natural awakenings central ohio - january 2016 issue

2016

H E A L T H Y L I V I N G H E A L T H Y P L A N E T

feel good • live simply • laugh more

Health and Wellness

JANUARY 2016Central Ohio Edition

NACentralOhio.com

FREE

Super Soups

Good Reasons to Try Acupuncture

Functional Medicine

Gets to the Root of Illness

2 Central Ohio NACentralOhio.com

3natural awakenings January 2016

Natural Awakenings Central OhioPO Box 4056

Dublin, OH 43016Phone: 614-427-3260

Fax: 614-455-0281 [email protected]

www.NACentralOhio.com

PublisherSean Peterson

EditorsJim FroehlichJenny Patton Marge Veeder

Laurie Zinn

Design & ProductionPatrick Floresca

Ad DesignCharles Erickson

Ryan Mackey

Ad SalesLiz Jaggers

Franchise SalesAnna Romano239-530-1377

© 2016 by Natural Awakenings. All rights reserved. Although some parts of this publication may be reproduced and reprinted, we require that prior permission be obtained in writing.

Natural Awakenings is a free publication distributed locally and is supported by our advertisers. It is available in selected stores, health and education centers, healing centers, public libraries and wher-ever free publications are generally seen. Please call to find a location near you or if you would like copies placed at your business.

We do not necessarily endorse the views expressed in the articles and advertisements, nor are we re-sponsible for the products and services advertised. We welcome your ideas, articles and feedback.

SUBSCRIPTIONSSubscriptions are available by sending $24

(for 12 issues) to the above address.

Natural Awakenings is printed on recycled newsprint with soy- based ink.

contact us

letterfrompublishersWelcome to the January “Health and Wellness/Dance Power” issue of Natural Awakenings Central Ohio.

One of the greatest joys I get to experience in life is

watching my wife dance. She has a carefree fluid-

ity and an effortless, yet precise, motion about her

as she seamlessly shifts from the “shopping cart” to the “cab-

bage patch”, or from the “lawn mower” to the “sprinkler.” I

selfishly savor attending weddings for the mere fact that I get

to see my wife bust a move post-dinner. This is, of course, in

addition to supporting those who care enough about me to invite me to their

special day.

I, on the other hand, am not much of a dancer at all. Maybe it is because I

am a middle-aged white man, or perhaps because since birth I have never pos-

sessed the necessary genes to let my body groove to the music. In any case, my

dancing skills are not up to par. I have made my peace with that, and instead I

live vicariously through observing others’ abilities to shake their tail feathers.

My oldest son takes after my wife in the dancing department. He has the

wherewithal and the internal calibration to construct body motions that resem-

ble structure and linear movement. This past summer’s dance hit “Watch Me

(Whip/Nae Nae),” repeatedly replicated and posted to YouTube by pop culture

references ranging from Michelle Obama to members of the reunited cast of

hit late 80s/early 90s sitcom Full House, also struck a chord in our household.

When I watch my son do the “superman” and “bop” along to the song’s se-

quence of commands, it hearkens back to the sheer exhilaration and pure fun

my wife exhibits when she gets in the dance zone on the parquet floor.

Oprah Winfrey recently produced and narrated a miniseries called Believe

that aired on her OWN channel this past fall. The program was about the variety

of religious beliefs around the globe, but also the cultural practices that accom-

pany various religions.

In one episode, it profiles a woman named Karen Cavanaugh who suffered

a near-fatal accident and fell into a coma. In this beleaguered state, a singular

poem by the Sufi mystic Rumi was at the fore of her mind. When she came to,

doctors told her she would not walk again. Despite the prognosis, she vowed

eventually to be able to dance. Subsequently, she pursued the Sufi religion and

its practice of Whirling Dervishes, those who use dance movement as a medi-

tation and form of healing. Karen’s story is inspiring because it demonstrates

healing can come in many forms, not the least of which is dancing.


HOW TO ADVERTISE To advertise with Natural Awakenings or request a media kit, please contact us at 614-427-3260 or email [email protected]. Deadline for ads: the 15th of the month.

EDITORIAL SUBMISSIONSEmail articles, news items and ideas to: [email protected]. Deadline for editorial: the 15th of the month.

CALENDAR SUBMISSIONSEmail Calendar Events to: [email protected] or fax to 614-455-0281. Deadline for calendar: the 15th of the month.

REGIONAL MARKETSAdvertise your products or services in multiple markets! Natural Awakenings Publishing Corp. is a growing franchised family of locally owned magazines serving communities since 1994. To place your ad in other markets call 239-449-8309. For franchising opportunities call 239-530-1377 or visit NaturalAwakeningsMag.com.

advertising & submissions

NACentralOhio.com

Natural Awakenings is your guide to a healthier, more balanced life. In each issue readers find cutting-edge information on natural health, nutrition, fitness, per-sonal growth, green living, creative expression and the products and services that support a healthy lifestyle.

6 newsbriefs

8 communityspotlight

10 healthbriefs

14 healthtip

16 globalbriefs

22 healingways

26 fitbody

29 inspiration

30 consciouseating

33 naturalpet

34 greenliving

38 localperspective

40 wisewords

42 healthykids

46 calendar

48 classifieds

51 naturaldirectory

contents

18 FUNCTIONAL MEDICINE GETS TO THE ROOT OF ILLNESS by Lisa Marshall

22 GOOD REASONS TO TRY ACUPUNCTURE Thousands of Studies Show Healing Results by Kathleen Barnes

26 THE POWER OF CONSCIOUS DANCE Creative Movement Connects Body, Mind and Spirit by Gail Condrick

29 EMBRACING A REDEFINING MOMENT by Dennis Merritt Jones

30 SUPER SOUPS New Twists on Old Favorites Heal, Nourish and Soothe by Judith Fertig

33 THE RIGHT VET FOR YOUR PET Animals Thrive with Gentle, Safe and Natural Approaches by Shawn Messonnier

34 IT’S EASY TO BE GREEN At Home and On the Road by Avery Mack

40 BRUCE LIPTON ON WHY BIOLOGY IS NOT DESTINY by Linda Sechrist

42 PRACTICAL WAYS TO PREVENT AND TREAT AUTISM by Meredith Montgomery

18

10

22

33

42

16


14


newsbriefs

welldone

Local Restaurateur Opens Grocery Store

Portia Yiamouyiannis, founder of Portia’s Café,

will open Clintonville Natural Foods in January. The new health food store is located within a block of her vegan restaurant. The market will offer grab-and-go prepared meals, healthy raw snacks,

fresh local produce and select supplements, as well as bulk beans, grains, flours and herbs. The selection will focus on, but is not limited to, gluten-free, vegan, organic and GMO-free products. “The goal is to provide the community what it needs, while being conscious of the health of our customers and of the planet,” says Yiamouyiannis.

Location: 4398 Indianola Ave., Columbus. For more infor-mation, visit PortiasCafe.com.

Central Ohio Elite Cyclist Stars in Commercial

Local resident Noelle Bar-tholdi, the newly appointed

Membership Captain for all-female competitive cycling club Lady Gnar Shredders, is featured in a new commercial filmed by Emmy-nominated director Dave Docimo. Bartholdi rode over 100 miles during filming to capture enough raw footage for the 60-second spot. The commercial is for Owensboro Health, a regional

Kentucky health care system. It focuses on the organiza-tion’s cancer treatment program and touts the tagline “Here, cancer fears us.” Bartholdi is also the leader of a wellness company that provides healthy initiatives, such as yoga and plant-based meal planning, to professional sports teams, corporations and athletic clubs. She recently started a program, called ReAwaken Yoga, for cancer survivors, those in recovery, and people of all ages who want to fortify themselves from developing cancer. She also teaches fitness programs such as spinning and Pilates.

For more information, contact [email protected]. Also visit Vimeo.com/146966149 and LadyGnarShredders.com.

Ohio Manufacturer Wins National Award

for Snack Products Urban Raccoon, a healthy snack food maker based in Medina, Ohio, won the 2015 Consumer

Packaged Goods (CPG) Editor’s Choice Award for its Coconut Grainless Paleo Bar at an annual industry tradeshow, SupplySide West. The event was held Octo-ber 7 and 8 at Mandalay Bay Resort in Las Vegas. The expo’s editorial team distributes awards for achievement in market impact and innovation in 18 in-dividual categories; Urban Raccoon won in the bar cat-egory. “The food industry is moving at a very fast pace to meet the growing consumer demand for cleaner ingredients,” says Brad Indoe, president and founder of Urban Raccoon. “Our grainless paleo bar line uses natural ingredi-ents to provide protein, low carbs and no added sugar.” Indoe started Urban Raccoon four years ago after he was diagnosed as gluten intolerant.

For more information, call 949-244-1354 or visit UrbanRaccoons.com.

Registration Opens for Ohio Sustainability Conference

Attendees may now sign up to take part in the 37th install-

ment of Ohio’s largest sustainable food and farm conference pro-duced by Ohio Ecological Food and Farm Association (OEFFA). The three-day event will take place from February 12-14 in Granville, Ohio. The keynote speakers for the festival this year are Lindsey Lusher Shute, member of National Young Farmers Coalition, and John Ikerd,

a leading national expert on agricultural economics. The event draws over 1,200 attendees from Ohio and through-out the U.S. The conference offers nearly 100 workshops that span a range of topics, including sustainable farming, gardening, homesteading, cooking, food and farm policy, livestock and poultry production, business management and research. Other highlights include Saturday evening entertain-ment, a trade show, a seed swap, kid and teen conferences, child care, locally-sourced meals and a raffle.

For more information, or to register, visit OEFFA.org/ conference2016. See ad, page 41.


feel good • live simply • laugh more

Now Enrolling!

“The skills I learned in the acupuncture program provided a strong base for practicing various ways of healing.”

Experience a reputation of quality: •Hands on clinical training with patients

• Option to study abroad on trip to China

• Trusted education in Traditional Chinese Medicine

School & Clinic: 6685 Doubletree Ave. Columbus, OH•(614)825.6255•www.aiam.edu Find graduation rates, median debt of students and more at our website. Click the disclosure links on any program page.

1489-T

— Stacey Kent, L.OM (Acupuncture Class of 2004) AIAM Director of Clinical Services & Oriental Medicine Practitioner

Vaccination RequiredCalifornia Mandates Shots for Childcare WorkersAfter passing the state House and Senate, California Senate Bill 792 was approved by Governor Jerry Brown on October 11. The unprecedented law mandates vaccines for adult childcare workers and volunteers, including all individuals working in private and public school early childhood education programs, with no religious exemptions permitted. SB 792 reads, “Commencing September 1, 2016, a person shall not be employed or volunteer at a day care center if he or she has not been immunized against influ-enza, pertussis [whooping cough] and measles. Each employee and volunteer shall receive an influenza vaccination between August 1 and December 1 of each year.” The same regulations also apply to family home day care workers and volun-teers. Failure to comply with these requirements can result in a loss of licensing for the facility/center.

For more information, visit Tinyurl.com/californiasb792. Let California lawmakers hear what the people want via Legislature.ca.gov.

actionalert

With the new day comes new strength and new thoughts.

~Eleanor Roosevelt


communityspotlight from 50 years to brand new business owners, and they support each other through mentorships. “We have members in their late 70s who have been doing what they do for 50 years. Then we have people who have just finished their Reiki level two and they are going to try to launch a practice,” Cooksey says. “That’s a richness of it as well, that people can learn from each other.” The All Life Community helps its members recognize the six domains of the integrative health model that serves as its foundation: beliefs, biol-ogy, mechanics, knowledge, mind/body and energy. In 2002, Cooksey opened a com-munity integrative health center in Upper Arlington, which was acquired by OSU in 2005. She said the All Life Community is different from OSU or any other community integrative health center because it is not af-filiated with a hospital, an academic institution or an individual. Instead, it is a nonprofit commu-nity organization based on a coop-erative model where members are individual business owners. “The All Life Community supports them with resources, opportunities to participate in treatment teams and other integrative initiatives, quarterly open houses for members and the public, and quarterly member meet-ings,” she says. She also adds that everyone can use the common areas, and members/partners can rent private rooms at affordable rates for as little as one hour per month or as many as 40 hours per week. Members have access to a kitch-en, conversation rooms, multi-purpose rooms, spas, studios, treatment rooms and a group acupuncture room. Last July the center opened an outdoor atrium building with windows on all sides, and a boardwalk that winds around the grounds. The spaces have been used for private practice, and to host continuing education seminars, parties, company benefit events, and even weddings and baby showers. Cooksey says the All Life Com-munity has plans to grow its member benefits in 2016. They are compiling a preferred vendor list that will contain small business support contacts for

On 24 serene acres of preserved land in southern Delaware County lies nestled a beautiful

facility acting as a centralized hub for the community of health and well-ness-focused professionals in Central Ohio. The All Life Community and All Life Center are both available to health care providers, business owners and members of the community. The All Life Center for Integrative Well Being opened its doors in July of 2013. The broader All Life Community offers its members/partners a framework of collaboration and support, allowing them to be more holistic and resourced in their approach to business. Co-founder and President Melin-da Cooksey is a gross anatomist with a doctorate in integrative medicine from The Ohio State University. She describes the All Life Community as a way to bring “pockets” of practitioners together to help each other.

“We’re a really comprehensive resource pool for Central Ohio that takes all of those different groups of great people and helps make them better accessible to each other and to people who need their services,” Cooksey says. The All Life Community has 120 members who are health and wellness providers, artists, educators, physi-cians, life coaches, acupuncturists and massage therapists. About 10 percent of All Life Community members/partners use the All Life Center as a full-time or part-time practice site, or sporadically for classes, workshops and other special events. The majority of All Life Community members and partners are spread throughout central Ohio, contributing to the area’s vast resource network. Anyone or any type of business can get involved and sup-port the All Life Center. Members range in experience

The All Life Center One-Of-A-Kind Model

Offering Collaboration, Resources and Community

by Laurie Zinn


PAIN FREE, RADIATION FREE BREAST SCREENING

BREAST THERMOGRAPHY A “DO NO HARM” APPROACH

TO BREAST SCREENING AND EARLY DETECTION

WESTERVILLE & LEWIS CENTER LOCATIONS WWW.OHIOINFRAREDHEALTH.COM

(614) 636-3362

FDA APPROVED

SCANS INTERPRETED BY A MEDICAL DOCTOR

FEMALE TECHNICIAN

FULL BODY SCANS

NO PRESCRIPTION NEEDED

business services such as accountants, marketing profes-sionals, social media experts and graphic designers, as well as event planning resources such as caterers, event planners and photographers. They also plan to add more allied health profession-als to their membership, such as optometrists, dentists and family physicians. Beginning in 2016, the All Life Community will offer health screenings twice a year where people can get a physical in addition to the screens offered by their mem-bers/partners. “A lot of the people who use these services spend a lot of money every month on yoga classes and acupuncture and supplements, and then they don’t get physicals,” Cook-sey says. “They don’t know what their resting heart rate is, and they have no idea what their blood glucose levels are. It’s about being integrative and really rounding that out for people, and helping it feel like a piece of their health care that they can use.” As it offers a collaborative community for its members/partners, the All Life Community relies on accomplishing its goals through member and partner support.

For more information, call 740-201-8242 or visit AllLife-Community.org.

Laurie Zinn is a Columbus-based freelance writer and the owner of Line-By-Line, a digital content management ser-vice for websites, blogs, email marketing and social media. Connect at [email protected].


healthbriefs

Feel Young, Live LongResearch published in the Journal of the

American Medical Association has found people that feel younger than their years have a lower incidence of earlier mortality. Conducted by scientists from the UK’s Uni-versity College London, the research ana-lyzed data from 6,489 people and measured their self-perceived age with the question, “How old do you feel you are?” Then, over more than eight years, the scientists tracked the number of deaths from all causes. Almost 70 percent of those that averaged a little over 65 reported feeling at least three years younger than their chronological age. Only a quarter said they felt close to their age and about 5 percent said they felt more than a year older. The research found that deaths among those that felt younger were 14 percent, while more than 18 percent of those who felt their own age and more than 24 percent of people that felt older died during the follow-up period. The research further found that individuals that felt at least three years younger were less likely to die later from heart disease or cancer. These relationships prevailed even when other health and lifestyle factors were eliminated. Co-author Andrew Steptoe, Ph.D., says, “We expected to find an asso-ciation between self-perceived age and mortality. We didn’t expect that the relationship would still be present even when wealth, other socio-demographic indicators, health, depression, mobility and other factors were taken into ac-count.”

Vitamin E and D Supplements Hinder Alzheimer’s and Falls Among Elderly

Two common vitamins are making headlines in medical research. A recent study published in the

Journal of the American Medical Association found that supplementation with vitamin E may reduce the progression of Alzheimer’s disease. The five-year study followed 561 Alzheimer’s pa-tients and included a placebo and the pharmaceuti-cal drug memantine. Those that took vitamin E had a reduced progression of the disease compared to both a placebo group and the memantine group. Also, researchers from the Wake Forest Baptist Medical Center found that vitamin D supplementa-tion reduced the risk of falling for elderly folks. The study had a vitamin D supplement or a placebo

delivered through a Meals-on-Wheels program to 68 people. The subjects were given blood tests and their history of falls was measured. Diaries revealed that the individuals taking vitamin D supplements fell less than half the number of times than the placebo group.


Autism Spurs Creative ThinkingThe UK’s University of East Anglia

and the University of Stirling con-ducted a study of individuals with au-tistic traits among 312 people recruited through social media, including 75 diagnosed with autistic spectrum dis-order. Each of the subjects completed a series of creativity tests in which they determined uses of mundane objects. Published in the Journal of Autism and Developmental Disorders,

the study found that while the autistic people chose fewer uses for each object, their choices were significantly more original and creative. The subjects devel-oped a greater range of “divergent thinking”. Martin Doherty, Ph.D., co-author of the study, confirms, “People with high autistic traits can have less quantity, but greater quality of creative ideas. They are typically considered to be more rigid in their thinking, so the fact that the ideas they have are more unusual or rare is surprising. This difference may have positive implications for creative problem solving.” The researchers found that while the average person will utilize simple mental strategies to produce more obvious answers first, autistic people tend to first utilize more demanding strategies during their processing, thus produc-ing the more creative result.

Sunlight Reduces Risk of Pancreatic Cancer Researchers from the University of California (UC)

School of Medicine at San Diego have determined that regions with greater exposure to ultraviolet (UV)-B radiation from the sun and reduced cloud cover have significantly lower incidence of pancreatic cancer. In an analysis of global rates of the disease, the research, published in the Journal of Steroid Bio-chemistry and Molecular Biology, demonstrated that areas with more sunshine had only one-sixth of the pancreatic cancer rates of areas with less sunshine. The farther from the equator, the less is the exposure to UV-B radiation, leading to less body production of vitamin D. Study author Cedric F. Garland, doctor of public health, a UC professor and member of the UC San Diego Moores Cancer Center, says, “If you’re living at a high latitude or in a place with a lot of heavy cloud cover, you can’t make vitamin D most of the year, which results in a higher-than-normal risk of getting pancreatic cancer.” According to World Cancer Research Fund International, 338,000 new cases of pancreatic cancer are diagnosed annually, and it is the seventh most lethal form of cancer.

