freeman manufacturing and supply company

®

Freeman Manufacturing and Supply Company

ModelmakingMoldmakingPrototyping

PatternmakingFoundry Supplies

Composites

Vol. 24

www.freemansupply.com

Montreal, QCPortland, OR

OrderingFor fast and accurate ordering, always refer to the catalog number for each product.

Quotations & PricesQuotations will be given upon request. Prices are subject to change without prior notice and do not include sales or excise taxes which may be applicable in your area.

Shipping InformationWhen specific shipping information is NOT given by the customer, we will make every attempt to ship best way.

Returned GoodsTo save transportation charges, and facilitate handling of merchan-dise upon our receipt, no merchandise returns will be accepted without prior written authorization.

Damaged GoodsMerchandise given to a transportation firm is their responsibility to deliver in satisfactory condition. If merchandise is delivered damaged, the customer should note as such on freight bill and file a claim with the delivering carrier. Regulations require that hidden damage, identi-fied upon unpacking, must be reported within ten (10) days of delivery in order to file a proper claim.

Liability/Warranty StatementOur products are intended for sale to industrial and commercial cus-tomers. We request that customers inspect and test our products before use and satisfy themselves as to contents and suitability. Nothing herein shall constitute a warranty, expressed or implied, including any warranty or merchantability or fitness, nor is protection from any law of patent to be inferred. All patent rights are reserved. The exclusive remedy for all proven claims is replacement of our materials and in no event shall we be liable for special, incidental, or consequential damages.

Copyright 2011 Freeman Manufacturing & Supply Co. All Rights Reserved Freeman, Repro, Tuf-Fil, Tuf-Carv, and logo designs are all registered trademarks of Freeman. Other trademarks are the property of their respective owners.

Freeman Serves Customers with Twelve Strategic North American Locations

Terms and Conditions

CaliforniaI M C Distribution 15147 Don Julian Road City of Industry, CA 91746 TEL 800-325-2100 FAX 440-934-7200

GeorgiaShippers Warehouse of Georgia 7137 Southlake Parkway Morrow, GA 30260 TEL 800-445-0811 FAX 440-934-7200

KansasGarvey Warehouse 5755 S. Hoover Rd., Bldg. #5 Wichita, KS 67215 TEL 800-792-1047 TEL 817-551-7301 FAX 817-568-0908

Michigan27655 Groesbeck Hwy. Roseville, MI 48066 TEL 800-345-9259 TEL 586-774-1210 FAX 586-774-1019

Pennsylvania909 Strickler Road Mt. Joy, PA 17552 TEL 800-631-4230 TEL 717-653-5300 FAX 717-653-7372

Quebec13475 boul Pitfield Montreal, QC H4S 1H3 TEL 800-263-7699 TEL 514-335-3530 FAX 514-335-3225

Ohio (Headquarters) 1101 Moore Rd. • Avon, OH 44011

TEL 800-321-8511 • TEL 440-934-1902 FAX 440-934-7200

MinnesotaProfessional Warehouse 2117 Charles Ave. Saint Paul, MN 55114 TEL 800-558-0866 FAX 262-789-5407

OntarioVoyageur Distribution 3600B Laird Road, Unit 4 Mississauga, ON L5L 5Y7 TEL 800-345-9259 FAX 586-774-1019

OregonBushnell’s Warehouse 2720 N.W. 35th Ave.Portland, OR 97210TEL 800-558-0866FAX 262-789-5407

Wisconsin16910 W. Cleveland Ave. New Berlin, WI 53151 TEL 800-558-0866 TEL 262-789-9800 FAX 262-789-5407

Texas3152 S.E. Loop 820 Fort Worth, TX 76140 TEL 800-792-1047 TEL 817-551-7301 FAX 817-568-0908

®

FREEMAN MANUFACTURING & SUPPLY CO.1101 Moore Road, Avon, Ohio 44011 Phone 800-321-8511 • Fax 440-934-7200 www.freemansupply.com • [email protected]