Leave Them at the Door: Shoe Soles Harbor Risky BacteriaResearch from the University of

Houston has determined that a species of bacteria that has become resistant to many antibiotics might be tracking into homes on the soles of shoes. More than a third of randomly tested homes were contaminated with Clostridium difficile bacteria, and 40 percent of doorsteps were also infected with the bacteria. Depending upon the strain, C. dif-ficile can cause intestinal infections, inflammation and severe diarrhea. Study author M. Jahangir Alam, Ph.D., comments, “Shoes are con-taminated from diverse sources, and we are regularly contaminating our doorsteps by shoes.” The researchers tested three to five household items within 30 houses in Houston, Texas. They col-lected 127 environmental samples—from 63 shoe bottoms, 15 bathroom surface samples, 12 house floor dusts and 37 other household surfaces They found that 41 of them harbored C. difficile and nearly 40 percent of the shoes were positive for the bacteria. They also found that a third of the bathroom surfaces har-bored the bacteria, a third of house dust and 19 percent of other surfaces maintained the bacteria. The cause of many intestinal disorders, this bacteria species has become increasingly resistant to antibiotics and many household cleaning products.

Darkness cannot drive out darkness; only light can do that. Hate cannot drive out hate; only love can do that.

~Martin Luther King, Jr.


healthbriefs

Scientists Urge Ban on Non-Stick Pan CoatingsA new paper published in the Environmental Health

Perspectives journal warns of the con-tinued health risks of chemicals used for non-stick pan coatings and water repel-lents on clothing. The chemical is being found in some municipalities’ drinking water. More than 200 scientists signed the statement, which presents the dan-gers of poly- and perfluoroalkyl substances (PFAS). These chemi-cals are persistently used as pan coatings, despite more than a decade of research showing associations with liver toxicity, neurological disorders, cancers of different organs and types, and heart conditions. The paper noted that many manufacturers have discontinued long-chain PFAS production and substi-tuted shorter-chain PFAS. The scientists caution that these shorter-chain PFAS may not effectively reduce PFAS ex-posure because more has to be used to achieve the same effectiveness, maintaining PFAS in the environment with exposure levels relatively unchanged. It calls for scien-tists, governments, chemical manufacturers and consumer product manufacturers to participate in halting all PFAS production.

Playing Outside Before Lunch Spurs Kids to Eat HealthierResearchers from

Brigham Young University and Cornell University have deter-mined that simply mov-ing recess to precede lunch significantly increases students’ con-sumption of fruits and vegetables at lunch. The researchers tested first- through sixth-graders from seven schools in Utah for 14 school days. In three schools, recess was switched from after to just before lunch. In the other four schools, recess still followed lunch. Published in the journal Preventative Medicine, research found that when recess was just prior to lunch, students ate 54 percent more fruits and vegetables. Moving recess also resulted in 45 percent more kids eating at least one serving of fruits and vegetables during school-provid-ed lunches. The researchers concluded that results show the benefits of holding recess before lunch and suggest that if more schools did this, there would be significant increases in fruit and vegetable consumption, particularly among students that eat school lunch as part of the National School Lunch Program.


Respect

Only the Finest Organic Materials

T. Y. F I N EFURNITURE

tY

your sleep

We carry the only certified organic

mattresses in Central Ohio

Health, Luxury, and Quality Without Compromise

614-929-5255 106 East Moler Street Next to Historic German Village

www.TYFineFurniture.com--

Complimentary Delivery with this Ad


Easy and Effective Ways to Shed Belly Fat by Trudy Pieper, ND

Not only does belly fat look bad, but it is also potential-ly harmful to overall health. Fat concentrated around

the abdomen can lead to diabetes, heart disease, stroke and even dementia. In addition to a reduction of sugar in the diet, adding healthy vegetables and fruits, getting enough sleep, and regular whole-body workouts with both cardiovascular exercises and strength training, here are three easy and effective tips.

Detox With Lemon WaterThe liver should be detoxified so it can ef-fectively metabolize the fat that is depos-ited around the waistline. Lemon water increases enzymes that detoxify the liver so it is able to carry out its basic functions more efficiently. Squeeze the juice from half a lemon into a warm glass of water, and drink it first thing every morning.

Burn More FatCinnamon and ginger are ther-mogenic herbs, meaning they increase body temperature and thereby help burn fat more ef-fectively. Include one teaspoon

of ground cinnamon on top of beverages, toast, cereal, or in a daily smoothie. Ginger can also suppress the produc-tion of cortisol, a compound that promotes the develop-ment of belly fat. Have a cup of ginger tea after dinner to help with digestion and burn fat.

Shed Retained FluidDandelion leaf will help if belly fat is primarily due to water retention. The plant is a natural di-uretic, increasing urine output. It will flush retained water and toxins out of the body, especially from abdominal bloating. It will also improve the liver’s func-tioning capacity. Drink it daily as a tea, or ingest capsules of it twice each day.

Trudy Pieper is a Naturopathic Doctor with Phoenix Well-ness Center, in Johnstown. For more information, call 740-616-9949 or visit PhoenixWellness4U.com. See ad, page 54.

healthtip

What Better Time To Find That Special Someone!

Join for FREE at NaturalAwakeningsSingles.com

J oin the largest database of health-conscious, eco-minded and spiritual singles now and manifest an extraordinary relationship!

Order online today atShopNaturalAwakenings.com

or call: 888-822-0246

A Few Drops Can Change Your Life!

You could feel better, lose weight or increase energy and mental clarity with a few drops of Natural Awakenings DETOXIFIED IODINE daily when used as directed. The replacement of iodine, an essential component of the thyroid, has been reported to give relief from depression, hyperthyroidism, hypothyroidism, radiation, viruses and more.

$19.99 plus $5 shipping • 1 btl. = 6-8 week suply

Like us on Facebook at Natural Awakenings Webstore


healthbriefsglobalbriefsecotipsgreenlivinghealingwayshealthykids

consciouseatingwisewordsfitbodyinspirationnaturalpet

departments themes

JANUARY health & wellness plus: dance power

FEBRUARY friendship plus: dental health

MARCH food matters plus: eye health

APRIL everyday sustainability plus: freshwater scarcity

MAY women’s wellness plus: thyroid health

JUNE happiness plus: balanced man

JULY independent media plus: summer harvest

AUGUST empowering youth plus: creativity

SEPTEMBER healing music plus: yoga

OCTOBER community game changers plus: chiropractic NOVEMBER mental wellness plus: beauty

DECEMBER uplifting humanity plus: holiday themes

2016 editorial calendar


globalbriefsNews and resources to inspire concerned citizens to work together in building a healthier, stronger society that benefits all.

Drive-Thru VeganAmy’s Opens Organic Fast Food RestaurantCalifornia now hosts the nation’s first Amy’s Organic Drive-Thru restaurant, in Rohnert Park, with a vegetarian menu sporting veggie burgers, salads and dishes served in both regular and vegan varieties. Ingredients are sustainably grown and GMO-free (no genetically modified ingredients). The company’s signature frozen pizzas have been popular for yearsin health food and grocery stores nationwide, and now Amy’s first restaurant is serving them hot, with toppings ranging from spinach and diced tomatoes to a choice of mozzarella cheese or vegan “cheeze”. While some other fast food restaurants import almost all of their products from factory farming operations and give nothing back to the community, Amy’s Drive-Thru grows produce sustainably on its own roof. Amy’s Kitchen, a family-owned, privately held organic frozen food company, reportedly pays workers a living wage with health benefits. On the inaugural restaurant’s popularity, Manager Paul Schiefer remarks, “It’s given us a lot of hope that this is a concept that works.”

OM MBAEastern Practices Penetrate U.S. Corporate CultureAetna CEO Mark Bertolini has introduced free yoga and meditation classes for employees of the health insurance giant, and more than 13,000 are participating. On aver-age, they experienced a 28 percent reduction in their stress levels, 20 percent improvement in sleep quality, 19 percent reduction in pain and 62 minutes per week of extra productivity. “We have this groundswell inside the company of people wanting to take the classes,” says Bertolini. “It’s been pretty magical.” He sells the same classes to businesses that con-tract with Aetna. Google now offers emotional intelligence courses for employees and General Mills has a meditation room in every building on its Minneapolis corporate campus. Even conservative Wall Street firms such as Goldman Sachs are teaching meditation on the job. Some programs, from yoga ses-sions for factory workers to guided meditations for executives, are in-tended to improve overall well-being; others to increase focus and produc-tivity. Most aim to make employees more present-minded, less prone to make rash decisions and generally nicer people to work with. More than 21 million individu-als now practice yoga nationwide, double the number from a decade ago, and nearly as many meditate, according to the National Institutes of Health.

Source: MindfulYogaHealth.com

Fish FollyMarine Life Drops by Half since 1970The nonprofit World Wildlife Fund (WWF) and the Zoological Society of London have jointly determined that industrial-scale overfishing, pollution and climate change have killed half of all marine life over the last 40 years. The Living Blue Planet Report cites that species essential to the global food supply are among the hardest hit, partially due to humans catching them faster than they can reproduce. Large swaths of coral reefs, mangroves and sea grasses have also died, further decimating fish populations.

Statistics show that the family of fish that includes tuna and mackerel has declined by 75 percent since 1970. The number of species is also declining; a quarter of all shark and ray species face extinction. Half of all coral has already disappeared, and the rest will vanish by 2050 if temperatures continue to rise at current rates. “Coral reefs occupy less than 1 percent of the ocean surface, but they harbor a third of ocean species,” says French biologist Gilles Boeuf. The WWF report argues that protected global ocean area should be tripled by 2020 and fish retailers should source from companies that follow certified best practice standards.

Source: Tinyurl.com/WWF2015BluePlanetReport


Puppy CuddlesStudents De-Stress by Petting DogsAt least three universities in England have offered puppy rooms to stressed students. More than 600 students signed up last year in Bristol alone. Gordon Trevett, from the University’s Centre for Sport, Exercise and Health, says, “Every year I see stu-dents fretting about their exams, and I thought this would be a great way to ease the stress and take their minds off it. People with dogs have lower blood pressure in stressful situations than those without a dog, and we know that playing with a dog can elevate levels of serotonin and dopamine, which calm and relax.” Jo Woods, from the Bristol Students Union, says, “It’s important to do fun and different things to de-stress during exams, and cuddling a puppy is a perfect way to release some endorphins.”

Source: BBC

Sci-Fi SolutionBeaming Solar Power to Earth from SpaceA great deal of solar power falls on our planet, but a lot more misses us and goes off into space. Scientists at JAXA, Japan’s space administration, have made a major breakthrough in accurate wireless power transmission on Earth that bodes well for solar space technology. The team beamed 1.8 kilowatts of power, enough to power an electric tea kettle, more than 50 meters to a small receiver without any wires whatsoever.

The researchers were able to accomplish this task by first converting the electrical energy to microwaves, and then beaming them to a remote receiver before converting them back into electrons. The program’s goal is to harness a constant supply of solar energy directly from space using orbital solar farms, and then beam that energy for use on Earth. Solar power generation in space has many advantages over current technology, including the constant availabil-ity of energy regardless of the weather or time of day.

Source: Global.jaxa.jp

Unique CharacterSesame Street Addresses AutismAfter working with organizations such as Autism Speaks and the Autism Self Advoca-cy Network, Sesame Street has been aiming to help reduce the stigma associated with autism spectrum disorder. A new autistic character, Julia, already has her own digital storybook, We’re Amazing, 1,2,3 as part of the campaign See Amazing in All Children.

According to Dr. Jeanette Betancourt, senior vice president of U.S. social impact at Sesame Workshop, Sesame Street producers are waiting to hear back from the autism community before introducing Julia to the TV show.

For more information, visit Autism.SesameStreet.org/storybook-we-are-amazing and Tinyurl.com/MeetJuliaVideo.

Doctor’s OrdersGMO Labeling Endorsed by PhysiciansEven as the federal government pursues H.R. 1599, aka the “Deny Americans the Right to Know” (DARK) act, mainstream medicine is urging the government to abandon its resistance to GMO (genetically modified organism) labeling. They are bolstered by a recent announce-ment by the World Health Organi-zation that glyphosate (the active ingredient in Monsanto’s Roundup weed killer) is probably carcinogen-ic in humans. The genetic engineer-ing ends up making crops resistant to the herbicide so more must be applied. According to contributing doctors from Harvard, Mt. Sinai Medical Center and the University of Wiscon-sin reporting in the New England Journal of Medicine, “GM crops are now the agricultural products most heavily treated with herbicides, and two of these herbicides may pose risks of cancer.” A recent notice in the same journal, “GMOs, Herbicides and Public Health,” reports: “The appli-cation of biotechnology to agricul-ture has been rapid and aggressive. The vast majority of the soy and [feed] corn grown in the United States are now genetically engineered. Foods produced from GM crops have become ubiquitous.” Sixty-four countries, includ-ing Russia and China, have already adopted transparency in labeling laws, but U.S. Big Food and Big Ag lobbyists have stonewalled efforts domestically.

For more information and petitions, visit OrganicConsumers.org.


By the end of 2014, Trina Mills, of Parker, Arizona, had given up on conventional medicine.

She’d been diagnosed with a thyroid disorder 17 years earlier and taken medication ever since without feeling her symptoms of fatigue, muscle aches and stomach problems ever fully sub-side. She’d visited endocrinologists, gastroenterologists and a half-dozen other specialists, each of which offered a different diagnosis and prescribed a different drug. At one point, she had her gall- bladder removed. At another, her doc-tor suspected she had bleeding in her brain and sent her for a computerized axial tomography (CAT) scan. Some thought she was a hypochondriac; oth-ers said she was depressed. “I would tell them, ‘I’m just depressed that you

Functional Medicine Gets to the Root of Illness

by Lisa Marshall

can’t figure out why I’m so sick,’” she says. Weighing a skeletal 82 pounds, the 54-year-old mother of three finally wrote out a living will and braced for the inevitable. Then she heard of a new Center for Functional Medicine opening at the prestigious, century-old Cleveland Clinic. As the first clinic of its kind to open at an academic medi-cal center, it promised to look at the underlying causes of disease, while focusing on the whole person, rather than isolated symptoms. Intrigued, Mills caught a flight to Ohio and soon was offering up 30 tubes of blood, stool and saliva samples, as well as an exhaustive life history. One year later, thanks to a se-ries of personalized diet and lifestyle changes, she’s 10 pounds heavier and

feels better than she has in decades. “I spent a lot of years and money in the traditional medical system and got nothing,” says Mills. With functional medicine, “In a very short time, they had me feeling nearly 100 percent.”

Distinctive Characteristics In the 25 years since nutritional bio-chemist Jeffrey Bland, Ph.D., of Gig Harbor, Washington, coined the term, this science-based, whole-body ap-proach to addressing chronic disease has gained widespread traction. More than 100,000 physicians—60 per-cent of them medical doctors—have trained with the Institute for Function-al Medicine he founded in Washing-ton and New Mexico, and numerous medical schools have added its tenets to their curricula. More naturopaths and chiropractors are also distinguish-ing themselves with a functional medicine emphasis. “It is not alternative medicine at all,” stresses Bland, whose latest book, The Disease Delusion, details how functional medicine can curb chronic diseases like arthritis, diabetes, de-mentia, and heart disease, which con-stitute 78 percent of U.S. health care costs. “It’s the basis of 21st-century health care,” he says. For most of the 20th century, conventional medicine centered on a singular objective: Arrive at a diagnosis and treat it with drugs or surgery. Then, the alternative medi-cine movement proffered a toolbox of more natural therapies, including acupuncture, herbs and massage to address these same diagnoses. The 1990s brought integrative medicine, a best-of-both-worlds approach. “While all of the above have merit, they lack the necessary guid-ance to help practitioners determine which tools work best for which patient,” says Dr. Mark Hyman, direc-tor of the Cleveland Clinic’s Center for Functional Medicine. “Alternative therapies and conventional treatments are tools. We need a new map that can teach us how to skillfully use those tools,” maintains Hyman. “That map is functional medicine.” Because one chronic disease such as diabetes can have dozens of underlying causes, or one culprit such


[optional sidebar]

We are the only center in the area to teachReiki classes in the traditional method.

* ENERGY HEALING:Reiki, Reflexology, Sound Healing, Essential Oils

* BODYWORK:Massage Therapy, Shiatsu, CranioSacral Therapy

* ANIMAL THERAPIES:Animal Reiki and CranioSacral Therapy, Dog Massage

* INTUITIVE SERVICES:Readings, Counseling, Dreamwork

* OTHER:Detox Foot Spa, Numerology, Classes, Gift Shop

The Reiki Center1540 West Fifth Avenue, Columbus

[email protected]

Open Daily

614-486-8323

Discover Central Ohio'soldest and largest

natural wellness center

We offer:

Infant - School Age Children

Homemade Organic Meals

Tuition includes diapers, wipes, blankets, sheets and

organic food

www.BarringtonSchool.com

POWELL: 10655 Sawmill Pkwy.

614-336-0000

DUBLIN: 6046 Tara Hill Dr.

614-336-3000

NOW ENROLLING! Call 614-336-3000 for more information!

2 NEW LOCATIONS OPENING IN MAY!

HILLIARD - CEMETERY RD. COLUMBUS - THE INTERSECTION

OF BETHEL AND SAWMILL RDS.

The

Barrington Schoolwhere learning begins

What you do today can improve all of your tomorrows. ~Ralph Marston


as a genetic predisposition or expo-sure to toxins can lead to multiple chronic conditions, functional medi-cine focuses on systems, rather than organs, and origins, rather than diseas-es. “It’s about listening to the patient’s story in a different way, where the objective is not simply about arriving at a diagnosis,” explains Bland.

Ferreting Out Key CluesKey to discovering the underlying origins of a health issue are a host of new gene, blood and gut health tests. “They allow us to look under the pa-tient’s ‘metabolic hood’ at the genetic and biochemical factors influencing health,” says Naturopathic Doctor Kara Fitzgerald, who heads up a func-tional medicine clinic in Newtown, Connecticut. For instance, certain genes influ-ence how a person burns and stores fat. Depending on which variant a patient has, based on a genetic test, they might be guided toward a higher- or lower-fat diet. Those genetically prone to difficulty in metabolizing the amino acid homocysteine (an excess of which can raise the risk of heart disease) might be advised to take folic acid supplements. If a patient displays intractable gut problems, rather than simply look for blood or pathogens in the stool, Fitzgerald also looks at the DNA of

their gut microbiome, mapping out which strains of good bacteria are present or absent and prescribing prebiotics, probiotics or whole foods to promote a healthful balance. For another patient with thinning hair and aching joints, she might use specialized blood tests to look for micronutrient deficiencies, signs of al-lergies or certain autoantibodies—pro-teins produced by the immune system that mistakenly attack one’s own tissues—that might herald a brew-ing autoimmune disorder. “Research shows that predictive autoantibodies can show up in the blood 10 or even 20 years before an autoimmune dis-ease such as Type 1 diabetes, multiple sclerosis or rheumatoid arthritis makes itself known,” says Fitzgerald, pointing to a seminal review published in 2007 in Scientific American: “If a patient with mild, early-stage symptoms is proactive with diet and lifestyle changes, they may be able to fend it off.” High-tech tests aside, Bland stresses that what’s most important is “a tool that has been largely lost in medicine today: Knowing how to listen to the patient.” In a typical exam, Fitzgerald thor-oughly inspects often neglected body parts, including the tongue and finger-nails, which can hold important clues to underlying health. She asks about

past emotional trauma which might trigger chronic disease, and inquires about what environmental toxins and harmful chemicals both the patient and their birth parents may have been exposed to. One example might be a patient exposed to cigarette smok-ing in utero having a bias toward an allergic disease. If their parents grew up in a period of famine, they might have inherited a genetic disposition for rapid weight gain. “She spent two-and-a-half hours with me,” in her initial consultation, recalls 52-year-old Lauren Zambrelli, of Long Island, New York, who credits Fitzgerald for helping her tame her multiple sclerosis into remission. “It was like having a sister for a doctor.”