Table of Contents

Table of ContentsMachinable MediaFreeman Machinable Wax ........................................................................2RenShape Modeling and Styling Boards ............................................. 3-5RenShape Tooling and High-Temperature Work Boards .................... 6-7Perfect Plank Specialty Lumber ........................................................... 8-9Rough Sawn Pattern Lumber ........................................................... 10-11Ren Seamless Modeling Pastes and Clay .............................................12Richlite Fibre-Laminate Sheets ..............................................................13MDF - Medium Density Fiberboard ........................................................13

Liquid Tooling MaterialsRepro Fast-Cast Polyurethanes ....................................................... 14-16Pro-Cast Fast-Cast Polyurethanes .........................................................17Ren Fast-Cast Urethane Systems ..........................................................17Polyurethane Elastomers – Intermediate Cure ................................ 18-19Polyurethane Elastomers – Overnight Cure – Flexible .................... 20-21Polyurethane Elastomers – Overnight Cure – Semi-Rigid .............. 22-23Polyurethane Elastomers – Overnight Cure – Rigid ..............................24Polyurethane Elastomers – Rapid Cure .................................................25Mold Making Silicone Rubbers & Accessories................................. 26-29Epoxy Casting Resins ....................................................................... 30-32Epoxy Laminating Resins ................................................................. 33-35Epoxy Surface Coats ........................................................................ 36-38Polyester Resins & Gelcoats ..................................................................39Resin Infusion Epoxy Systems ...............................................................39Specialty Tooling Pastes & Resin Systems ..................................... 40-41Plasters, Gypsum Cements & Accessories ..................................... 42-43

Fabrics, Fillers, & BaggingFiberglass Fabrics ............................................................................. 44-45Other Fiberglass Reinforcements ...........................................................46Kevlar Fabrics .........................................................................................46Carbon Fiber Reinforcements ................................................................47Tooling Plastics Fillers ...................................................................... 48-49Dyes and Pigments .................................................................................49Mia Vacuum Bagging Supplies ........................................................ 50-51Core Materials .........................................................................................51

Specialty WaxesMachinable Wax .....................................................................................52Freeman Sheet Wax ...............................................................................53Freeman Fillet Wax & Accessories ........................................................54Freeman String Wax ...............................................................................54Freeman Half Round Wax ......................................................................54Freeman Blind Gauging Wax .................................................................55Freeman Core Vent Wax ........................................................................55Optical Soluble Wax ...............................................................................55Sol-U-Carv ..............................................................................................55Miscellaneous Waxes .............................................................................55

Adhesives & Repair MaterialsFreeman TUF Repair and Build-Up Materials.................................. 56-57Polyurethane-Based Repair Materials ....................................................58Epoxy-Based Repair Materials ...............................................................58Polyester-Based Repair Materials ..........................................................59Epoxy Adhesives .............................................................................. 60-62Methacrylate Adhesives ..........................................................................63Polyurethane Adhesives .........................................................................64Cyanoacrylate Adhesives .......................................................................64Adhesive Dispensing Guns and Static Mix Nozzles ..............................65Hot Melt Foundry Adhesives ..................................................................66Wood Glue & Glue Applicator Bottles ....................................................66Ren Tooling Board Adhesives ................................................................67Other Specialty Adhesives......................................................................67

Foundry Tools & SuppliesFreeman-Palmer Pattern Plates ....................................................... 68-69Mold Alignment Hardware ......................................................................70Alignment Dowels ............................................................................. 71-73Core Box Air Release Vents & Accessories .................................... 74-77Core Box Seals & Gaskets .....................................................................77Core Vent Wax........................................................................................78Dike-O-Lastic Ejector Buttons ................................................................78Leather Fillets & Accessories .................................................................78Core Box Clamps ....................................................................................79Slicks & Trowels ......................................................................................79Foundry Specialty Tools .........................................................................80Other Foundry Supplies ..........................................................................81

Plywood & Sheet MaterialsFreeman Pattern Plywoods ....................................................................82Premium Plywoods .................................................................................83Standard Plywoods .................................................................................84Other Sheet Materials .............................................................................85

Hardware & EquipmentFreeman Pattern Letters & Logos .................................................... 86-88Tapes & Embossers ...............................................................................89Abrasives........................................................................................... 90-95Fasteners .......................................................................................... 96-97Band Saw Accessories ...........................................................................97Degassing and Mixing Equipment .................................................... 98-99Dispensing Equipment ............................................................................99Scales & Balances ..................................................................................99Assorted Cutters & Bits................................................................. 100-101Shears for Carbon, Kevlar, & Glass .................................................... 101

AccessoriesPattern Coatings (Primers, Paints, & Sealers) ............................. 102-103Mold Releases – Sacrificial .......................................................... 104-105Semi-Permanent Mold Release Systems .................................... 106-107Gloves and Protective Wear ................................................................ 108Mixing Cups & Paddles ....................................................................... 109Clean-Up Supplies ............................................................................... 109Brushes ................................................................................................ 110Wedges ................................................................................................ 110Rollers .................................................................................................. 111Clay Modeling Products ....................................................................... 112Freeman Industrial Solvents ................................................................ 113Miscellaneous Accessories .................................................................. 113

AppendixIndex

Products by Trade Name or Manufacturer ..................................... 114 Alphabetical Product Listings .......................................................... 115

Glossary ............................................................................................... 118Preparation of Patterns/Mold ............................................................... 119Reference & Conversion Tables ......................................................... 120

1 www.freemansupply.com

Machinable Media

2 1.800.321.8511

Machinable Media

Original SizesCatalog Number Description Thickness Width Length108003 Wax Block 1½" 2" 3"108011 Wax Block 1½" 3" 7"108021 Wax Block 3" 3" 7"108031 Wax Block 3" 4½" 7"108051 Wax Block 3" 5" 10"

Standard Block Sizes

Width x Length

Thickness2" 3" 4" 5" 6" 7" 8"

6" x 6" 108250 108300 108350 108400 108450 108500 1085526" x 12" 108252 108071 108352 108402 108452 108502 1085546" x 18" 108254 108304 108354 108404 108454 108504 1085566" x 24" 108256 108306 108356 108406 108456 108506 1085586" x 30" 108258 108308 108358 108408 108458 108508 1085606" x 36" 108260 108310 108360 108410 108460 108510 1085626" x 42" 108262 108312 108362 108412 108462 108512 1085646" x 48" 108264 108314 108364 108414 108464 108514 10856612" x 12" 108266 108316 108366 108416 108466 108516 10856812" x 18" 108268 108318 108368 108418 108468 108518 10857012" x 24" 108270 108320 108370 108420 108470 108520 10857212" x 30" 108272 108322 108372 108422 108472 108522 10857412" x 36" 108274 108324 108374 108424 108474 108524 10857612" x 42" 108276 108326 108376 108426 108476 108526 10857812" x 48" 108278 108328 108378 108428 108478 108528 10858018" x 18" 108280 108330 108380 108430 108480 108530 10858218" x 24" 108282 108332 108382 108432 108482 108532 10858418" x 30" 108284 108334 108384 108434 108484 108534 10858618" x 36" 108286 108336 108386 108436 108486 108536 10858818" x 42" 108288 108338 108388 108438 108488 108538 10859018" x 48" 108290 108340 108390 108440 108490 108540 10859224" x 24" 108222 108342 108392 108442 108492 108542 10859424" x 30" 108292 108344 108394 108444 108494 108544 10859624" x 36" 108294 108346 108396 108446 108496 108546 10859824" x 42" 108296 108348 108398 108448 108498 108548 10860024" x 48" 108298 108243 108244 108245 108246 108550 108248

Standard Cylinder SizesCatalog Number Description

Diameter(Nominal) Length

108114 Wax Cylinder 1" 12"108115 Wax Cylinder 1½" 12"108125 Wax Cylinder 2" 12"108135 Wax Cylinder 3" 12"108145 Wax Cylinder 4" 14"108155 Wax Cylinder 5" 16"108165 Wax Cylinder 6" 18"108175 Wax Cylinder 7" 18"

Non-Standard Sizes and Bulk Machinable WaxIn addition to the above blocks and cylinders, machinable wax is also available in custom sized blocks and cylinders.Catalog Number Description108099 Non-Standard Size Block108199 Non-Standard Size Cylinder108001 Bulk Wax 1-5 lb. pieces

Freeman Machinable Wax

Formulated & manufactured by Freeman, this unique medium is an extremely hard synthetic wax that machines faster than polyurethane and epoxy tooling boards or metals without sacrificing quality of finish, surface detail, or dimensional accuracy.