Who PaysFunctional medicine doctors don’t shy away from prescription drugs when necessary, but they do lean decidedly toward the lower-tech modalities, us-ing dietary supplements, allergen-free diets, exercise, mind-body practices and toxin avoidance as their primary tools. “We basically take out the bad stuff from the body and put in the good stuff,” says Hyman. Maintaining good health is price-less, but without conventional insur-ance coverage, it can be expensive. While Mills’ doctor visits were cov-ered by insurance (which is rare), she

Vegetarian Vegan Organic Gluten-Free Non-GMO Local Natural Food & Products

Phone:(614)476-6159 www.itsall-natural.com

1360 Cherry Bottom Road, Gahanna, OH 43230

/itsallplantbased @allplantbased /allplantbased/

Vendors of the MonthKick Salsa

Willowbeez SoulvegLet's Get Bked

JOIN THE VEG CLUBVeg Meetup, Share Recipes &

More SavingsOpen to vegan and non-vegan communities

New Year, New YouNew Goal, New Savings


Lobby for ChangeTo lobby for consistent insurance coverage of more complementary thera-pies, check out these resources. CoverMyCare (CoverMyCare.org). This national grassroots advocacy campaign, a project of the Integrative Healthcare Policy Consortium, aims to support the proper full implementation of Section 2706 of the Affordable Care Act, which states that insurers cannot leave licensed practitioners like naturopaths, chiropractors, massage therapists or Oriental medicine practi-tioners out of their provider networks. It still lacks enforcement at the state level, although Oregon and Rhode Island recently passed legislation to fix the existing loophole; California, Hawaii, Minnesota and New Mexico are working to do the same. American Sustainable Business Council (Tinyurl.com/Integrative Reimbursement). The organization recently launched a campaign to urge insurers to cover integrative practices.

DIY TestingWhile most

practitioners recommend that patients consult with a physician to interpret their test results, several companies offer gene, blood and microbiome lab

testing directly to consumers. Here are a few options to consider. uBiome, Inc. (Ubiome.com): Send in swab samples from gut, mouth, nose, genitals and/or skin and the company will genetically sequence the DNA of resident bacteria and send findings back within six weeks, iden-tifying good and bad varieties present, deficiencies, and how that personal microbiome compares to others with similar lifestyles, such as smokers, veg-ans, meat-eaters, etc. It’s also possible to test a client’s microbiome over time to see if dietary changes implemented to change gut health are working. WellnessFX (WellnessFX.com): Visit an affiliated diagnostic lab to submit blood samples with results posted within a week on a secure website. Different packages target-ing weight loss, sports performance, heart health or women’s health is-sues look at different biomarkers in the blood, such as levels of certain micronutrients, hormones or signs of inflammation. Clients can request an online consultation with a doctor or dietitian to interpret the results. Pathway Genomics (Pathway.com): The company’s DNA Insight Genetic Health and Wellness Tests use genetic material taken from saliva to analyze genetic markers. Ordered via a licensed practitioner, online or through a smartphone app, clients receive a kit, send in a sample and get results within three weeks. The Pathway Fit tests snap-shot 75 genetic markers related to metabolism and sports performance. Others look for genes that influence nutrient absorption, heart health or hormonal function.

spends roughly $1,000 a month on supplements to address her diagnosed leaky gut syndrome, nutrient deficien-cies and mercury poisoning. Zambrelli has paid thousands out of her own pocket, too. Some people worry that, like most conventional physicians, some functional medicine practitioners place too much emphasis on expen-sive tests and too little on the most crucial and affordable remedy—self-care. “Functional medicine as a concept is an important step forward,” says integrative medicine pioneer Dr. James Gordon, founder of the Center for Mind-Body Medicine, in Washington, D.C., and San Francisco. “However, some practitioners do a lot of tests and prescribe a lot of supple-ments and work on cleaning out the gut, but neglect the psychological, spiritual and social issues. That con-cerns me.” Bland and Hyman concede that some practitioners over-test, but say that will fade over time as they learn to better discriminate which ones are useful for specific patients. Several efforts also are underway to get more functional medicine providers and the acupuncturists, massage therapists and nutritionists they work with covered under the Affordable Care Act, which expressly emphasizes a need for more preventive medicine. Viewing the big picture, Bland believes that functional medicine is just what the country needs to save

on exploding healthcare costs. Rather than spending dollars on extraordinary measures to save heart attack victims or diabetics in emergencies, we can prevent such dire situations by identi-fying underlying problems sooner and halting their progression. In the meantime, some patients are finding priceless relief. “Am I poorer right now? Yes,” says Mills. “Am I healthier? Way. It’s been so worth it.”

Lisa Marshall is a freelance health writer in Boulder, CO, who specializ-es in health care. Connect at LisaAnn Marshall.com.

Learn More Online

Cleveland Clinic Center for Functional Medicine Tinyurl.com/Center4 FunctionalMedicine

Dr. Kara Fitzgerald’s blog DrKaraFitzgerald.com/blog

Functional Forum FunctionalForum.com

Dr. Mark Hyman’s blog DrHyman.com/blog

Institute for Functional Medicine FunctionalMedicine.org


The ancient Chinese art of acu-puncture is gaining popularity in modern Western medicine for

many reasons. “There’s lots of research to support the effectiveness of acu-puncture for a wide variety of condi-tions,” says Thomas Burgoon, a medical doctor who practices internal medicine in West Chester, Pennsylvania, and is president of the American Academy of Medical Acupuncture, an association of doctors of medicine and osteopathic medicine that use acupuncture in con-junction with conventional treatments. Acupuncture treatments typically involve the nearly painless insertion of very thin needles to stimulate the body’s natural repair and regulation mechanisms based on the fundamental Chinese medicine principle that the inside of the body can often be treated from the outside. Burgoon explains that acupuncture works by stimulating and releasing the body’s natural pain reliev-ers, including endorphins, producing the feel-good brain chemical serotonin and relieving inflammation, as well as bringing many other body processes into normal function.

Good Reasons to Try Acupuncture

Thousands of Studies Show Healing Results

by Kathleen Barnes

healingwaysFind a local physician

trained in medical acupuncture at

MedicalAcupuncture.org/FindAnAcupuncturist

Brevard, North Carolina, li-censed master acupuncturist Paul Buchman, adds, “Acupuncture differs from conventional Western medicine in many ways, primarily in that when it treats a disease on the physical level, it also has far-reaching effects on our mental, emotional and spiri-tual aspects.” Chronic back pain: Chronic low back pain affects 80 percent of us at some time and is the second-most common cause of disability in Ameri-can adults, according to a University of North Carolina at Chapel Hill study published in the Journal of the Ameri-can Medical Association. A recent study of Australian patients arriving in Melbourne hospi-tal emergency rooms complaining of low back pain found that those treated with acupuncture experienced as much pain relief in an hour as those given drugs. “When I treat a person for low back pain, I always take pulses in several parts of the body, and then take into account many factors, including age, gender and life situation,” says

Buchman. “The underlying causes of the pain may be different in a 20-some-thing student with a stressful academic load than a 50-something woman that’s a recent empty nester redefining her future,” he explains. When researchers at China’s Central South University reviewed 13 studies on acupuncture and low back pain, they concluded that compre-hensive treatment plans that involve acupuncture are urgently needed. Headache: Acupuncture has long been used to relieve the pain of migraines and tension headaches. Aus-tralian research published in Evidence-Based Complementary and Alternative Medicine found that 16 acupuncture sessions cut in half the number of days that patients experienced migraines, significantly reducing pain. “Acupuncture is a must-try therapy for anyone with migraines or chronic or tension-type headaches,” says Burgoon. He notes that Aetna Insurance Company policy consid-ers acupuncture among accepted, medically necessary treatments for migraines, chronic low back pain, knee osteoarthritis, postoperative den-tal pain and nausea associated with surgery, pregnancy and chemotherapy. Asthma and allergies: More than 25 million Americans have asthma, including 6.8 million children. Dan-ish research published in the journal Alternative Therapies in Health and Medicine showed that 10 acupunc-ture sessions given over a three-month period reduced asthma symptoms and use of inhaled steroids, but only when acupuncture was ongoing. Benefits diminished when treatments were discontinued. German researchers at Berlin’s Charité University Medical Center found similar effects for sea-sonal allergies by comparing it with


No Needles Needed for Kids

by Kathleen Barnes

Acupuncture can be helpful for chil-dren, especially in treating

asthma, allergies and childhood diges-tive disorders, including colic, says Melanie Katin, a licensed acupuncturist who specializes in treating children in New York City. “Acupuncture for children rarely involves the use of needles. Since their qi (life force) flows very close to the surface of their skin, it doesn’t require a lot of movement to get things flowing in the right direction,” she explains. Acupuncture for kids typically involves light, fast brushing of the skin to encourage a healing circulation of energy. Katin teaches parents to continue treatments at home. She explains that it’s still technically acupuncture, not acupressure, which would involve prolonged stimulation of the body’s energy meridian sites. Sometimes she includes the use of small instruments for tap-ping or brushing the skin and tuning forks to stimulate the meridian points. She remarks, “The kids love it.”

the effects of antihistamines and sham acupuncture. “Patterns of bad health get more ingrained in our body systems as we get older,” says Melanie Katin, a licensed acupuncturist specializing in treating children in New York City and professor at the Pacific College of Oriental Medicine. “If we can catch an

illness in a child’s first seven or eight years, we may be able to prevent it from becoming chronic in adulthood.” Digestive problems: Acupuncture has been found to be effective for treating colic in babies, irritable bowel syndrome, morning sickness and post-operative nausea caused by anesthesia and chemotherapy treatments, verified

Solutions for your New Yearʼs resolutionsOrganic groceries • gluten-free foods • produce • cafe

• dairy and non-dairy products • vegan/vegetarian• personal care • nutritional supplements and more

A healthier, locally owned super foods grocery store established in 1978

Download our free

mobile app

2545 Schrock Road •Westerville • 614-882-5886 raisinrack.com

in research from Australia’s University of Sydney on patients after surgery for metastatic liver cancer. Several other studies, including one from the Milwau-kee’s Medical College of Wisconsin, show that acupuncture rebalances the nervous system and re-stores proper digestive function, while relieving pain. The World Health Organization review of research notes how acu-puncture relieved gastrointestinal (GI) spasms better than atropine injections, and also recommends acupuncture for relief of nausea. “Acupuncture helps calm down an overactive GI tract and stimulates an underactive one,” explains Burgoon. Acupuncture is a non-pharma-ceutical remedy for many health problems, Burgoon says. “I fell in love with acupuncture when I discovered I could use it to treat some problems that nothing else helped. I almost never prescribe any medications. Instead, I help people get off pharma-ceuticals.”

Kathleen Barnes is author of many natural health books, including The Calcium Lie 2: What Your Doctor Still Doesn’t Know, with Dr. Robert Thomp-son.Connect at KathleenBarnes.com.


There are many national adver-tisements for mattresses this time of year. Michael Koveleski,

local owner of Design Sleep in Yellow Springs, offers his thoughts on sleep and sleep-related products.

Natural Awakenings (NA): Your business name and ta-gline are “design sleep” and “refresh life.” What do those phrases mean? Mike Koveleski (MK): To design sleep is to create a personal sleep solution and bedroom sanctuary. I realized long ago that everyone wants to wake refreshed—physically, mentally, and emotionally. The mission of Design

Sleep is to refresh life, and that mis-sion extends to all our words, deeds and products. Sleep is the period of time when the body heals, grows, and files the tidbits of knowledge and memory gained during waking hours. A good night’s sleep makes life better.

NA: Why do you think organic mattresses are becoming popular?MK: People are concerned about breathing chemicals and fire retar-dants in their beds, yet I think it is really more about trust. The term “organic mattress” gives people a way to find certified-safe mattress materi-als. One of the main ingredients in the

organic mattress market is 100 percent natural latex rubber foam. However, because the manufacturing process uses soaps and gelling agents, a fin-ished product cannot be labeled “100 percent pure organic.” Thus, the term “organic mattress” is a misnomer, yet the entire industry uses it. To a consum-er, the term implies something holistic, chemically safe and breathable.

NA: What are some of the mis-takes people make when pur-chasing organic mattresses?MK: Reports say 30 percent of shop-pers are dissatisfied with their first effort. People focus on purity of materi-als and subjective comfort, with little knowledge of proper sleep posture and alignment on a mattress. Posture and alignment are absolutely essential to facilitate good nervous system func-tion and deep, unobstructed breathing. These two huge pillars of wellness are barely mentioned in the mattress in-dustry, yet are so obvious to those who understand chiropractic care or yoga. Unfortunately, mistakes are often made because of misinformation. Perhaps the biggest mistake is not finding someone knowledgeable about sleep to help with the selection process.

Crafting Healthier SleepThoughts From Mike Koveleski

of Design Sleep

by Deena Kloss


NA: How are your mattresses different?MK: We make our mattresses from materials that are tested independently for chemical safety and use organic cotton, organic merino wool and 100 percent natural latex foam. These materials create a better sleeping climate and allow us to avoid the use of chemical fire retardants. We source all of our components from Europe because of their high quality standards and superior performance features. Each mattress is tailored to the individual on their side of the mat-tress. This can even be modified after delivery. Our mattresses provide three-dimensional tailoring not found in any other American bed. That’s a pretty strong statement, but the European slat foundation allows us to tailor fit a mattress to fit someone’s curves and control back support. This ensures proper sleep posture and alignment with the mattress.

NA: Why did you get into the mattress industry?MK: After graduating from Pratt’s

industrial design program in 1990, I started building and designing plat-form beds for Scott Jordan Furniture in New York City. We had a simple mattress program with natural materi-als (cotton, wool, springs, and latex), yet they were not designed well for ergonomic function. A passion for functional design led us to the Europe-an mattress market. In the early 1990s, we began making latex mattresses and importing functional slat foundations. That’s when I realized how important sleep is to health—oddly enough, while I was in the city that never sleeps.

After the events of 9/11, I moved with my wife and children from NYC to Ohio. We realized that there was a huge market for a natural sleep store selling function, design, and real value. In 2004, I opened Design Sleep as a resource for natural customized mattresses, ergonomic home seating and clean design functional furniture.

NA: So what makes your store different?MK: We strive to create an educa-tional and comfortable environment. Everyone is free to visit several times and ask as many questions as needed. We want customers to feel as if they’re talking to a friend or trusted advisor that listens to understand their needs before suggesting a solution. Helping people achieve health and wellness through better sleep is what we love to do.

Location: 108 Dayton St., Yellow Springs. For more information, call 937-767-7567, email [email protected], or visit DesignSleep.com. See ad, page 56.


fitbody

“Most are familiar with the performance or competitive dance world of learned steps.

Conscious dance is a non-competitive, body-based way of raising conscious-ness. There’s no wrong way to move and your shape and measurements don’t matter,” says Mark Metz, of Berkley, California, founder and executive

The Power of Conscious DanceCreative Movement Connects

Body, Mind and Spiritby Gail Condrick

A growing tribe of movers and shakers are discovering and unleashing

their power in conscious dance, a combination of moving medita-

tion, soul-stirring music, self-expression and sweat.

director of the Dance First Association (DFA) and publisher of the Conscious Dancer Magazine and UpShift Guide. The group identifies more than 100 forms of conscious dance, rang-ing from ecstatic dance to somatic movement therapy. Commonalities include body awareness, barefoot movement, inspiring global music and

minimal structure facilitated by leaders. With 1,000 DFA studio loca-tions, many are finding the power of conscious dance suits their search for movement with purpose beyond im-proved fitness as it’s practiced in drug- and alcohol-free club-style events and ecstatic dance experiences, as well as dance fitness programs. “It’s about honoring body intelligence and paying attention to the body and mind-body connection,” says Metz. “The modalities mentioned most often are 5Rhythms, Soul Motion, Open Floor, JourneyDance, and the Nia Technique,” says Metz. A brief look at three of them shows how each has its own style.

5RhythmsIn St. Petersburg, Florida, 22 women have gathered to seek the bliss prom-ised by 5Rhythms, one of the original conscious dance forms, founded by the late Gabrielle Roth. “Find your flow. Feel your connection to the Earth through your feet and release your head,” guides facilitator Amber Ryan, of New York City, who travels the world for dance sessions. “Use your body as a gateway into the now.” For two hours, dancers move freely and individually, swaying, sensing and interacting in an experience called “the wave”, intended to move energy through the body, release emotions and heal the psyche. It’s based on Roth’s premise that, “Each of us is a moving center, a space of divine mystery. Though we spend most of our time on the surface in daily ordinary existence, most of us hunger to connect to this space within, to break through to bliss, to be swept into something bigger.”

JourneyDance Toni Bergins, from the Massachusetts Berkshires, is a frequent presenter at the Kripalu Center and Omega Insti-tute for Holistic Studies. After years of studying and teaching movement, drama, creative visualization and ge-stalt techniques, she combined them in creating JourneyDance. More than 400 trained facilitators now offer it in 60- or 90-minute classes worldwide based on the philosophy, “Move into


Connecting “within” through free and inspired

body movement is the power of conscious dance.

a new story!” Every class includes visualization, creative movement, affirmations and evocative music, all working together to release emotions and connect with spirit. “You learn to love your body, expand your emotional intelligence, clear your mind and connect with your inner source,” explains Bergins. “You express yourself, infuse life with creativity and connect with a dancing community.” Participants engage in a ritual journey of physical transformation, cleansing the body through breath, sweat and expression. In this safe space, “Dancers discover their power and personal heart medicine, their true essence,” says Bergins.

Nia Technique For those that prefer more structure, the Nia Technique is the original barefoot mind-body-spirit fitness practice, activating sensation and awareness in a workout adaptable for every-body. More than 2,600 instructors in 51 countries offer 60-minute classes where enthusiasts move the way the body is built to move, reaping cardio-vascular fitness and therapeutic ben-efits while having joyful fun. Dancers, guided by instructor’s moves, feel the rhythm of the music and ground them-selves in spirit, equipping themselves to take the self-healing experience into everyday life. “Nia has always blended form and freedom,” says Debbie Rosas, of Portland, Oregon, co-founder and creator of the technique. “We are now introducing new FreeDance classes to bring what we have learned through Nia to embody consciousness in new ways, conditioning the whole body and nervous system. It’s an invitation to move in free, unbound, unstruc-tured ways to offset the tendency we have to move less as we age.” Dancers move to music designed to animate each chakra through

an eight-stage process via a Nia DJ. They’re guided to listen to body feedback through sensation, release emotions and relish being in the present moment. “Regardless of how you act, dress or think, the way you feel inside reveals the most accurate truth of oneself and this is reflected in dance,” says Rosas. “Moving without interference allows your unconscious creative self to shine. You can connect to the sacred artist within; the one that holds a palette with endless colors, shapes and pos-

sibilities.” She sees life as ultimately a free-style dance into the self that supports a philosophy of “Love your body, love your life”. “Dance is in everyone’s family tree, a universal message,” says Metz. “In conscious dance, you discon-nect from gadgets and reconnect with yourself and others around you. People need that.”