Machinable Wax is: Non-Abrasive – unlike metal and tooling boards that can cause significant wear on cutting tools. User-Friendly – machining produces chips instead of dust, for a cleaner work environment. Self-Lubricating – enables all machining operations to be performed without the need for coolants or cutting fluids. Able To Be Glued – to produce large or irregularly-shaped pieces for machining with the use of 3M #90 Hi-Strength Spray Adhesive (pg. 67).Available in a Wide Variety of Sizes – eliminating the waste associ-ated with using large tooling boards for smaller projectsSelf-Releasing & Self-Sealing – liquid tooling plastics, including epoxy, urethane, and silicone rubber may be poured into Machinable Wax without requiring the use of sealers or release agents.

Machinable Wax is used for: •ProducingAccurateMoldsandPrototypes•EducationasaTrainingAidMaterial•CNCSystemsSet-upandDemonstrations•ProofingCNCMachiningPrograms

Machinable Wax SpecificationsHardness (Shore D) 50-55Specific Gravity 0.92Flash Point 575° FSoftening Point 226° FVolumetric Shrinkage @ Room Temp. 7%Coefficient of Thermal Expansion (in./in. °F) 9.5 x 10-5

Color Blue

Machinable Wax Machining GuidelinesSpindle Speed Feed Rate

Roughing 3,000 rpm 100 inches per minuteFinishing 8,000-10,000 rpm 40-100 inches per

minute*Dataobtainedusinga½"ballendmill

How to Calculate Machinable Wax WeightLength x Width x Thickness (inches)

= Weight (lbs)28.8


Machinable M

edia

RenShape® Modeling & Tooling Boards

Huntsman Advanced Materials’ RenShape modeling and tooling board line is the broadest and most diverse offering in the industry. From the original modeling board, RenShape 450, this line has grown to meet the needs of nearly every demanding styling, modeling, and tooling application. All of these boards are manufactured in the United States to the highest quality standards in the industry, which is why RenShape remains the leading line of modeling and tooling boards and why Freeman is proud to be its number one distributor.

RenShape Applications Guide

RenShape No. 5015 5020 5025 5030 5045 440 5440 450 5460 460 470 472 473 474 550 5166 5169 5179 5008 2000NC Tape Proofing X X X X X X X X XVisual Models X X X X X X X X X XStyling Prototypes X X X X X X X X X XArchitectural Models X X X X X X X X X XTooling Aids & Fixtures X X X X X X X X XTemporary Models X X X X X X X X X XMaster Models X X X X X X X X X X X XAutomotive Dies X X X X X X X X X XIntermediate-Temperature Aerospace Masters & Lay-up Tools X X X

Prototype Foundry Patterns X X X X X X X X X X X X X X X X XFoundry Patterns & Core Boxes X XPrototype Vacuum-Form Molds X X X X X X X X X X X X X XMetalforming Tools X X XPrototype Injection Molds X

RenShape Specifications

Hardness Shore D

Density (g/cc)

Density (lbs/ft.3)

Tensile Strength

(psi)Compressive Strength (psi)

Compressive Modulus

(psi)Flexural

Strength (psi)

Flexural Modulus

(psi)

Glass Transition Temp (ºF)

Coefficient Thermal

Expansion (in/in/ºF) Color

Modeling & StylingRenShape 5015 – 0.10 6 160 130 – 190 – – 33.0 x 10-6 Blue-GreenRenShape 5020 27 0.16 10 350 260 – 350 – – 33.0 x 10-6 Lt. GrayRenShape 5025 27 0.25 15 600 560 – 780 – – 33.0 x 10-6 Lt. GreenRenShape 5030 33 0.30 20 895 1,130 – 1,330 – – 33.0 x 10-6 PeachRenShape 5045 42 0.48 30 1,250 2,200 – 2,400 – – 33.0 x 10-6 BrownRenShape 440 54 0.55 34 1,300 1,400 105,000 2,300 106,000 203 34.4 x 10-6 Red-BrownRenShape 5440 54 0.55 35 1,300 1,400 105,000 2,300 106,000 203 34.4 x 10-6 Lt. BrownRenShape 450 65 0.66 41 2,300 2,800 135,000 4,000 144,000 205 36.0 x 10-6 Lt. BrownRenShape 5460 58 0.70 43 1,886 2,075 127,000 3,200 152,000 187 34.4 x 10-6 Lt. BrownRenShape 460 64 0.77 48 1,800 2,200 181,000 3,700 185,000 219 29.9 x 10-6 Lt. Brown