Gail Condrick is a Nia faculty member, retreat leader and archetypal soul coach in Sarasota, FL. Connect at GaelaVisions.com.


Rapose says, as she explains her life-long study of mind, body and spiritual practices. After completing the work for three degrees from The Ohio State University, and early in her career as a therapist, a new way of looking at her clients’ difficulties emerged, Rapose continues. “It was evident that many of the symptoms they presented (relationship strife, grief, depression, anxiety, atten-tion disregulation and ‘dis-ease’) had at their core a certain kind of tension, resistance and a struggle that could be significantly reduced through engag-ing in a mindfulness-based stress reduction program,” Rapose notes. Since then, Rapose has conducted more than 60 such eight-week programs for both individuals and professional groups. She sees the process as fine-tun-ing people’s ability to fully “be with” life and whatever arises in its course with greater preparedness and ease. Recent research has shown that regular meditation actually changes our brains, Rapose observes. “It in-creases the region that contributes to creativity, insight, emotional integra-tion and positive mood” as well as regulating the autonomic nervous system and increasing the capacity

of the brain to return to baseline state when thrown off. This research supports one of Ra-pose’s favorite guiding tenets, a quota-tion from Virginia Satir that is at the essence of the work. “Life is not the way it is supposed to be. It is the way it is. And how we relate to this truth is what makes all the difference.”Sheri Rathburn came to the prac-tice of mindfulness meditation in a different way, taking a heretofore-untraveled fork in the road leading from a career of more than twenty years in interior design and art. Rath-burn said that, in her work, she had always been more interested in how her clients felt about a space than the mere aesthetics, and she said she eventually came to be interested in the sense of authenticity and healing fostered in an environment. Rathburn added that some of her own personal challenges and experi-ences contributed to her understand-ing of the importance of meditation and mindfulness. One such moment occurred following the birth of a child when she said she realized that her Lamaze training, with its emphasis on breathing and on concentration, could be helpful at other times of stress and difficulty. “I didn’t know it at the time, but it was a form of mindfulness,” Rathburn recalls. “Using mindfulness practice years later in my own addic-tion recovery and personal discovery work changed my life and my career. Now, I’m helping other people to do the same thing and have been doing so for the past 12 years. People come to this with curiosity, but they tell me how much it changes their perspective and their outlook.” Rathburn is certified in mindful-ness meditation by the University of Holistic Theology, a Reiki master teacher, and the owner of Om2Ohm Meditation and Wellness Center in Powell. She offers private one-to-one sessions for mindfulness meditation and mindfulness coaching, group classes in mindfulness meditation, and mindfulness meditation teacher train-ing and certification. Marge Veeder is a Midwest-based freelance writer.

Multi-tasking is out, and uni-tasking is in.While this is an oversimpli-

fied characterization of a newfound curiosity about a complex, thoughtful and thoroughly researched body of work, it is one more way to under-stand a much-needed framework is now taking hold. In Central Ohio, as in the rest of the country, people increasingly signal their readiness to learn about mindfulness meditation. They want to learn about what it can bring to their careers, their relationships, and their personal growth and wellness. It is good to know there are trained, extensively experienced Co-lumbus-area professionals who are not just recent adherents to the discipline. These people have devoted most of their working lives to the study and practice of mindfulness, and Cheryl Rapose, M.Ed., LISW, is one of them. Rapose, a mindfulness consultant to Behavioral Health and Neurosci-ence at Ohio Health, in Columbus, took her first training in mindfulness meditation in 1998 and helps thou-sands of people to live their lives with greater awareness and clarity. “I have always been a seeker,”

Mindfulness in the Momentby Marge Veeder


Our authentic self is constantly trying to get our attention so it may be more fully expressed.

When we set our intention to genu-inely evolve, we naturally begin to pay attention and see how redefining moments appear as needed. They are drawn to us sequentially to support us in the process of staying the course on our pilgrimage, each one a perfectly aligned portal in space and time, opening and closing, creating what-ever experience is required to guide us to heightened awareness of our authentic self. While the possible circum-stances that preclude such a moment are limitless, there are key signals to watch for. When they pop up, it helps immensely to stay engaged in the moment, rather than zipping past them on to another distraction. Rather, consider ways in which this might prove to be a pivotal point forward in our life journey.

n Moments that challenge our ego and moments that our ego challenges usn Unexpected eventsn Times of significant lossn First-time experiencesn Discontentmentn Disappointmentn Experiencing someone or some-thing that instantly inspires us to grown Birth of a loved onen Death of a loved one

Personal growth and evolution can be motivated by either inspiration

Embracing a Redefining Moment

by Dennis Merritt Jones

inspiration

or desperation. Both may prompt us to ask big questions of ourselves and the universe that cause us to dig deep. The deeper we dig, the closer we come to merging with our truest self. We know the answers to such questions are correct because they will lead to actions that honor life—like harming no one, including ourself—and affirm the presence of a prevailing power for good that lies within; a power that guides, protects and sustains us. Satisfying answers seek only the highest and best of us and bless all. They connect our mind, heart and soul, moving us forward on the path of wholeness as a fulfilled and joyfully self-expressed person. When we are impelled to ask an important question of our self and the universe, don’t rush the process and are willing to embrace the answer we receive, it pushes a reset button as to what defines us. It brings us an enhanced sense of authentic wholeness. The lesson is that when redefin-ing moments appear, we must be open and prepared to go where we had no plans of going—because that’s where our bliss awaits us.

Dennis Merritt Jones, D.D., is the author of Your (Re)Defining Mo-ments, the source of this essay. He has contributed to the human potential movement and field of spirituality as a minister, teacher, coach and lecturer for 30 years. Learn more at Dennis-MerrittJones.com.

Come to a free class andlearn how to use essential

oils as Nature's Health Care.

Experience the #1 brand ofessential oils in the world.

Call or text to get your free sample!


Phot

o by

Ste

phen

Bla

ncet

t

SUPER SOUPSNew Twists on Old Favorites Heal, Nourish and Soothe

by Judith Fertig

consciouseating

Natural Awakenings recommends using organic and non-GMO (genetically modified) ingredients whenever possible.

Winter season soups on chilly days can warm us, both body and soul. Whatever

our food preferences or time con-straints, some new twists on traditional favorites will satisfy everyone’s taste buds—with an accent on healthy plea-sure. Here’s where to start. Reinventing the past. From her Colorado mountain home, Jenny McGruther, author of The Nourished Kitchen, celebrates the wisdom of traditional foodways, making nutrient-dense, healing soup broth from bones, water, vegetables and seasonings. McGruther’s twist is to make it in a six-quart slow cooker. Once her family has dined on organic roast or rotisserie chicken, she simmers the bones with purified water, a bay leaf or two, a few whole peppercorns and a few chopped organic vegetables like onion, car-rot and celery on the low setting for

24 hours. Then she ladles the broth through a coffee strainer into another container, refreshes the slow cooker with more water and simmers the bones and seasonings for another 24 hours. Eventually, the broth will have less flavor and color, and that’s when McGruther starts all over again. “I call this perpetual soup,” she says. She blogs at NourishedKitchen.com. Slowing it down. With home-made broth on hand, it’s easy to make the Italian winter staple of Tuscan Veg-etable Bean Soup. Cookbook authors and slow cooker experts Kathy Moore and Roxanne Wyss, from Lee’s Sum-mit, Missouri, love to make this when they’re working on a cookbook dead-line. They simply use what they have in the refrigerator, freezer or pantry. “With a soup like this you can always substitute one vegetable for another, adjusting the recipe to what

you enjoy and have on hand,” advises Moore. The pair blogs at PluggedInto Cooking.com. Speeding it up. Sometimes, we need a single serving of homemade soup fast. Award-winning recipe de-veloper and cookbook author Camilla Saulsbury, of Nacogdoches, Texas, whips up a Pumpkin Sage Soup that can simmer in a saucepan within min-utes, ready to be enjoyed in a mug. Saulsbury uses organic canned pumpkin, full of vitamins, which can vary in sweetness. “If needed,” she suggests, “add a drizzle of maple syrup to enhance the flavor of the soup.” Making “bisque” in a high-speed blender. Karen Adler is an avid grower of organic tomatoes in her Kansas City garden. When the seasonal har-vest comes to an end, Adler grills or oven roasts the tomatoes, along with organic peppers and onions, and then freezes them, ready to make Roasted Tomato Bisque any time of the year. “My secret to a light bisque without using cream is to blend all the roasted vegetables together with a high-speed blender to give it body. A swirl of extra-virgin olive oil at the end finishes ensuring the satisfying flavor,” she says. Going cold. Douglas McNish, head chef at Toronto’s raw and vegan restaurant Raw Aura, serves a popular Lemon, Cucumber and Dill Soup, which is easy to make in a food pro-cessor. “This soup is amazing this time of year, when most of our diets may be lacking in healthy fats and trace minerals,” says McNish. Warming up. Two cookbook authors teamed up across many miles to write 300 Sensational Soups. Meredith Deeds lives in Minneapolis, Minnesota, while Carla Snyder resides in Cleveland, Ohio. They’ve mutu-ally discovered the naturally warming properties of curry powder in Curried Coconut Chickpea Soup. Snyder observes, “A good soup nourishes the heart, as well as the stomach, spreading a feeling of satis-faction and contentment.”

Judith Fertig blogs at AlfrescoFood AndLifestyle.blogspot.com from Overland Park, KS.


SOUP’S ON!Tasty Recipes for Winter Meals

Tuscan Vegetable Bean Soup

Yields: 6 servings

2 Tbsp olive oil1 large yellow onion, chopped3 carrots, chopped1 stalk celery, chopped1 cup frozen, cut green beans2 cloves garlic, minced1 can (14.5 oz, BPA-free) diced tomatoes, with liquid4 cups bone broth or 1 carton (32 oz) vegetable broth2 tsp Italian seasoning1/8 tsp crushed red pepper flakes, optionalSalt and pepper, to taste1 cup chopped fresh broccoli1 can (15 oz, BPA-free) cannellini beans, rinsed and drained2 Tbsp minced fresh basil, plus additional for garnishFreshly grated Parmesan cheese

Heat the oil in a Dutch oven over me-dium high heat. Add onions, carrot and celery and cook, stirring frequently, for 3 minutes. Stir in the green beans and cook, stirring frequently, for 2 to 3 min-utes or until the vegetables are tender. Stir in garlic and cook for 30 seconds. Stir in tomatoes, vegetable broth, Italian seasoning, red pepper flakes, salt and pepper. Heat, covered, until boiling, and then reduce heat to a simmer and cook 15 to 20 minutes.

Stir in broccoli, cannellini beans and minced basil. Simmer for 5 minutes or until the vegetables are as tender as desired. Ladle into bowls. Sprinkle with

grated Parmesan cheese. Garnish if desired with additional minced basil.

Adapted from PluggedIntoCooking.com, by Kathy Moore and Roxanne Wyss

Roasted Tomato Bisque

Yields: 8 servings

4 large beefsteak tomatoes, sliced2 red bell peppers, seeded and sliced1 large red onion, peeled and sliced2 Tbsp plus ½ cup extra-virgin olive oil¼ cup red wine vinegar2 Tbsp Worcestershire sauce1 tsp kosher salt1 tsp hot pepper sauceBone broth or vegetable broth, if necessaryAdd fine dry or gluten-free bread crumbs and sliced green onion for garnish

Preheat the oven to 425° F. Line two large baking sheets with parchment paper. Arrange the tomatoes, bell pep-pers and onion on the baking sheets and drizzle with the two tablespoons of olive oil. Roast for 30 minutes or until soft and browned at the edges.

Transfer to a Vitamix or similar blend-er. Add the remaining half-cup olive oil, red wine vinegar, salt and hot pepper sauce and blend until smooth. Add a little bone broth or vegetable broth if the soup is too thick. Serve each bowl with a sprinkling of bread-crumbs and thinly sliced green onion.

Adapted from The Gardener and the Grill, by Karen Adler and Judith Fertig

Pumpkin Sage Soup

Yields: 1 serving

¾ cup ready-to-use chicken or vegetable broth 2/3 cup pumpkin purée (not pie filling) ¼ tsp dried rubbed sage 3 Tbsp half-and-half, whole milk or coconut creamer Salt and freshly ground black pepper

In a saucepan, bring the broth, pump-kin and sage to a simmer over medi-um-high heat. In the mug, stir broth, pumpkin and sage until blended. Stir in cream and heat for 1 minute more. Season it to taste with salt and pepper before pouring into a mug. Garnish with roasted pumpkin seeds.

Adapted from 250 Best Meals in a Mug, by Camilla V. Saulsbury


Restore Your Skin to its Natural, Youthful Beauty with our new Advanced Healing Skin Cream

4-oz jar $21.99 + ONLY $5 for shipping


You’ll love Natural Awakenings’ therapeutic cream’s clean, fresh botanical fragrance. Discover what our amazing skin cream can do:• Provides Ultra-Hydration of Skin• Enhances Anti-Aging and Skin Renewal• Soothes Dry, Itchy, Cracked Skin• Relieves Most Burns Including Sunburn• Comforts Wounds and Sores

Order online todayShopNaturalAwakenings.com

or call: 888-822-0246

MANUKA HONEY is produced by bees

that pollinate New Zealand’s Manuka bush. Advocates tout its antibacterial

properties.

Lemon, Cucumber and Dill Soup

Yields: 2 servings

2 cups chopped peeled, seeded cucumber½ cup chopped romaine lettuce¼ cup filtered water¼ cup chopped fresh dill fronds1 clove garlic3 Tbsp freshly squeezed lemon juice2 Tbsp extra-virgin olive oil½ tsp fine sea salt

In a food processor fitted with its metal blade, process cucumber, let-tuce, water, dill, garlic, lemon juice, olive oil and salt until smooth. Trans-fer to a bowl. Cover and refrigerate until chilled, at least 1 hour or up to

Phot

o by

Ste

phen

Bla

ncet

t

3 hours. Serve garnished with a dollop of vegan sour cream, if preferred, and additional dill.

Adapted from Eat Raw, Eat Well, by Douglas McNish

½ tsp salt2 cans (each 14 to 19 oz, BPA-free) chickpeas, drained and rinsed1 zucchini, ½-inch diced 1 Tbsp packed light brown or date sugar 1 Tbsp freshly squeezed lime juice 2 cups (about 3 oz) packed baby spinach Sea salt and freshly ground black pepperToasted shredded coconut for garnish

In a large pot, heat oil over medium heat. Add onion and sauté until soft-ened, about 6 minutes. Add garlic and sauté for 1 minute. Add curry powder and sauté another 10 seconds. Add potatoes and stir to coat.

Add stock and coconut milk; cook for 10 minutes. Add chickpeas and zucchini; cook another 10 minutes, or until potatoes and zucchini are tender. Stir in brown sugar and lime juice. Add spinach and stir until wilted. Season the soup with salt and pepper to taste. Ladle into heated bowls and garnish with coconut.

Adapted from 300 Sensational Soups, by Carla Snyder and Meredith Deeds

Coconut Curried Chickpea Soup

Yields: 6 servings

2 Tbsp olive oil 1 onion, finely chopped 2 cloves garlic, minced 1 Tbsp curry powder 1 lb small, red-skinned potatoes, ½-inch diced4 cups vegetable stock 1 cup unsweetened coconut milk


The Right Vet for Your Pet

Animals Thrive with Gentle, Safe and Natural Approaches

by Shawn Messonnier

Pet parents have many criteria to consider when choos-ing a healthcare provider for their prized pet, and among the most vital is trying to find a doctor that uses

holistic therapies, because the advantages are many. Wellness care is more than vaccines. While many conventional vets consider giving vaccines and flea medica-tions to all of their patients to be their best form of wellness care, holistic vets know these aren’t always necessary and can potentially be harmful. Instead, true wellness care involves careful consideration of proper diet, blood titer testing instead of vaccines, natural parasite control when appropriate and a heavy dose of diagnostic testing (blood, urine, fecal) to moni-tor organ function, check for parasites, screen for disorders of the urogenital system, liver and pancreas and early screening for cancer and other inflammatory conditions. There’s also a full physical check for common diseases like dental and heart disease and tumors.

Individualized prescriptions for a proper diet and supplements to maintain health are big reasons many own-ers prefer a holistic vet. Natural treatments include disease prevention. Many pets treated via a more natural approach have an easier experience with occasional illness than those that don’t enjoy this specialized care. Natural therapies can quickly restore an ill pet to his homeostatic balance without the side effects often associated with multiple drug doses. A team approach is expected. A holistic practice is a team effort, and the family doctor will suggest options for care, helping an owner decide on the best therapies for each pet. A fuller range of options is available. While holistic vets prefer a more natural approach, they know that if necessary, conventional therapies can sometimes be an appropriate complement if they follow holistic principles, which means infrequent use of low-dose medications and only when absolutely needed. In general, most conditions can be treated successfully without drug therapy, extend-ing the health and life of the patient and reducing medical costs. Gentler anesthesia means quicker recovery. A natu-rally balanced and gentler approach means less drugging if anesthesia becomes necessary, close monitoring of an anesthetized pet, a smooth and quick recovery for prompt discharge from the hospital and natural forms of follow-up treatment to control post-operative pain and inflammation. New hope rises for the hopeless. Many pets are brought to holistic doctors after conventional care has failed to help them. Some have been turned away by practitioners of conventional medicine because their cases are diagnosed as “hopeless”. Holistic vets and pet parents alike experience considerable satisfaction in helping to give a joyful pet a whole new lease on life.

Shawn Messonnier, a doctor of veterinary medicine prac-ticing in Plano, TX, is the award-winning author of The Natural Health Bible for Dogs & Cats and Unexpected Miracles: Hope and Holistic Healing for Pets. For more information, visit PetCareNaturally.com.

naturalpet

(614) [email protected]

Bucket Service ~ Full Service Yard CleanFood Waste to Energy

Free Delivery on all Product!


greenliving

“Living green means living well, using what you create with minimal waste,” says Mike

Bond, an ecologist and bestselling activist author in Winthrop, Maine. Here, he and other savvy sources share tips to go ever greener in ways that are painless and affordable.

Start Small4 Choose the best bulb for the job. Light bulbs can confuse even in-formed shoppers. Incandescent bulbs

It’s Easy to Be GreenAt Home and On the Road

by Avery Mack

last more than 750 hours, but aren’t energy-efficient. Fluorescent bulbs use 75 percent less energy than incandes-cent and last 10 to 15 times longer. A 20-watt compact fluorescent light (CFL) uses 550 fewer kilowatt-hours than a 75-watt incandescent bulb. For additional information, check Tinyurl.com/EnergyInfoLightBulbs. For a free app showing the best buy, visit Light-BulbFinder.net.