Tooling & High-Temperature Work BoardsRenShape 470 90 1.67 104 4,700 9,500 866,000 8,700 983,000 232 22.7 x 10-6 Lt. GrayRenShape 472 81 0.88 55 7,000 10,900 460,000 9,540 416,000 248 25.8 x 10-6 Lt. GrayRenShape 473 72 0.80 50 2,500 3,500 210,000 4,000 200,000 212 30.0 x 10-6 Lt. GrayRenShape 474 73 0.80 50 6,750 8,000 227,000 8,000 325,000 230 26.5 x 10-6 Lt. GrayRenShape 550 82 0.85 53 7,000 10,500 415,000 8,800 414,000 289 27.5 x 10-6 CreamRenShape 5166 90 1.66 103 4,875 9,500 840,000 8,000 965,000 228 22.0 x 10-6 CreamRenShape 5169 85 1.20 75 9,000 8,800 366,000 14,000 380,000 206 40.8 x 10-6 RedRenShape 5179 85 1.17 73 10,000 12,700 325,000 15,600 409,000 239 35.4 x 10-6 RedRenShape 5008** 68 0.67 42 3,500 8,200 350,000 4,600 350,000 287 18.0 x 10-6 Lt. BlueRenShape 2000** 91 1.80 112 9,000 36,500 900,000 12,000 1,200,000 455 23.0 x 10-6 GrayASTM D-2240 D-792 D-792 D-638 D-695 D-695 D-790 D-790 D-4065 D-3386

**Epoxyboards

Machinable Media

4 1.800.321.8511

RenShape Modeling and Styling BoardsRenShape modeling & styling boards are designed and formulated to meet the wide scope of styling, modeling, prototyping and fabricating applicationsfoundthroughoutindustrytoday.Theseboardsmaybeworked by hand or machine, and are non-abrasive to cutting tools.

CAUTION: Foam boards should not be used with addition (platinum) curesiliconerubbers.Cureinhibitionwilloccur,evenaftersealingtheRenShape.Condensation(tin)curesiliconesarecompatible.

RenShape 5015 Polyurethane Foam Board •6PoundDensity•Blue-GreenColor

RenShape 5015 is our lightest weight and most economical foam styling board. It is excellent for appearance models or as a substruc-turetoapplyRenPasteSeamlessModelingPaste.Catalog Number Description Thickness Width Length Bd. Ft.075836 RenShape 5015 2" 48" 96" 64075844 RenShape 5015 4" 48" 96" 128075846 RenShape 5015 6" 48" 96" 192

RenShape 5020 Polyurethane Foam Board •10PoundDensity•LightGrayColor

RenShape 5020 provides a better surface finish than RenShape 5015 andisusedinmostofthesameapplications.LikeallRenShapefoamboards,itisoftensealedwithFreemanWood&PlasterSealer,FreemanNo.60patterncoating,ortheDurateclineofsealers.Catalog Number Description Thickness Width Length Bd. Ft.075175 RenShape 5020 2" 24" 96" 32075176 RenShape 5020 4" 24" 96" 64075177 RenShape 5020 6" 24" 96" 96075178 RenShape 5020 8" 24" 96" 128075182 RenShape 5020 4" 48" 96" 128075183 RenShape 5020 6" 48" 96" 192075180 RenShape 5020 8" 48" 96" 256

RenShape 5025 Polyurethane Foam Board•15PoundDensity•LightGreenColor

RenShape 5025 provides a better surface finish than RenShape 5020 and is used in many large and lightweight styling applications. Freemanalsooffersasmaller24"x16"sizeforsmallerprojects.Catalog Number Description Thickness Width Length Bd. Ft.075119 RenShape 5025 4" 24" 16" 10.67075123 RenShape 5025 2" 24" 96" 32075124 RenShape 5025 4" 24" 96" 64075122 RenShape 5025 6" 24" 96" 96075125 RenShape 5025 8" 24" 96" 128075135 RenShape 5025 2" 48" 96" 64075126 RenShape 5025 4" 48" 96" 128075121 RenShape 5025 6" 48" 96" 192

RenShape 5030 Polyurethane Foam Board•20PoundDensity•PeachColor

RenShape 5030 provides a better surface finish than RenShape 5025 and is used in most of the same applications.Catalog Number Description Thickness Width Length Bd. Ft.075264 RenShape 5030 2" 24" 96" 32075265 RenShape 5030 4" 24" 96" 64075266 RenShape 5030 6" 24" 96" 96075267 RenShape 5030 8" 24" 96" 128075256 RenShape 5030 2" 48" 96" 64075261 RenShape 5030 4" 48" 96" 128

RenShape 5045 Polyurethane Foam Board•30PoundDensity•BrownColor

RenShape 5045 provides the best surface finish and edge definition of all of the RenShape foam boards.Catalog Number Description Thickness Width Length Bd. Ft.075529 RenShape 5045 3⁄4" 24" 96" 12075530 RenShape 5045 1" 24" 96" 16075521 RenShape 5045 2" 24" 96" 32075528 RenShape 5045 3" 24" 96" 48075522 RenShape 5045 4" 24" 96" 64075524 RenShape 5045 5" 24" 96" 80075523 RenShape 5045 6" 24" 96" 96075525 RenShape 5045 2" 48" 96" 64

RenShape 440 Polyurethane Styling Board •34PoundDensity•LightReddish-brownColor• IdealforManyModelandPatternApplications

RenShape 440 is a medium-low density board. Used for master mod-els,CNCstylingmodels,prototypes,andvisualmodels.RenShape440 machines easily at fast cutting speeds, finishes to a good surface with excellent edge definition and produces very little tool wear.Catalog Number Description Thickness Width Length Bd. Ft.075236 RenShape 440 2" 16" 60" 13.33075240 RenShape 440 4" 16" 60" 26.67075146 RenShape 440 1" 20" 60" 8.33075147 RenShape 440 2" 20" 60" 16.67075148 RenShape 440 3" 20" 60" 25075149 RenShape 440 4" 20" 60" 33.33075151 RenShape 440 6" 20" 60" 50

RenShape 5440 Polyurethane Styling Board•35PoundDensity•LightBrownColor

RenShape 5440 is higher density version of 440, offering an improved surface finish without sacrificing ease of machining.

Theseboardsaremanufacturedinmetricsizes(500mmx1500mm).TheEnglishequivalentsizesareprovidedbelow.Catalog Number Description Thickness Width Length Bd. Ft.075501 RenShape 5440 0.98" 19.7" 59.1" 7.92075502 RenShape 5440 1.97" 19.7" 59.1" 15.85075503 RenShape 5440 2.96" 19.7" 59.1" 23.77075504 RenShape 5440 3.94" 19.7" 59.1" 31.69

RenShape® Modeling & Tooling Boards [CONTD.]


Machinable M

edia

RenShape 450 Polyurethane Modeling Board •41PoundDensity•LightBrownColor•SuperiorMachinabilityandStability

RenShape 450 is the original medium density polyurethane modeling and styling board. An ideal material for models and prototypes, mas-terpatterns,andtoolingaids.Thismaterialwillproduceverystable,dimensionally accurate tools with well-defined edges and surface detail. RenShape 450 can be machined using standard woodworking tools and will not result in objectionable dust particles when planed, milled, sawed or drilled. It resists warping and can be easily painted and finished for appearance and prototype models.Catalog Number Description Thickness Width Length Bd. Ft.075139 RenShape 450 2" 15" 20" 4.17075202 RenShape 450 2" 16" 60" 13.33075205 RenShape 450 4" 16" 60" 26.67075140 RenShape 450 1" 20" 60" 8.33075141 RenShape 450 2" 20" 60" 16.67075142 RenShape 450 3" 20" 60" 25075143 RenShape 450 4" 20" 60" 33.33075203 RenShape 450 1" 24" 60" 10075206 RenShape 450 2" 24" 60" 20075211 RenShape 450 3" 24" 60" 30