4 Use appliance thermometers. Widely available, this useful tool will confirm a correct operating tem-

perature of 37 to 40 degrees in the refrigerator and zero degrees in the freezer. According to the U.S. Food and Drug Administration, a warmer fridge allows bacteria to grow, while 10 degrees cooler than the ideal range increases energy use 25 percent. Chiller units work harder if the room temperature exceeds 70 degrees, so keep appliances out of direct sunlight and away from the stove.

4 Find the right seeds and plants. Then get quick advice on how many to buy and how and when to plant using the SmartGardener.com step-by-step app. It encompasses more than 3,000 organic, GMO-free, edible varieties.

4 No dishpan hands. A full load of dishes in a water-efficient dishwasher uses four gallons of water versus 24 gallons for handwashing them, ac-cording to Seametrics, which manu-factures flow meters.

4 Test the toilet. If a few drops of food coloring added to the toilet tank colors water in the bowl, replace the flap. It’s an easy and inexpensive DIY task. The U.S. Environmental Protec-tion Agency reports that one in 10 homes leaks a cumulative 90 gallons a day.

4 Fix the faucet. One drip per second equals 3,000 gallons a year wasted, Seametrics calculates.

4 Reset the hot water heater to 120 degrees. This safe and efficient setting also reduces corrosion and mineral buildup.

4 Discover soap nuts and wool dryer balls. Dried soapberry fruit shells contain saponin, which works like most detergents and soaps. Toss five or six whole shells (one-half ounce) in a wash bag with the laundry. They’re good for five to eight reuses. All-natural sheep’s wool dryer balls shorten drying time, soften and fluff fabric, reduce static and help keep pet hair off of clothes.

4 Change the car’s air filter. Maintain a clean filter according to manufactur-er’s guidelines and visual inspection, about every 30,000 to 45,000 miles.

4 Use an oil-change service. In Connecticut alone, do-it-yourselfers

TrueREST

The Science of Feeling Great ™ Ohio’s first luxury floating oasis— True REST® Float Spa Relaxation • Pain Relief • Sleep Better

Call or go online to book your appointmentment.


Go-Green AppsHere are three apps we suggest among the many available.

n Green You is a free app. It cal-culates our eco-friendliness and suggests steps toward a deeper shade of green. ItAnyPlace.com/support/greenyou

n Recycle offers a free national data-base of 100,000 recycling and dispos-al locations for 200 products. Specify the item and find local options with contact information. Earth911.com/eco-tech/irecycle-now-on-android

n eEcosphere helps users discover, adopt and share the best sustainable living ideas and makes it easy to share specific actions and ideas with friends via social media. eEcosphere.com

change 9.5 million gallons of mo-tor oil a year, and 85 percent of it ends up in sewers, soil and trash as a major groundwater pollutant. Earth Talk reports that one quart can cre-ate a two-acre oil slick; a gallon can contaminate a million gallons of fresh water. While the more costly chemi-cals in synthetic oil create the same amount of pollution as traditional oil, it doesn’t need to be changed as often.

4 Carpool. The Green Living Ideas media network condones Uber, Lyft and Sidecar apps for making rideshar-ing ultra-accessible.

Go Greener4 Replace old appliances with ener-gy-efficient models. Check out a unit’s Energy Star rating. Consider a tank-less heater for hot water on demand, rather than 24/7 heating.

4 Choose eco-tires. Low rolling resistance improves gas mileage and reduces emissions. Keep tires properly inflated and periodically rotated for longer wear. Watch for future innova-tions in sustainable materials currently in research and development.

4 Ban idling. Don’t idle an electronic fuel-injected engine for more than 30 seconds when parked in cold weather; it warms up faster by being driven, explains the U.S. Department of Energy. Fuel injection engines took over in the 1980s and early 90s. Only older carburetors need a couple of

minutes’ warm-up. The Department of Energy’s Argonne National Laboratory further advises, “Idling for more than 10 seconds uses more fuel and emits more CO2 than engine restarting.”

4 Ask for pet- and eco-friendly anti-freeze. Choose less toxic red-orange propylene glycol antifreeze instead of green ethylene glycol antifreeze, which is poisonous to pets and peo-ple. Dispose of both types properly, as they are toxic to wildlife and fish via groundwater, as well.

4 Green-clean car windows. Choose a brand like EvergreeN Windshield Washer Fluid, which is plant-derived, eco-friendly, non-toxic and biodegrad-able. Traditional blue fluid is metha-nol, combined methyl alcohol and wood alcohol, and extremely poison-ous, especially to children and pets.

Go Big 4 Switch to a heat pump. “A heat pump works the reverse of a refrigera-tor; it takes cold air from the outside and turns it into warm air inside, and uses no oil or gas,” explains Bond.

4 Go solar. It’s the eco-alternative to conventional electricity generation. “Solar means that you’re creating your own power,” says Bond, who has used solar for years. “It works on an elegant cycle—create energy, use energy.” Leased solar panels reduce the cost of equipment, which has dropped dramatically in recent years.

4 Get a hybrid car. In combination with solar power, a hybrid vehicle can reduce or eliminate daily energy costs. “An electric car is perfect when com-mutes are not long,” Bond discloses. “If charged in the day, it can serve as the battery for a solar home at night, when no power is being created.”

Connect with freelance writer via [email protected].


Homeport has been providing affordable hous-ing and comprehensive support to Central Ohio residents since 1987. Beginning in the fall of 2014,

it enhanced benefits by offering residents a cleaner air environment through a smoke-free initiative. Brenda Moncrief, Homeport’s asset management service manager, never anticipated how fast the program would grow, or the impact it would have on the commu-nity. “To see how well it’s been received, it’s been over-whelming,” Moncrief said. Other housing properties had gone smoke free, but

Homeport’s Affordable

Housing Goes Smoke Free

by Laurie Zinn

740.393.2933AdultEdKCCC.org

KCCC School of Massage TherapyServing Ohio since 1999

Now Enrolling!Financial Aid available to those who qualify.

Accredited by theCouncil on Occupational Education.

(800) 567-9702(800) [email protected]

VendingOptions

ForPromotingA Healthier

Life

Full Servicewith No Cost

to the Location!

All major credit cardsand virtual wallet

accepted

they were not affordable housing properties, Moncrief ex-plained. Homeport began researching the option in 2011, and when HUD came out with solid guidelines, Homeport implemented its program. Homeport’s first smoke-free property was Trabue Crossing, a new construction of 52 townhomes in Hilliard that opened in 2014. Interested residents were informed upon application that the units would be smoke free, and were given literature about the dangers of smoking and second-hand smoke. “We wanted them to know coming in that this was going to be a smoke free community,” Mon-crief said. The Columbus Health Department’s Creating Healthy Communities program helps educate, develop and imple-ment smoke free initiatives around the city. They as-sist property managers with resident surveys, meetings, signage, and any other support they need to carry out the program. Amber Jones, health education program planner at the Columbus Health Department, has worked closely with Moncrief and Homeport’s smoke free initiative. “Homeport is leading the way, and has given others the confidence to do it, too,” Jones said. “They are the role models to look up to.” More than 290 Homeport apartments became smoke-free in the last year, but the transition was gradual. With the assistance of Jones, Moncrief led community meetings where residents were informed that the units would be smoke free in 90 days. Moncrief and Jones both stressed that residents do not have to quit smoking if they do not want to, but that with the initiative, residents are not al-lowed to smoke in the unit, in the home or on the grounds. Options and resources are available if they do want to quit, including smoking cessation classes offered by the Breathing Association. Moncrief said the cessation classes are excellent. “It really gets the smokers to start thinking about health,” she said. “It’s amazing when you see the light bulb come on.” Jones said more and more people are contacting her looking for smoke-free housing options. Many are non-smoking families who have neighbors that smoke. She said one low-income housing resident had to admit her three-year-old child to the hospital eight times last year for asthma flare-ups caused by second-hand smoke. She is not a smoker, but her neighbor is, and moving is a financial hardship.

Amber Jones of the Columbus Health Department speaking about the impact of smoking at Homeport’s Fieldstone Court senior community, March 2015

Phot

o: B

rend

a M

oncr

ief


WCBE 90.5 FM is a catalyst for community, enriching lives by providing original, independent, and network programming,and through partnerships with listeners and local organizations which grow and sustain our cultural and educational landscape.

WCBE.org614-365-5555

WCBE.org614-365-5555

HAPPY 2016WCBE's

60th Yearof Broadcasting

Because of Homeport going smoke free, Moncrief was asked to take part in a video produced by the Columbus Health Department showcasing the suc-cess of local initia-tives. Last fall, she was a panelist at the Ohio

Healthy Home Network’s forum called “Indoor Air Quality: Bridging Health and Housing.” When the Breathing Association saw Moncrief speak at the forum, it offered to bring mobile health lung clinics to Homeport’s properties in 2016. They will provide a host of services, including physical exams, breathing tests, pre-scription assistance programs, asthma and COPD educa-tion and management, and more. Moncrief said they are on track to transition 300 apartments this year, and hope to have 100 percent of the Homeport properties smoke free in two years. Their efforts to educate residents about the dangers of smoking are pay-ing off. “When they get that education piece and find out what it’s all about, they change their minds,” she said. “It almost brings tears to my eyes, to see someone that’s been smoking for 45 years say ‘maybe it’s time I do something about it.’”

For more information, call 614-221-8889 or visit Home-portOhio.org.

Laurie Zinn is a Columbus-based freelance writer and the owner of Line-By-Line, a digital content management ser-vice for websites, blogs, email marketing and social media. Connect at [email protected].


According to the Nielsen Corpo-ration, top New Year’s resolu-tions include losing weight,

spending less and getting organized. Research indicates that people find success during the first few weeks of the year but backslide by February. In addition, as reported in Psychology Today, most people are back where they started by the following Decem-ber, with some even further behind in their goals. Changing our habits by sheer will takes a lot of energy, and will power is hard to maintain over time. In my experience, negative self-talk further drains our vitality as we chastise our-

selves for slips. The Sanskrit word moksa means “effortlessness,” and it has been a recent mantra of mine. Rather than forcing into being the life I envision, which is tough to sustain since it zaps my energy, what I most want is to choose good habits effortlessly. In oth-er words, I want to want to do what is best for me rather than do something because I have to or should. What has helped me most in my moksa quest has been a combination of 20 minutes each of journal writing, yoga and meditation; a daily blend I have come to call my Sacred Hour. Here is how it works:

JournalingScientific research confirms that writ-ing to make sense of challenging times is an effective way to combat stress and benefit our immune system. I look at my journal as a place to unload whatever is churning in my brain and to write it down, make decisions and literally close the book on my worries so I can move on. If you are not sure where to begin, journal prompts can help.

YogaYoga offers increased flex-ibility, muscle strength and tone, improved respiration and vitality, weight reduction, cardio and circula-tory health, and improved athletic performance. It also helps manage stress, which is known to have a devastating effect on the body and mind, according to the American Osteopathic Association. My favorite online yoga videos are by the instructors featured on Gaia.com and by Yoga Zone teachers on Hulu.com.

MeditationMeditation promotes relaxation, focus, diver-gent thinking, improved relation-ships and compassion. Research from 163 different studies suggests that mindfulness meditation practice has an overall positive effect on improving anxiety and stress. Stan-ford researchers Dr. Seppala and her colleagues even assert that meditation improves immunity, lowers inflamma-tion and decreases pain. My own meditation method is to lie on the floor with my legs up a wall, a position that calms the nervous sys-tem. I breathe in for five seconds, gen-

Sacred Hour, Thriving Life

How 20 minutes each daily of journaling, yoga and meditation

acts as a reset buttonby Jenny Patton

localperspective


tly hold my breath for five seconds, release it for five seconds and hold my breath for five seconds. I imagine light traveling through my body in tandem with my breath as I repeat the cycle for 20 minutes, though after 10 minutes I lower my legs to avoid numbness. When my mind wanders, I do not berate myself but simply return to my breath. While I have benefited from journaling and yoga for years, adding in the meditation component seems to have taken me to a new level. I am more patient with others and with myself, more comfortable with con-flict and uncertainty, and more open to being vulnerable. I spend less time thinking about the “shoulds” in life, i.e. I should do this, I should not have done that, which used to exhaust me. Thanks to my Sacred Hour prac-tice, it is easier to make good eating choices, keep my home organized and say “yes” to opportunities that light me up and confidently say “no” to those that do not. While I have long been an all-or-nothing type of person, I have become better at pac-ing myself. I even floss daily now. The best part is that I have built new habits without having to force myself to do them. I have practiced journaling, yoga and meditation individually at times, but I find I get the best results when I combine them, even if I only have five minutes to devote to each. Things are not perfect, of course, and I have a list of changes I want to make. I believe, however, that my Sacred Hour prac-tice will continue to help me achieve the moksa, or effortlessness, I seek. I think of it as my daily reset button, and what better time to reset than the New Year?

[Please consult with a doctor or health specialist before beginning any exercise program or wellness practice, such as the one listed above.]

Jenny Patton teaches writing at The Ohio State University and posts Sun-day Journal Prompts on Journaling-WithJenny.blogspot.com. Connect on Twitter @JournalWJenny.


wisewords

Bruce Lipton on Why Biology Is Not Destiny

Our Beliefs Reprogram Our Genetic Destinyby Linda Sechrist

Bruce Lipton, Ph.D., author of The Biol-ogy of Belief and

The Honeymoon Effect, is a stem cell biologist and internationally recognized leader in bridging science and spirit. He is a visiting fellow lecturer on immu-nology at the New Zealand College of Chiropractic and participated in the Foundation for Con-scious Evolution’s seventh Worldwide Meeting on Human Values, in Mexico. His research explains the interplay between individual consciousness and body biology.

Why do you start with epigenetics as a foundation for health?Many people, programmed with the concept of genetic determinism, believe that genes in the fertilized egg at con-ception determine character and fate. Unable to pick our DNA genes, we are powerless to control our life, so that the only option is seeking help from some-one in the biomedical community to fix our genes. I introduced a new vision about the understanding of genes a half-cen-tury ago that is now the new science of epigenetics. Epi- means “above”. Here, we can realize control by regu-lating the environment in which we live and our perception of it, making us the master of our own genetics rather than a victim of heredity.

Do you believe epigenetics is the future of medicine?Epigenetics is a revolution in our knowledge and awareness of hered-ity. This new concept of biology is so big that it promises radical change

capable of revolutionizing civilization. Its dynamics are equivalent to the leap from Newtonian physics to quantum physics, which led to everything from computers and cell phones to Martian rovers. We are freed to abandon the belief that genes cause cancer, for instance. In changing our

lifestyle, beliefs and perceptions, we also change our genetic expression. Remember, this works because how we individually interpret our world is translated by the brain into chemical information that adjusts the behavior and genetics of cells to complement our perception. We could live in the healthiest environment, but if our mind perceives it as threatening and non-supportive, our biology will become less healthy and can generate disease. The cells’ response is based on the brain’s information, which actually is only an interpretation. Personal per-ceptions and the way we live, includ-ing our spiritual nature, adjust genes to manifest either a functional state of health or one of dysfunction.

Where is the “self” that makes people different? No two people are the same biologi-cally. If I inject my cells into another human, their immune system will recognize it as “not-self” and begin to eliminate them. On the surface of virtually all our cells are thousands of protein receptors that function like miniature antennae. They read and re-spond to environmental signals similar to the larger receptors on the skin’s sur-face, such as the eyes, ears and nose. Each human also possesses a unique set of “identity” receptors, a

subset of which are called “self-recep-tors” by the biomedical community, found on nearly all of our cells, with the primary exception of red blood cells. Self-receptors are unrelated to the cell’s function contributing to muscle, bone, brain or heart. Conventional medicine studies the physical aspect of self-receptors as being the source of “self” but overlook the environmental signals they receive. In other words, in-dividual identity is linked to the signals received by the antennae. When I reached this point in my research, I realized that we can’t die, because our real identity is represented by the invisible environment-derived “broadcast”, which might legitimately be referred to as spirit. My personal identity signal is received by each of my 50 trillion cells endowed with the unique set of “Bruce” self-receptors. While my physical body is like a TV, the “spiritual broadcast” representing the Bruce Show is an eternal, energetic element of the environment.

What is entrainment and why is it important today?A group of heart cells in a Petri dish will each beat to its own vibrational frequency. After a couple of days, they start beating in synchrony, because the stronger heart cells control the tempo. The other cells organize their behav-ior to entrain with the more powerful one. This happens in women’s college dormitories when residents start the school year with different menstrual cycles, but later experience entrain-ment, with their cycles beginning and ending about the same time. They link to a pulse and a beat, just like the heart cells. Humans become entrained to a higher force that’s an invisible broadcast of energy in harmony or in discordance. As more of us hold the intention for living a life of love and peace, the broadcast of that harmonic energy amplifies and those not yet there will eventually entrain to the stronger signal. This is the shift we need to make for conscious evolution to occur.

Linda Sechrist is a senior staff writer for Natural Awakenings. Connect at ItsAllAboutWe.com.

41natural awakenings January 2016WWW.OEFFA.ORG/CONFERENCE2016

NA Central OH 2016 conference full pg ad.indd 1 12/15/2015 3:11:20 PM


In The Autism Revolution, Pediatric Neurologist and Neuroscientist Martha Herbert approaches autism

as a whole-body condition that can improve, rather than be a static, lifelong genetic brain disorder. “It’s the way the brain is shifted into acting when faced with a combination of stressors—some, but not all of which are genetic—at a vulner-able point in develop-ment,” says Herbert. Non-genetic challeng-es can come from the immune system, nutri-tion, the environment and stress. “Addressing them can make a profound difference in the condition; maybe even turning it around.” Herbert directs the Treatment Re-search and Neuroscience Evaluation of Neurodevelopmental Disorders (TRAN-SCEND) program at a joint Harvard

healthykids

Practical Ways to Prevent and Treat Autism

by Meredith Montgomery

Experts agree that a natural foundation

for health begins with breastfeeding infants

to support natural immunity, and then ensuring children’s

diets are rich in nutrients at all ages.

University, Massachusetts Institute of Technology and Massachusetts Gen-eral Hospital Medical Imaging facility. “While autism is often thought of as a genetic disorder, it’s the result of a gene-environment interaction where genes are corrupted,” explains Psychia-

trist Robert Hendren, who is currently part-nering in developing the Center for Autism Spectrum Disorder and Neurodevelop-mental Disorders at the University of Cali-fornia, San Francisco. According to the U.S. Centers for Disease Control and Prevention, autism is the fastest-growing developmental

disability, now affecting one in 68 children and one in 42 boys. Autism Speaks (AutismSpeaks.org) defines autism spectrum disorder (ASD) as a group of complex brain development

Natural Awakenings’ healthy living, healthy

planet lifestyle app has a new look and

more features.• Updated every month with new content• Search the healthy products in our

National Directory• Find your local magazine• Read feature stories En Español• Sign up for Promotions and Newsletters• So much more!• And it’s FREE!

IT JUSTKEEPS

GETTINGBETTER!

Search “Natural Awakenings”

and download


disorders characterized by difficulties in social interaction, verbal and non-verbal communication and repetitive behaviors.

PreventionMany experts agree that in some cases, autism can be prevented. “Pre-vention needs to start early—precon-ception is ideal,” says Dr. Kenneth A. Bock, of Bock Integrative Medicine, in New York, and author of Healing the New Childhood Epidemics: Autism, ADHD, Asthma and Allergies. Emphasizing omega-3 essential fatty acids, folic acid and probiotics during pregnancy can be beneficial, and it’s important to avoid iron defi-ciency, which has been tied to higher rates of autism, Hendren counsels. Results from a recent University of California, Davis study published in Environmental Health Perspectives re-veals increased rates of autism among children of women that live close to pesticide-treated fields during pregnan-cy, particularly during the second and third trimesters. Hendren says, “Living near heavily sprayed fields can be very detrimental. Living close to freeways or downwind of coal-fired power plants is also associated with autism.” If heavy metal toxicity in blood is confirmed, chelation therapy is often used to remove metals, although Hendren advises against using it for

the general treatment of ASD. “Chela-tors pull out mercury, along with other metals, a process that can be harmful. Instead, think about diet and nutrition-al supplements that can help detoxify the body more safely,” he explains. Bock says, “It’s not enough to detoxify, we have to remove and pre-vent exposure to neurodevelopmental toxins.” Herbert suggests avoiding toxic household products, electromagnetic exposure from devices such as cell phones and baby monitors, which can lead to stress, sleep disruption and cell

health problems, as well as antibiotic overuse, which can disrupt the gut mi-crobiome, increasing vulnerability to exposure to other harmful chemicals. Herbert notes some parents ob-serve that their child became autistic after a vaccination but there are also autistic children that are vaccine-free; still others become so after facing oth-er stresses such as illness or trauma. “We need to focus on the underly-ing vulnerabilities and keep children strong and resilient so they can handle life’s challenges to their health and immune systems,” she says.

GoYoga®

Ad_GoYoga_29.5.15_RZzu.indd 1 29.05.15 10:44

Easy-on-Kids Cooking

Beyond Gluten-Free, Casein-Free by Melody Handley

The Kid-Friendly ADHD & Autism Cookbook by Pamela Compart and Dana Laake

The SCD for Autism and ADHD: A Reference and Dairy-Free Cookbook for the Specific Carbohydrate Diet by Pamela Ferro and Raman Prasad

Special Diets for Special Kidsby Lisa Lewis


Feb. 27 - Mar. 5, 2016Join our 13th annual Holistic Holiday at Sea cruise for 7 nights on the luxurious MSC Divina, one of the most ecologically-friendly and elegant cruise liners on the seas. Bask in gracious Italian hospitality and service all while enjoying inspiring lectures and vegan natural foods prepared by our own chefs. Departing from Miami, FL and sailing to beautiful St. Thomas, Virgin Islands; historic San Juan, Puerto Rico; & the paradise of Nassau, Bahamas. Learn more about the classes, cuisine and itinerary at holisticholidayatsea.com.

Food options for everyone - vegan,gluten-free, oil-free & ship’s menu

Dancing, socials & singles eventsVegan pizza & ice cream partiesCancer support group & recovery panel

Award-winningenvironmentally-friendly ship

Swim, snorkel & kayak in thecrystal waters of the Caribbean

Daily yoga, meditation, Pilates,Qi Gong, Do-In, running, fitness& body building classes

Private consultations& treatments available

Continuing Education Credits(CMEs & CEUs) will be available

35 teachers135 lectures & workshops10 cooking classes, 4 intensives

Lectures & WorkshopsFeaturing World-Renowned Chefs, Teachers & Healers

Chosen by National Geographic Traveler as One of the 100 best worldwide vacations to enrich your life.

Book TodayLorraine [email protected]: 1-877-844-7977Ph: 1-305-443-0542(option 1 for program informationoption 2 for travel agent)All reservations for our holistic groupmust be made through Lorraine Travel

Learn Moreholisticholidayatsea.cominfo@holisticholidayatsea.comToll-Free (US): 1-800-496-0989Ph: 1-828-749-9537Or join the conversation: Holistic Holiday at Seaholisticholidayatsea.com/blog

Join 1800+ Like-Minded Vegans

Physician, author, & internationally-recognized speaker on nutrition; founded NutritionFacts.org; spoke at Congress, on Dr. Oz, & the Colbert Report

MICHAEL GREGER, M.D.

Long-time radio host, acclaimed physician and health educator; practices nutritionally-based medicine at True North Health Center

MICHAEL KLAPER, M.D.

Co-author of The China Study and author of Whole: Rethinking the Science of Nutrition; featured in the film Forks Over Knives

T. COLIN CAMPBELL, PH.D.

Founder of the Physicians Commitee for Responsible Medicine; author of Food for Life & Power Foods for the Brain; active health advocate

NEAL BARNARD, M.D.

Spiritual PracticesRelaxing Vacation Gourmet Cuisine

Chef & author of Unprocessed: How to Achieve Vibrant Health and Your Ideal Weight , inspiring public speaker & cooking instructor

CHEF AJ

Yoga teacher, health & wellness coach, aerial performer, stunt woman & actor. Her education stems from a lifetime of living a holistic lifestyle.

ANGELICA KUSHI

Feb. 27 - Mar. 5, 2016Join our 13th annual Holistic Holiday at Sea cruise for 7 nights on the luxurious MSC Divina, one of the most ecologically-friendly and elegant cruise liners on the seas. Bask in gracious Italian hospitality and service all while enjoying inspiring lectures and vegan natural foods prepared by our own chefs. Departing from Miami, FL and sailing to beautiful St. Thomas, Virgin Islands; historic San Juan, Puerto Rico; & the paradise of Nassau, Bahamas. Learn more about the classes, cuisine and itinerary at holisticholidayatsea.com.

Food options for everyone - vegan,gluten-free, oil-free & ship’s menu

Dancing, socials & singles eventsVegan pizza & ice cream partiesCancer support group & recovery panel

Award-winningenvironmentally-friendly ship

Swim, snorkel & kayak in thecrystal waters of the Caribbean

Daily yoga, meditation, Pilates,Qi Gong, Do-In, running, fitness& body building classes

Private consultations& treatments available

Continuing Education Credits(CMEs & CEUs) will be available

35 teachers135 lectures & workshops10 cooking classes, 4 intensives

Lectures & WorkshopsFeaturing World-Renowned Chefs, Teachers & Healers

Chosen by National Geographic Traveler as One of the 100 best worldwide vacations to enrich your life.

Book TodayLorraine [email protected]: 1-877-844-7977Ph: 1-305-443-0542(option 1 for program informationoption 2 for travel agent)All reservations for our holistic groupmust be made through Lorraine Travel

Learn Moreholisticholidayatsea.cominfo@holisticholidayatsea.comToll-Free (US): 1-800-496-0989Ph: 1-828-749-9537Or join the conversation: Holistic Holiday at Seaholisticholidayatsea.com/blog

Join 1800+ Like-Minded Vegans

Physician, author, & internationally-recognized speaker on nutrition; founded NutritionFacts.org; spoke at Congress, on Dr. Oz, & the Colbert Report

MICHAEL GREGER, M.D.

Long-time radio host, acclaimed physician and health educator; practices nutritionally-based medicine at True North Health Center

MICHAEL KLAPER, M.D.

Co-author of The China Study and author of Whole: Rethinking the Science of Nutrition; featured in the film Forks Over Knives

T. COLIN CAMPBELL, PH.D.

Founder of the Physicians Commitee for Responsible Medicine; author of Food for Life & Power Foods for the Brain; active health advocate

NEAL BARNARD, M.D.

Spiritual PracticesRelaxing Vacation Gourmet Cuisine

Chef & author of Unprocessed: How to Achieve Vibrant Health and Your Ideal Weight , inspiring public speaker & cooking instructor

CHEF AJ

Yoga teacher, health & wellness coach, aerial performer, stunt woman & actor. Her education stems from a lifetime of living a holistic lifestyle.

ANGELICA KUSHI


Creating Calm Islandsby Carolyn Dalgliesh

Sensory kids, like those living with autism spectrum, sensory process-

ing, anxiety or attention deficit disor-ders, are often highly affected by the design of their physical environments. Here are some tips for removing daily stressors for a more supportive home environment. Identify the common sensory challenges for the child so the fam-ily can create spaces that support them. Kids may struggle with regulat-ing their emotions, initiating tasks, maintaining focus, rigid rules, lack of flexibility or being consistently over-whelmed.

Less is more because these kids are often more sensitive to environ-mental stimuli. Tone down the color scheme of their bedroom and play-room, and maintain uncluttered spaces. Clearly defined and labeled areas in certain rooms can help them know what to expect and how to use each space appropriately. Define areas and tasks with vi-sual aids to foster more focused, calm and flexible interactions. Consider creating a designated dressing area with hooks that hold the next day’s clothes and a laundry hamper. This provides a visual routine to follow

and structural aids to help complete the task successfully. Create a space to escape and regulate when they return home anxious, overwhelmed or ready to explode; a zone to help them feel calm and connected again. Dark and quiet spots are best, like the corner of a closet, bottom bunk, under a desk or even a cardboard box “cabin”. Add a flashlight, favorite books, beanbags, heavy or weighted blankets, handheld sensory toys and something that taps into the child’s current fascination.

Carolyn Dalgliesh is the founder of Systems for Sensory Kids & Simple Organizing Strategies in North Kingstown, RI, and author of The Sensory Child Gets Organized. Con-nect at CarolynDalgliesh.com.

Relax your attachment to expectations and realize

that your child sees, hears and feels the world

differently than you. Broaden your perspective

and make every choice a healthy choice.

~Martha Herbert

Safeguard ResilienceCurrently, the only treatment that has been proven to consistently improve the core symptoms of ASD is be-havioral therapy designed to foster language, socialization and academic skills. While effective, this approach is time- and staff-intensive. With the rise and prevalence of autism in the past decade, more parents are turning to complementary and alternative treatments (CAM). Hendren reports that the best re-searched and safest CAM therapies for treating autism include melatonin to improve sleep, omega-3 fatty acids to ease hyperactivity and possibly improve socialization, multivitamins to supplement a limited diet or poor appetite and methyl B12 injections to protect against oxidative stress. Mas-sage therapy has also proven effective in increasing connectivity with others and reducing over-arousal, while reducing ASD symptoms. Research remains in its infancy, but other CAMs deemed acceptable for a professionally monitored trial in-clude B6 and magnesium supplements to correct metabolic aberration, folic acid for improvements in core symp-toms, probiotics to ease gastrointesti-

nal distress and iron supplementation for a deficiency. Although clear benefits have yet to be backed by scientific evidence, many parents of children with ASD report that behavior improves with a diet free of the proteins gluten (found in wheat, barley and rye) and casein (found in dairy). Other parent-endorsed diets include anti-yeast, anti-hyperglycemia, specific carbohydrate, low-oxalate and specific food reaction regimens. A review article in the journal Autism Research and Treatment notes

that acupuncture, exercise, and mu-sic- and animal-assisted therapy have all been reported as helping to reduce a variety of ASD functional and be-havioral symptoms. From sound-dampening head-phones that offset loud noises to structuring the environment to an-ticipate transitions, removing stress-ors can help reduce the debilitating characteristics of ASD. “This improves abilities to learn and interact with oth-ers, but we also don’t want to shelter them from having a chance to learn the rules of social interaction in real-world situations,” advises Hendren. Because autism is a heteroge-neous disorder with numerous sub-types, the best individualized combi-nation of treatments can be challeng-ing to identify and can often change throughout one’s life. Bock reminds families that even with a successful treatment plan, “A parent’s love is the final element that brings these recov-ering children out of darkness into light.”

Meredith Montgomery publishes Natural Awakenings of Gulf Coast Alabama/Mississippi (HealthyLiving HealthyPlanet.com).


MONDAY, JANUARY 11Mini Sessions: Spirit Drawings With C. Bean – 7-8:20pm. Art Therapist and Reiki Practitioner C. Bean will connect with the image, shape and color information from the client’s energy field, then use colored pencils and pastels to reveal the wisdom of truth and healing energy through spirit-inspired drawings. $20, for a 20-minute session. The Reiki Center, 1540 W. 5th Ave., Columbus. 614-432-6632. TheReikiCenter.net.

TUESDAY, JANUARY 12Mini Sessions: Sound Healing With Kelly Bis-son, Reiki Master – 6:30-8:30pm. Everything is energy and vibration, including light, colors and sound. Come experience how different frequencies can enhance healing and wellbeing, through the use of tuning forks. $20, for a 20-minute session. The Reiki Center, 1540 W. 5th Ave., Columbus. 614-432-6632. TheReikiCenter.net.

WEDNESDAY, JANUARY 13A Healthy, Happy New Year Dinner – 7pm. Who says healthy food can’t taste good? Get that New Year’s resolution off to the right start at this month’s wine dinner. This waist-friendly gastro-nomic adventure includes expertly-paired wines, alongside a seasonal four-course dinner. $65 per person, excludes tax and gratuity. The Worthington Inn, 649 High St., Worthington. 614-885-2600. WorthingtonInn.com.

SUNDAY, JANUARY 17Treating Headaches: A Holistic Approach – 3-4pm. Headaches create significant distress for those who experience symptoms, both from the pain but also from a lack of solutions. Please join Dr. Jeff Brown as he discusses headaches from a holistic, chiropractic perspective. Learn about the common and not-so-common causes, often overlooked by traditional healthcare profession-als, and discover viable remedies. Free. Renew Wellness, 287 W. Johnstown Rd., Columbus. 614-305-5102. [email protected]. Renew-Wellness-Center.com.

WEDNESDAY, JANUARY 20Natural Ways to Decrease Depression and Anxiety – 6:30-8:30pm. Discover natural ways to help lessen depression and anxiety, conditions commonly experienced and amplified during, and even after, the holiday season. $20. Oasis of the Heart, 6135 Memorial Dr., Ste. 102E, Dublin. 614-273-5698. OasisOfTheHeart.com.

SATURDAY, JANUARY 2Cleanse and Clear for the New Year: Group Meditation – 10-11am. A new year offers the opportunity to let go of the past and breathe in a fresh perspective. Discover true release from thoughts and emotions that offer nothing produc-tive, specifically judgements, expectations and attachments from last year. Certified Meditation Instructor and Reiki Master Teacher Sheri Mollica-Rathburn will use breathing techniques and guided visualization to lead this group meditation. $10. Om2Ohm Meditation and Wellness Center, 324 W. Case St, Powell. 614-787-0583. Om2Ohm.com.Deep Chakra Healing and Activation – 11:30am-12:30pm. This group session will begin with cleansing and healing breathing techniques, followed by a visual journey to provide further balance to the chakras. Led by Certified Meditation Instructor and Reiki Master Teacher Sheri Mollica-Rathburn. $15. Om2Ohm Meditation and Wellness Center, 324 W. Case St., Powell. 614-787-0583. Om2Ohm.com.

FRIDAY, JANUARY 8New Year Reiki and Readings – 10am-8pm. Receive a 30-minute session of healing Reiki energy, plus intuitive guidance. Pre-registration recommended. $45. Om2Ohm Meditation and Wellness Center, 324 W. Case St, Powell. 614-787-0583. Om2Ohm.com.

SATURDAY, JANUARY 9Yoga and Herbs: Working With Insomnia – 1-2pm. Sleep is essential to maintaining a healthy lifestyle. Many factors can impact how we fall asleep, as well as the quality of sleep we get. We will discuss some basic nighttime strategies to get a good night’s sleep, plus tips on how to use gentle sedative herbs such as passionflower, hops and chamomile. Afterward, we will engage in a deep relaxation meditation practice called Yoga Nidra, which literally means “yoga sleep,” that can help decrease stress and anxiety while increasing quality of sleep. $30. Renew Wellness, 287 W. Johnstown Rd., Columbus. 614-305-5102. [email protected]. Renew-Wellness-Center.com.Introduction to Mental Alchemy: Part 1 – 1-3pm. Learn about the process of transmuting, transforming and changing various mental states and conditions into more desirable ones, for a more bal-anced and abundant self. Includes a free book. $60. Oasis of the Heart, 6135 Memorial Dr., Ste. 102E, Dublin. 614-273-5698. OasisOfTheHeart.com.Winter Psychic and Wellness Fair – 1-5pm. Featuring a variety of intuitive and wellness practitioners. $20, per each 20-minute session. The Reiki Center. 1540 W. 5th Ave., Columbus. 614-432-6632. TheReikiCenter.net.

calendarofeventsNOTE: All calendar events must be received via email by the 15th of the month and adhere to our guidelines. Email [email protected] for guidelines and to submit entries. No phone calls or faxes, please. Or visit NACentralOhio.com to submit online.

PLANS CHANGEPlease call ahead to

confirm date and times


WOMEN’S WELLNESS WINTER WARMER

January 29 - 5:30-9pm 5 :30 -9pm. Join Natural Awakenings magazine as we host our third annual winter social event. Experience products and services featured in our pages and discover additional like-minded business from the Central Ohio area. Free. WatersEdge Event and Conference Center, 4643 Trueman Blvd., Hilliard. NACentralOhio.com/WWWW2016.

PERIPHERAL NEUROPATHY RECOVERY WELLNESS

WORKSHOP JANUARY 28 • 6:30pm

6:30pm. This session is for those suffering from the following symptoms in the hands or feet: pins and needles, numbness, burning, stabbing, unsteadiness, weakness, hot/cold sensitivities, loss of feeling or discoloration. If “everything” has been tried, and medica-tion is not an option, learn how this non-drug program can help get life back on track. Pre-registration required, space is limited. Free. BioHealth Wellness Center, 1335 Worthington Woods Blvd, Worthington. 614-431-0555. BioHealthOhio.com.

featuredlisting

featuredlisting

SATURDAY, JANUARY 23Basic Level Integrated Energy Therapy Certi-fication Training: Part One – 9:30am-5:30pm. This two-day series focuses on self-healing, personal empowerment and energy therapy certi-fication to address emotional, mental and spiritual blocks, as well as physical issues. Taught by Jim Broyles, Ph.D., and David Galik, M.Ed., and in-cludes two workbooks. Pre-registration required. $240. Columbus Center for Spiritual Living, 3620 N. High St., Columbus. 614-707-1956. [email protected] Series, Part 1: Introduction to Crys-tals and Stones – Identifying and Working With Ancient Energy Forms – 10am-Noon. Learn about the origin of crystals and their metaphysical healing properties, plus how to clear the energy of crystals. Includes free crystal and sample of crystal gem elixirs. $30. Oasis of the Heart, 6135 Memorial Dr., Ste. 102E, Dublin. 614-273-5698. OasisOfTheHeart.com.Workshop Series, Part 2: Crystals and The Chakra System – 1:30-4:30pm. Learn about the basic Chakra System and how to identify crystals that can assist in clearing, healing and balancing the body’s chakras. Includes a healing guided chakra meditation and chakra crystals. $60. Oa-sis of the Heart, 6135 Memorial Dr., Ste. 102E, Dublin. 614-273-5698. OasisOfTheHeart.com.

SUNDAY, JANUARY 24Crystals for Beginners – 1-3:30pm. This work-shop is an introduction to the many types of crys-tals and some of the ways to use them. Learn about what crystals are, how they work, how to choose and purchase them, and more. $45. Om2Ohm Meditation and Wellness Center, 324 W. Case St, Powell. 614-787-0583. Om2Ohm.com.Basic Level Integrated Energy Therapy Certifi-cation Training: Part Two – 1-7pm. This two-day series focuses on self-healing, personal empower-ment and energy therapy certification to address emotional, mental and spiritual blocks, as well as physical issues. Taught by Jim Broyles, Ph.D., and David Galik, M.Ed., and includes two workbooks. Pre-registration required. $240. Columbus Center for Spiritual Living, 3620 N. High St., Columbus. 614-707-1956. [email protected].

Life is 10 percent

what happens to you

and 90 percent how

you react to it.~Charles R. Swindoll


ongoingevents

sundayFundamentals of Yoga – 10:30-11:45am. An introduction to all things yoga, from class etiquette to breathing and relaxation techniques. Mats are available to borrow. $15. Room to Breathe Yoga, 6260 S Sunbury Rd, Westerville. 614-378-4778. [email protected]. AmylyBrook.com.Kundalini with Alex Everett – 11:45am-1pm. An uplifting blend of spiritual and physical practices. This yoga style incorporates movement, dynamic breathing techniques, meditation, and the chant-ing of mantras. Yoga on High, 1081 N High St, Columbus. 614-291-4444. YogaOnHigh.com.Advanced Yingjie Tai Chi – 3-4pm. This Tai Chi style blends various martial arts into a philosophy designed to develop strength, relaxation, and self-defense. Positive energy for stress relief. $35/session, $85/monthly. The Grey Budha, 400 West Rich St, Columbus. 614-975-7683. GreyBudha.Weebly.com.Yin Yoga – 6-7pm. Lengthen connective tissue by releasing into each posture for three to five min-utes. Open to all, but not recommended for those in the third trimester of pregnancy. Shift, 1520 W 1st Ave, Grandview Heights. 614-407-4668. [email protected]. ShiftGrandview.com.Sekoia with Karine Wascher – 6:30-7:45pm. Yoga on High, 1081 N High St, Columbus. 614-291-4444. YogaOnHigh.com.

mondayMorning Meditation – 8:30-9am. An empower-ing and relaxing way to set the tone for the day or week. Shift, 1520 W 1st Ave, Grandview Heights. 614-407-4668. [email protected]. Shift-Grandview.com.

Urban Zen with Lori Moffet –12:30-1:30pm. This class is appropriate for everyone, whether recovering from an illness or injury or simply in need of tender loving care. The modalities of Urban Zen include gentle movements, restorative yoga poses, body scans, breath practices, aroma-therapy and Reiki. Each session guides students through a different symptom. Experience a respite from a busy day. Yoga on High, 1081 N High St, Columbus. 614-291-4444. YogaOnHigh.com.Next Level: High Intensity Training – 5:30-6:30pm. This total body workout shocks muscles with an always-changing format and set of ex-ercises. Any fitness level can have benefit from this program. Builds endurance, reduces body fat and increases flexibility. $10. Elite Physiques, 350 E Orange Rd, Lewis Center. 740-548-3637. ElitePhysiquesInc.com.Fascial Flow – 7-8pm. Incorporate foam rollers, trigger point props, stability equipment, develop-mental patterning, and yoga to uniquely access and work through tension, pain, and stress. Instructor: Melinda Cooksey, PhD. $20. All Life Center, 123 Hyatts Rd, Delaware. AllLifeCenter.org.

tuesdayTea for Tuesdays – 10am-6pm. During regular Tuesday business hours, come sample a warm tea in the cold months, and a cool tea in the warm months. Free. Boline Apothecary. 15 W Dunedin Rd., Co-lumbus. 614-517-0466. BolineApothecary.com.Chair Yoga – 11:15am-12:15pm. Designed for those who might have difficulty using a yoga mat, this class is suitable for all levels of practice and includes standing poses and balances, plus work along a wall to lengthen and strengthen the body. $15. Yoga-Well-Being, 1890 Northwest Blvd., Ste. 340, Columbus. 614-432-7553. YWBYoga.com.Mid-Day Hatha Yoga – 12:15-1pm. Prep the body to handle the rest of the day centered, grounded, but stimulated and strong. Open to all levels. Shift, 1520 W 1st Ave, Grandview Heights. 614-407-4668. [email protected]. Shift-Grandview.com.Hot Flow Level 1/2 with Anne Weidinger – 7:30-8:15pm. Grow Yoga, 1780 W 5th Ave, Grandview Heights. 614-291-4444. YogaOnHigh.com.iRest Yoga Nidra with Michele Vinbury – 7:30-8:15pm. iRest® Yoga Nidra is an evidence-based, ancient transformative practice of deep relaxation and meditative inquiry. Release negative emotions and thought patterns, and calm the nervous system. Develop an inner sanctuary of well-being and equanimity that underlies all life circumstances. Learn how to live contentedly and free of conflict, anxiety, fear, and suffering by opening mind and body to their inherent health and wholeness. Yoga on High, 1081 N High St, Columbus. 614-291-4444. YogaOnHigh.com.Big Asana with Michelle Winship – 7:30-9pm. A safe space for people with larger bodies who may not have felt welcomed and honored in other movement classes. Yoga on High, 1081 N High St, Columbus. 614-291-4444. YogaOnHigh.com.

classifieds

Classified ads are $1 per word, per month. Minimum 25 words. To place a listing, email content to [email protected]. Submission deadline is the 15th of the month.

BUSINESS OPPORTUNITY

SEEKING THRIVING INTEGRATIVE WELL-NESS CENTER IN COLUMBUS – Seeking func-tional medicine MD/DO for clinical supervision, with the option of eventually purchasing the practice. Send inquires to Practitioner [email protected].

HELP WANTED

SEEKING QUALIFIED DELIVERY DRIV-ERS - As Natural Awakenings continues to grow we are looking for regular readers to help expand our distribution network in the Central Ohio community. Must have own vehicle and a flexible schedule, roughly 5-10 hours monthly. Pay is per stop and based on city-specific routes. E-mail [email protected] to apply.

MEDITATION GROUP

JEWISH MEDITATION PROJECT OF CO-LUMBUS – Offers silent, walking, and guided meditations, with themes and chants drawn from traditional sources. For anyone interested in building a mindfulness practice. 614-738-0389. JewishMeditationColumbus.org.

ORGANIC BEEF

FOR SALE – Freezer beef, high in omega-3s. One-hundred percent grass fed, with no grain finishing. Economical, healthy, and raised at Pleas-ant Springs Farm, Mount Vernon. 740-427-9001. OEFFA.org/userprofile.php?geg=1073.


or call: 888-822-0246

Boost Your Mood and Energy Levels!One Serving Has the Equivalent Antioxidants

of Four Servings of Fruits and Vegetables.Made with certified-organic, non-GMO, Paleo profile ingredients, Natural Awakenings Green Powder supplement nourishes and strengthens every system in your body, resulting in:• SUSTAINED ENERGY • ENHANCED RECOVERY• MENTAL CLARITY • OVERALL WELL-BEING

9.5-oz jar $54.99 (30-day supply) plus $5 for shipping



wednesdayMorning Meditation – 8:30-9am. An empower-ing and relaxing way to set the tone for the day or week. Shift, 1520 W 1st Ave, Grandview Heights. 614-407-4668. [email protected]. Shift-Grandview.com.Hatha Level 1/2 with Jodi Patton – 9:30-11pm. This is an appropriate class for students who have completed Yoga on High’s Hatha New Beginner Class or have equivalent introductory yoga experience. This mixed-level class allows students continue the study and practice of Hatha yoga fundamentals; students are also invited to explore more advanced poses with the comfort of modifications. Yoga on High, 1081 N High St, Columbus. 614-291-4444. YogaOnHigh.comKundalini Yoga – 5:45-7:45pm. An all-encom-passing yoga that uses pranayam (breathing techniques), yoga posture, movements, mantra, deep relaxation, and meditation. Flexibility is not required, however, and open mind is important. $15/drop-in, $12/two or more classes. Center for Wholeness, 4041 N High St, 614-596-6385. [email protected]. CFWohio.org.Weight Loss Workshop – 6-7pm. Informative Workshop with Dr. Ardie Singh, introducing Nu-triMost All-Natural Ultimate Weight Loss System. Learn more about correcting hormone levels, clearing toxins, losing fat and restoring balance to the body. Free. Worthington Health Solutions, 55 Caren Ave, Ste 360, Worthington. 614-436-9355. 614FatLoss.com.Tai Chi – 6-7:15pm. A moving meditation done standing that centers and grounds the practitioner. Build strength and balance in the physical body while enhancing internal vital energy. Shift, 1520 W 1st Ave, Grandview Heights. 614-407-4668. [email protected]. ShiftGrandview.com.Beginning Yingjie Tai Chi – 6:30-8pm. This Tai Chi style blends various martial arts into a philosophy designed to develop strength, relaxation, and self-defense. Positive energy for stress relief. $35/session, $85/monthly. The Grey Budha, 400 West Rich St, Columbus. 614-975-7683. GreyBudha.Weebly.com.

thursdayMixed Level Vinyasa Flow Yoga – 9:30-10:30am. Participants build strength, plus increase flexibility and balance. Poses move gracefully from one to the next, using the inhalation and exhalation of the breath as a guide for each movement. Taught by Lisa Chorey. $15/drop-in. Elite Physiques, 350 E Orange Rd, Lewis Center. 740-548-3637. ElitePhysiquesInc.com.Sekoia with Michele Vinbury – 9:45-11am. Yoga on High, 1081 N High St, Columbus. 614-291-4444. YogaOnHigh.com.$5 Karma Yoga – 12-1pm. Grow Yoga, 1780 W 5th Ave, Grandview Heights. 614-291-4444. YogaOnHigh.com.Mid-Day Hatha Yoga – 12:15-1pm. Prep the body to handle the rest of the day centered, grounded, but stimulated and strong. Open to all levels. Shift, 1520 W 1st Ave, Grandview Heights. 614-407-4668. [email protected]. ShiftGrandview.com.

Anxiety and Depression Group – 4-5:30pm. Small group to provide support for individuals struggling with anxiety, depression, panic attacks, PTSD, or bipolar disorder. Individual must be screened through a brief phone interview before attending group. $30-$40/session. Dr. Schulz, 4230 Tuller Rd, Suite 201, Dublin. 614-766-0379. [email protected]. EMAPDrSchulz.com.Turtle Flow Yoga – 6:35-7:35pm. Experience completeness by integrating breath and movement to create a powerful and stabilizing, yet delicate and meditative flow. The measured pace supports quality of breath, postural alignment, and aware-ness of the body and mind. Great for beginners to advanced yogis. $15. Arena District Athletic Club, 325 John H. McConnell Blvd, Ste 150, Columbus. 614-719-9616. MaggieFekete.com.Columbus Threshold Choir – 7-8:30pm. For those who can carry a tune, and enjoy conveying kindness through singing. This all-women choir is dedicated to singing at the bedsides of those struggling between living and dying. 35 Oakland Park Ave, Columbus. Free. 614-580-2551. Thresh-oldChoir.org/Columbus.Kundalini Yoga as Taught by Yogi Bhajan – 7-8:30pm. All Life Center, 123 Hyatts Rd, Dela-ware. $15. 812-219-2339. [email protected]. AllLifeCenter.org.

friday$5 Karma Yoga – 3-4pm. Yoga on High, 1081 N High St, Columbus. 614-291-4444. YogaOnHigh.com.

Dancing Mindfulness – 7:30-8:30pm. For begin-ners and experienced movers alike, this medita-tion and creative movement class explores the mind-body connection and mindfulness through dance. $10 suggested donation. Center for Whole-ness, 4140 N High St, Columbus. 614-546-6264. DancingMindfulness.com.

saturdayFree Meditation with Jasmine Grace – 8-8:20am. Join Jasmine Grace for a pre-practice meditation. A short, but complete meditation practice. Yoga on High, 1081 N High St, Columbus. 614-291-4444. YogaOnHigh.com.Guided Meditation – 10-11am. The perfect class for beginners and those who have never meditated before. Relax the mind and return home energized and refreshed. Certified Meditation Instructor Sheri Mollica-Rathburn will teach new tools and techniques for dealing with stress, anxiety, and negativity while demonstrating how to benefit most with the breath. Drop-ins welcome. $10. Om2Ohm Meditation and Wellness Center, 324 W Case St, Powell. 614-787-0583. Om2Ohm.com.Hatha Beginner Drop-In with Mary Ellen Bib-yk – 10:30-11:45am. Class assumes no prior yoga experience and covers basic breath work and yoga postures. Simple stretches and deep relaxation are included each week. Yoga on High, 1081 N High St, Columbus. 614-291-4444. YogaOnHigh.com.Ashtanga Beginner Drop-in with Stella Cor-nett – 12-1:30pm. Yoga on High, 1081 N High St, Columbus. 614-291-4444. YogaOnHigh.com.

Step Up to the Challenge!614.279.1700 | ClimbColumbus.org

FEBRUARY 20, 2016RHODES TOWER | COLUMBUS, OH

40 FLOORS | 880 STEPS

Thanks to Our SponsorsNATIONAL CORPORATE TEAM PARTNER


Turn Your Passion Into a Business

Own a Natural Awakenings Magazine Our publishers ranked us among the highest

in franchise satisfaction for our Training, Support, Core Values and Integrity!

For more information, visit our website NaturalAwakeningsMag.com/mymagazine

or call 239-530-1377

Natural Awakenings is now expanding into new markets across the U.S. Contact us about starting a magazine in a community of your choice or acquiring an existing pub-lication for sale highlighted in red below.

Natural Awakenings publishes in over 95 markets across the U.S. and Puerto Rico. • Huntsville,AL• GulfCoastAL/MS*• Phoenix,AZ*• Tucson,AZ• EastBayArea,CA• SanDiego,CA• Boulder,CO*• Denver,CO• FairfieldCounty,CT• Hartford,CT• NewHaven/

Middlesex,CT• Washington,DC• Daytona/Volusia/

Flagler,FL• NWFLEmerald

Coast• Ft.Lauderdale,FL• Jacksonville/

St.Augustine,FL• Melbourne/Vero,FL• Miami&the

FloridaKeys• Naples/Ft.Myers,FL• NorthCentralFL• Orlando,FL• PalmBeach,FL• PeaceRiver,FL• Sarasota,FL• Tampa/St.Pete.,FL• FL’sTreasureCoast• Atlanta,GA• HawaiianIslands• Chicago,IL• ChicagoWestern

Suburbs,IL• Indianapolis,IN• BatonRouge,LA• Lafayette,LA• NewOrleans,LA• Portland,ME• Boston,MA• AnnArbor,MI• EastMichigan• WayneCounty,MI*• WesternMI*• Minneapolis/

St.Paul,MN• Charlotte,NC*• LakeNorman,NC*• Triangle,NC• Bergen/Passiac,NJ*• Central,NJ

• HudsonCounty,NJ• MercerCounty,NJ• Monmouth/

Ocean,NJ• NorthCentralNJ• SouthNJ• SantaFe/Abq.,NM• LasVegas,NV• Albany,NY• Buffalo,NY• CentralNY• LongIsland,NY• LowerHudson

ValleyWest,NY• Manhattan,NY*• Queens,NY• Rochester,NY• Westchester/

PutnamCo’s.,NY• CentralOH• Cincinnati,OH• Toledo,OH• OklahomaCity,OK• Portland,OR*• Bucks/Montgomery

Counties,PA• Harrisburg/York,PA• Lancaster/Berks,PA• LehighValley,PA• Pocono,PA/

WarrenCo.,NJ• Scranton/

Wilkes-Barre,PA• RhodeIsland• Charleston,SC*• Columbia,SC• GrandStrand,SC*• Greenville,SC• Chattanooga,TN• Knoxville,TN*• Memphis,TN• Austin,TX• DallasMetroplex,TX• Dallas/FWMetroN• Houston,TX• SanAntonio,TX*• SETexas• Richmond,VA• VA’sBlueRidge• Seattle,WA• Madison,WI• Milwaukee,WI• PuertoRico

Natural AwakeningsrecentlywontheprestigiousFBR50FranchiseSatisfactionAwardfromFranchiseBusinessReview.Tolearnmore,visitFranchiseBusinessReview.com

• Meaningful New Career

• Low Initial Investment

• Proven Business System

• Home-Based Business

• Exceptional Franchise Support & Training

As a Natural Awakenings publisher, you can enjoy learning about healthy and joyous living while working from your home and earn a good income doing something you love!

No publishing experience is necessary. You’ll work for yourself but not by yourself. We offer a complete training and support system that allows you to successfully publish your own magazine.

* Existingmagazinesforsale


ACUPUNCTURE

FINE BALANCE ACUPUNCTUREMelanie Campbell, L.Ac830 E Johnstown Rd, Ste C, Gahanna614-584-7989MKC@FineBalanceAcupuncture.comFineBalanceAcupuncture.com

Our practice is based on the most essential belief in Traditional Chinese Medicine: balance. Whether you

are experiencing a chronic or acute problem, restoring balance is the key to your well-being. Regardless of what might be ailing you (infertility, high stress, etc.), acupuncture is a natural and effective medical option that not only treats an illness, but assists in preventing it. We help you regain balance and restore harmony in the body, so it can function optimally.

ALLERGY TESTINGCOLUMBUS LASER ALLERGY Ginny Johnsen Rockenbaugh, RD, LD, CLT, CHHP 6797 N High St, Ste 221, Worthington [email protected] BalancedWellnessAndNutrition.net

Columbus Laser Allergy’s Laser Allergy Relief Program uses the LZR7™, targeting the problem at its source – the immune system. Medications and shots only treat symptoms, so results are temporary and require continual daily, weekly or monthly doses for several years. Our program differs by painlessly and effectively identifying allergens, then re-educating the immune system to no longer react inapproriately to them. See ad, page 26.

APOTHECARY

BOLINE APOTHECARYLily Shahar Kunning, Owner15 W Dunedin Rd, Columbus614-517-0466Lily@BolineApothecary.comBolineApothecary.com

We are an old-fashioned apothecary that makes tonics and body care for the community. Our shop i s run by an

herbalist who uses time-tested, tried-and-true methods to select and curate her “good for you” offerings. We also carry local and national lines of homeopathic remedies, Ayurvedic medicine, Traditional Chinese Medicine (TCM), dried bulk herbs, spices, body care ingredients and essential oils. Classes are held regularly on the demonstration and hands-on creation of human and pet remedies. Many of our raw ingredients are sourced locally, so be sure to visit regularly to view our seasonal offerings. See ad, page 10.

BIOFEEDBACK

BRAINCORE THERAPYDeb Wellmes, MA, CCC/SLP, NDBeecher Wellness Center428 Beecher Rd, Ste B, [email protected]

Bra inCore Therapy™ provides a unique, drug-free approach to treating Brainwave Dysregulation, a condition brought about

by tension on the nervous system from a variety of factors. Brainwave Dysregulation may be associated with several neurological conditions such as ADD/ADHD, insomnia, panic attacks, autism, anxiety, memory loss, TBI, migraines and PTSD.

naturaldirectoryConnecting you to the leaders in natural healthcare and green living in our community. To find out how you can be included in the Natural Directory email [email protected] to request our media kit.

CHIROPRACTIC

BEECHER CHIROPRACTICDr. Joseph IuvaraDr. Benjamin LongDr. Paul Valenti428 Beecher Rd, Ste B, Gahanna614-855-5533BeecherChiro.com

We l c o m e t o B e e c h e r Chiropractic and Wellness Center. Our goal is to help improve your health through complementary and integrative techniques designed to enrich and balance your everyday

life. Our team of doctors and therapists have created a welcoming environment where each person is treated based on their own unique needs. Balancing all aspects of a person on an individual basis, and offering cutting-edge treatments that are only available in our center, sets us apart as Ohio’s foremost chiropractic and wellness center.

WORTHINGTON OPTIMAL WELLNESSDr. Julia Keiser 6180 Linworth Rd, Worthington 614-848-5211 [email protected] WorthingtonOptimalWellness.com

Worthington Optimal Wel lness has been helping people reach their optimal health for over 25 years through;

Master Level Chiropractic, Acupuncture, Expert Massage, Natural Weight Loss. Nutritional Cleansing, Allergy Cessation and other holistic treatments. Visit central Ohio’s most experienced and comprehensive wellness center at Worthington OptimalWellness.com. See ad, page 35.

DAY CARE - ORGANIC

THE BARRINGTON SCHOOL6046 Tara Hill Dr, Dublin614-336-300010655 Sawmill Pkwy, Powell614-336-0000***Opening in May 2016***Cemetery Rd, HilliardSawmill/Bethel Rd, [email protected]

The Barrington is an all-inclusive child ca re fac i l i ty fo r i n f a n t s t h r o u g h

school age. We are proud to offer organic meals prepared from natural, fresh ingredients and free-range, non-processed meats. We have exceptional teacher-to-student ratios, and all our instructors are experienced and well-educated. Daily classes feature a rotation of gymnastics, dance, music, yoga and cooking. See ad, page 19.

Reach YourTarget Market

Secure this ad spot!Contact us for special one-time ad rates.


DENTISTRY

DENTAL ALTERNATIVESDr. Richard DeLano, DDS, MS150 E Wilson Bridge Rd, Ste 150, Worthington614-888-0377DentalAlternatives.net

Dental Alternatives is the dental office of Richard M. DeLano III, DDS, MS. Dr. DeLano pract ices

general dentistry with a holistic approach. He takes time with his patients to explain the choices they have concerning their oral health. Dental Alternatives is a mercury-safe and fluoride-free dental practice. Visit our website to learn more. See ad, page 46.

DIGESTIVE HEALTH

ALTERNATIVE HEALTH OASISKate Dixon, Loomis Digestive Specialist, CNHP, Certified Colon HydrotherapistDr. Michael H. Fritz, Chiropractor, Certified Applied Kinesiologist, Certified Microscopist, Naturopathic Doctor10223 Sawmill Pkwy, Powell614-717-9144Info@AlternativeHealthOasis.comAlternativeHealthOasis.com

Each year statistics show that more Americans complain of d i g e s t i v e p a i n . T h e s e discomforts are commonly attributed to symptoms such as: stomachache, allergies, skin problems, depression, anxiety,

immune dysfunctions and diarrhea. They may also be related to chronic pain, bloating and cramps. We believe diet and digestion play a major role in the prevention and reversal of chronic degenerative disease. We objectively test and compare against our extensive patient history survey to determine which specific enzymes and nutrients are missing from the client, and then help bring the body back into balance.

THAT ENZYME LADYChristina McLaughlin, Loomis Digestive Health Specialist, CNHP, EPT PractitionerBased in [email protected]

In our world today, stress a leading cause of disease. Stress comes in three forms: mechanical, emotional and nutritional. Each form includes excesses and deficiencies. I am trained and certified to determine your source of stress, using a combinat ion of object ive diagnostic tools: palpation, 24-hour

urinalysis, plus postural and lymphatic function exams. Urinalysis is particularly effective, as it pinpoints the biochemistry of the body and paints a clear picture of your individual health. Furthermore, I educate my clients on strategic lifestyle changes and use customized enzyme replacement therapy to relieve dietary stress, support specific organ systems, and restore normal function. Whether I am the most recent stop on your health journey, or your first curious inquiry, my passion is to restore balance in people so they can live a fulfilling life with renewed vitality. Call me for a free initial 25-minute consultation.

ESSENTIAL OILS

DOTERRA ESSENTIAL OILSLori and Mark Vaas, Blue Diamond Wellness Advocates614-582-7680LoriVaas@gmail.comHealing-Essential-Oils.com

Who is controlling your health care? Empower yourself with Nature’s

medicine: essential oils! We will teach you how at our free classes. doTERRA is the only brand to be third-party certified as 100 percent pure and potent, and why it is currently being used in many hospitals, including locally at the OSU’s James Cancer Hospital. Email us for a current class schedule, or to schedule your free private consult. Also visit our Facebook page – Lori’s Essential Oil Well. See ad, page 29.

FENG SHUI

FENG SHUI INSTITUTE OF AMERICAConnie Spruill, Owner/Director An International Feng Shui Certification School614-325-5452 (cell)614-837-8370 (school)[email protected]

We enroll new students throughout the year for feng shui certification. Our program teaches a scientific a n d m i n d f u l a p p r o a c h , incorporating brain science and teaching only remedies that are backed up by science. We offer a proven business system training

that guarantees new profit centers for your holistic practice. We are a Certified Gold School with the International Feng Shui Guild. Private feng shui consultations are available for residential and businesses. Continuing education courses can be customized for your industry. If you are not inclined to enroll in full certification, we offer a personal feng shui coaching course to apply to your own life. See ad, page 20.

FURNITURE

T.Y. FINE FURNITUREWes Miller, Sales Manager106 E Moler St, Columbus614-929-5255Service@TYFineFurniture.comTYFineFurniture.com

We custom design and hand produce al l our unique commercial and home décor pieces from naturally fallen timber, applying water or milk-based glues and a

proprietary organic wood finish. Our furniture is heirloom quality and guaranteed for life. We also sell a handpicked selection of Ohio-made organic mattresses, to help reduce harmful chemical exposure in your home. See ad, page 13.

HOME DÉCOR

NIKWORKSVijayakumar Kannan, OwnerBased in [email protected]

Nikworks was started to help revive the production of traditional, handcrafted arts in Ind ia wh i l e f i nanc ia l ly supporting organizations that operate at the grassroots level to educate, empower and raise the standard of living for

underpriveleged communities throughout the world. We carry décor and accent pieces made from silk, cotton, silver, gold, brass and sandalwood. Please visit our online store for further product details.

Pleasant Dreams™ contains a blend of safe, natural, sleep-inducing ingredients including chamomile, valerian root and melatonin which may help to:

• Facilitate relaxation without morning drowsiness

• Maintain sleep all night• Reduce anxiety symptoms• Improve pain tolerance

Consult a healthcare professional before taking this product. Pleasant Dreams is not intended to cure, treat, diagnose or mitigate any disease or other medical conditions. These statements have not been evaluated by the U.S. Food and Drug Administration.


or call: 888-822-0246

Fall Asleep Safely, Quickly and Naturally!

60 capsules: $34.99 plus $5 shipping



INTEGRATIVE THERAPY

OASIS OF THE HEARTTabby Sapene, MSW, LISW-S6135 Memorial Dr, Ste 102E, Dublin614-273-5698OasisOfTheHeart.com

At Oasis of the Heart, we are dedicated to addressing our clients’ needs based on a h o l i s t i c a p p r o a c h , integrating all aspects of their experience. We see the events that one experiences in life as opportunities to

grow – mentally, physically, emotionally and spiritually. Create a more balanced life by becoming in tune with your “whole” self. We provide counseling, consultation, energy therapy, crystal therapy and guided meditation/imagery, plus offer a selection of energy-infused crystal jewelry and organic skin care products.

JEWELRY

AUDACIOUS BOUTIQUEMary Curran, Owner4375 W Dublin-Granville Rd, Dublin614-799-8951AudaciousBoutique.com

Audacious Bou-t ique fea tu res American-made c l o t h i n g a n d

jewelry items, including sustainably-made pieces from Alex and Ani, plus locally-made organic herbal salves. We also offer a wide variety of sunglasses, scarves, handbags and accessories. Let us help you build your wardrobe, from top to bottom. We carry products for all ages. Stop in to see our rotating seasonal offerings. See ad, page 37.

MASSAGE THERAPY

KNOX COUNTY CAREER CENTER - SCHOOL OF MASSAGE THERAPYDiane Fisher, LMT, NMT, Program Coordinator308 Martinsburg Rd, Mount [email protected]

W h e t h e r y o u a r e interested in a career in massage therapy, or prefer to rece ive a massage from one of our qualified students, we

are here for you. Founded in 1999, KCCC Massage offers small classes with individualized instruction and hands-on experience. Our 817-hour program focuses on three areas: therapeutic massage, anatomy and physiology, and professional development. Call today for more information about our program or student clinic. See ad, page 36.

MEDITATION

OM2OHM WELLNESS STUDIOSheri Mollica-Rathburn, Owner, C.MI324 W Case St, [email protected]

O m 2 O h m w i l l change the way you think about stress management. We

offer Peace Management for individuals and groups, teaching management of daily peace as opposed to stress. Through Certified Meditation Instruction, Sound Healing, Chromotherapy, Mindfulness based guidance, Energy and Body Work we will transform and empower you. Allow yourself time for peace in our beautiful Om2Ohm wellness center, leave your worries at the door and enter into your “Om away from home”.

HYPNOTHERAPY

INTEGRATIVE HYPNOTHERAPYTD Hickerson, Certified Hypnotherapist77 E Wilson Bridge Rd #200, Worthington614-304-1061Info@Integrative-Hypnotherapy.comIntegrative-Hypnotherapy.com

At Integrative Hypnotherapy, we help our clients grow through the issues that kept them frustrated, worried and hurt. We help them find the relief they need, and build confidence, peace and ease into their daily lives. We do this by getting to the root of the matter (the thoughts and beliefs

in the mind) and that is precisely why the changes stick. If you need some support in making a lasting positive change, schedule yourself a free phone consult today at In-Hyp.com/free, or call us at (614) 304-1061. P.S. - We can help with a number of issues. See In-Hyp.com/155 for a list of some of the issues we work with. See ad, page 5.

INTEGRATIVE PSYCHIATRY

BRAIN ENERGY MDDr. Linda Cole, MD287 W Johnstown Rd, Gahanna614-887-7731BrainEnergyMD.com

Optimize your journey to wellness. Specializing in t r e a t m e n t p l a n s f o r depression, mild cognitive impairment, adult ADHD, OCD, anxiety and other mood disorders. Integrative P s y c h i a t r y c o m b i n e s

medical and holistic approaches to find and correct the underlying causes of disease, by first looking where problems tend to begin (in your gut, immune and endocrine systems) and then testing for your particular imbalances and deficiencies.

To advertise or participate in our next issue, call 614-427-3260

FRIENDSHIPS CAN LAST A LIFETIME

Now is an ideal time to start a relationship with Natural

Awakenings. Advertise in our February Friendship and

Dental Health Issue


All great achievements require time.

~Maya Angelou

Let the event organizer know you heard about it in

Natural Awakenings!

NATURAL FOODS

BEXLEY NATURAL MARKET508 N Cassady Ave, Bexley614-252-3951BexleyNaturalMarket@yahoo.comBexleyNaturalMarket.org

The Bexley Natural Market is a not-for-profit coop-e ra t ive g roce ry s to re dedicated to providing food of the highest possible nutritional quality to our members and community.

We provide many local and organic products, bulk foods, organic herbs and spices, as well as a vast array of vitamins and supplements to support the health of our customers. We like to support local businesses and farmers by being a space in which their products are available. See ad, page 20.

IT’S ALL NATURAL!1360 Cherry Bottom Rd, Gahanna614-476-6159ItsAll-Natural.com

It’s All Natural! is a prominent source of vegetarian and vegan products, offering organic, eco-conscious and down-to-earth items. Our mission is to promote a benevolent, eco-friendly and vegan lifestyle. We strive to be

fertile ground where seeds of love can be planted to grow in health and harmony. See ad, page 20.

RAISIN RACK NATURAL FOOD MARKET2545 W Schrock Rd, Westerville614-882-5886RaisinRack.com

Raisin Rack offers a complete variety of organic groceries, including gluten-free

foods, vegan/vegetarian products, and dairy-free items. Bulk grains, herbs, nuts and seeds accompany organically-grown fruits and vegetables, as well as a complete selection of vitamins, minerals, herbals and other nutrients from leading national brands. See ad, page 23.

NATUROPATHY

PHOENIX WELLNESS CENTERDr. Trudy Pieper, NDDr. Allison Engelbert, ND10 S Main St, Johnstown740-616-9949PhoenixWellness4U.com

Drs. Trudy and Allison are board c e r t i f i e d a n d accredited by the

American Naturo-pathic Medical Association (ANMA), the oldest and largest professional naturopathic medical organization in the U.S. Dr. Trudy is author of Prevention is the Cure for Cancer and was awarded the ANMA 2014 Higher Achievement Award. Dr. Allison is a Master Herbalist and specializes in women’s wellness.

PET SERVICES

GREEN SCOOPJendell Duffner, OwnerBased in [email protected]

We are a unique pet w a s t e r e m o v a l company that recycles dog, cat, rabbit, and chicken waste by

converting it to either EPA-approved compost or natural gas and electricity. We can accommodate any size household, community or business. We also sell compost, mulch, topsoil, firewood bundles and compostable dog waste bags, and donate a percentage of the proceeds to local charitable and environmental organizations. See ad, page 33.

PSYCHOLOGICALCOUNSELING

GEORGE O. SCHULZ, PH.D.4230 Tuller Rd, Ste 201, Dublin614-766-0379 EMAPDrSchulz.com

Dr. Schulz is a licensed psychologist who specializes in a gentle, integrative approach that provides: relaxation, release from post-traumatic stress, and relief from depression, anxiety or panic attacks. He provides skills training for both healthy conflict resolution and building healthy interpersonal relationships at home and work. He is grounded by an inclusive, faith-based Christian perspective that involves grace, forgiveness and a loving Creator, instead of fear or judgment.

REAL ESTATE

DUNIGAN REAL ESTATE GROUPCindy Dunigan, Realtor3500 N High St, [email protected]

There are only a handful of Realtors in the Central Ohio area t h a t c a r r y t h e N a t i o n a l Association of Realtors GREEN designation, and Cindy Dunigan is one of them. She has taken the

initiative to encourage the industry to produce more sustainable homes, and helps communities to reduce their consumption by implementing sustainable practices. Cindy is devoted to reducingher own footprint on the environment, and livesby her motto: “We can make a significant impacton the world around us one person at a time.”

REIKIHEALING TOUCH WELLNESSSara Awad, Certified Reiki Practitioner1516 W First Ave, Grandview Heights123 Hyatts Rd, Delaware614-535-8787Sara@HealingTouchColumbus.comHealingTouchColumbus.com

Optimize your journey to wel lness wi th holistic care for the mind, body and spirit. Tradi t ional Reiki p r o v i d e s a s a f e ,

effective approach to stress reduction, pain relief, weight loss, and recovery from illness, injury or addiction. We also offer aromatherapy, essential oils and the Raindrop Technique® from Young Living.

TOTAL ENERGY HEALTHSue Marting, RMT4238 Broadway, Grove City614-499-2572TotalEnergyHealth.com

Total Energy Health is a holistic healing practice that focuses on stress reduction, pain relief, and recovery from illness and injury at the physical, mental, emotional and spiritual level. Each service is customized for the client’s maximum benefit. Benefits include increased energy, pain relief, reduced stress and a better night’s sleep. Sue Marting is a certified Reiki Master Teacher and practices Reiki, Integrated Energy Therapy, Tapping, Access Bars, Reflexology and Raindrop Technique. See ad, page 12.

Work like you don’t need the money. Love like you’ve never been hurt. Dance like nobody’s watching.

~Satchel Paige


THE REIKI CENTERLinda Haley, RMT, Director 1540 W 5th Ave, Columbus 614-486-8323 TheReikiCenter.net

The Reiki Center is Central Ohio’s oldest and largest natural wellness center, plus the only center to offer Reiki classes in the traditional format. More than 20 services are available to meet your wellness,

spiritual and emotional goals, including energy therapies, therapeutic bodywork, shamanic and intuitive services, as well as animal therapies. Open daily from 9am-9pm. See ad, page 19.

YOGA

GOYOGAFour locations: New Albany, Powell, Upper Arlington, Worthington 844-469-6428 GoYogaUSA.com

At GoYoga, we are regular working people with busy schedules and t ight budgets , on a

mission to inspire the Central Ohio community through providing convenient and affordable yoga classes, taught by compassionate and knowledgeable instructors. With over 150 programs each week, ranging from Beginners Series, workshops, and 100, 200 and 500-hour teacher training courses, we are here to provide you with a life-changing opportunity to live stronger, healthier and more mindfully. REAL YOGA FOR REAL PEOPLE! See ad, page 45.

RENEW WELLNESSJamie Eversole, RYT-200, LISW287 W Johnstown Rd, Gahanna614-305-5102JamieEversole@Renew-Wellness-Center.comRenew-Wellness-Center.com

As wi th a l l serv ices p r o v i d e d a t R e n e w Wellness (RW), RW Yoga is committed to helping students discover and

become their best selves. Classes, from gentle yoga to power flow, are designed such that participant can connect with a deeper level of being,and achieve a state of peace and contentment within. Teachers double as mental health professionals, so classes are therapeutic in nature and also trauma sensitive. In addition to strengthening the physical body, sessions provide students with practices that help to decrease stress, increase energy, develop mindfulness, and create more balance overall. RW Yoga offers a full weekly drop-in schedule, as well as workshops and series classes. Come try your first class for free! See ad, page 29.

SALON/SPA

THE NATURAL NAIL SPA8487 Sancus Blvd, Columbus 614-985-3205 TheNaturalNailSpa.com

Incorporating the most n a t u r a l p r o d u c t s a n d processes for manicure, pedicure and waxing, while maintaining the highest

level of cleanliness and sterilization available. See ad below.

VIRTUE SALONMelanie Guzzo, Owner3282 N High St, Columbus614-725-2329VirtueVeganSalon.com

We are committed to helping men and women enjoy the luxuries of the modern beauty industry without harming animals, the environment or our health. We are dedicated to working in an

organized, stress-free setting while enjoying a holistic lifestyle within true community. See ad, page 19.

WELLNESS CENTER

BIOHEALTH WELLNESS CENTERDr. David Siegel, Chiropractic Physician, CCN, DACBN1335 Worthington Woods Blvd, Worthington614-431-0555BioHealthOhio.com

At BioHealth Wellness Center, we restore hope through treating the underlying causes of

your health challenges by providing customized, natural, drug-free care. With more than 30 years of experience, Dr. Siegel uses a unique approach of targeted toxicology, hormonal and nutritional imbalance corrections, and brain dysfunction therapies. Our services include Field Control Therapy, Neurofeedback, Interactive Metronome, Quantum Reflex Integration and Hako-Med Horizontal Therapy. We are truly a place Where Wellness Begins. See ad, page 25.

Wellness is not a ‘medical fix’ but a way of living—a lifestyle that’s

sensitive and responsive to all the dimensions of body, mind and spirit, an approach to life we each

design to achieve our highest potential for well-

being now and forever.~Greg Anderson

When deeds speak, words are nothing.

~Pierre-Joseph Proudhon

natural awakenings central ohio - january 2016 issue

Documents