RenShape 5460 Polyurethane Modeling Board•43PoundDensity•LightBrownColor•HighQualitySurfaceFinish

RenShape 5460 is lower density version of 460, offering excellent surface finish and ease of machining while minimizing the dust prevalent in many other modeling boards in this range.Catalog Number Description Thickness Width Length Bd. Ft.075518 Ren Shape 5460 2" 24" 60" 20075519 Ren Shape 5460 3" 24" 60" 30075520 Ren Shape 5460 4" 24" 60" 40

RenShape 460 Polyurethane Modeling Board •48PoundDensity•LightBrownColor•ExcellentSurfaceFinish

RenShape 460 is a medium-high density polyurethane modeling and styling board. It was developed to meet the growing demand for higher-quality, more dimensionally accurate, machined master patterns and prototypes. With a smoother surface finish than RenShape 450, this board is an ideal material for prototype vacuum-forming tools, styling prototypes, master models, tooling aids, and automotive die models.Carbidecuttersarerecommended,butnotnecessary.Catalog Number Description Thickness Width Length Bd. Ft.075213 RenShape 460 2" 16" 60" 13.33075214 RenShape 460 4" 16" 60" 26.67075229 RenShape 460 1" 20" 60" 8.33075219 RenShape 460 2" 20" 60" 16.67075221 RenShape 460 3" 20" 60" 25075222 RenShape 460 4" 20" 60" 33.33075169 RenShape 460 1" 24" 60" 10075170 RenShape 460 2" 24" 60" 20075171 RenShape 460 3" 24" 60" 30075172 RenShape 460 4" 24" 60" 40

RenShape Tooling and High-Temperature Work BoardsRenShapeToolingandHigh-TemperatureWorkBoardsaredesigned and formulated to meet the wide scope of challenging applications including foundry, metal-forming, vacuum-forming and temperature resistanttooling.Theyallshareanumberofperformancecharacteris-tics including ease of machining, excellent dimensional stability, and good edge definition.

RenShape 470 High-Density Polyurethane Fixture Board•104PoundDensity•LightGrayColor•ExtremelyToughandDense

RenShape 470 is a high-density polyurethane board designed for machining of production fixtures capable of withstanding extended use and handling. It is very dimensionally stable and features excellent wear resistance.Catalog Number Description Thickness Width Length Bd. Ft.075209 RenShape 470 2" 20" 60" 16.67

RenShape 472 Medium-Density Polyurethane Fixture Board•55PoundDensity•LightGrayColor•ExcellentforFoundryPatternsandThermoformTools

RenShape 472 is a polyurethane board designed for machining of production fixtures capable of withstanding extended use and han-dling.Combineslightweightwithtoughnessandabrasionresistanceto withstand demanding production environments.Catalog Number Description Thickness Width Length Bd. Ft.075242 RenShape 472 1" 20" 60" 8.33075243 RenShape 472 2" 20" 60" 16.67075245 RenShape 472 3" 20" 60" 25075244 RenShape 472 4" 20" 60" 33.33075238 RenShape 472 5" 24" 30" 25075239 RenShape 472 6" 24" 30" 30

RenShape 473 Lighter Density Polyurethane Fixture Board•50PoundDensity•LightGrayColor•OurMostEconomicalFixtureBoard

RenShape 473 is a polyurethane fixture board that offers a lighter density than traditional fixture boards. May be used for check fixtures, model bases, patterns, and thermoform tools where requirements are less demanding.Catalog Number Description Thickness Width Length Bd. Ft.075153 RenShape 473 2" 16" 60" 13.33075154 RenShape 473 3" 16" 60" 20075155 RenShape 473 4" 16" 60" 26.67075156 RenShape 473 6" 16" 60" 40


Machinable Media

6 1.800.321.8511

RenShape Tooling and High-Temperature Work Boards

RenShape 474 Polyurethane Fixture Board•50PoundDensity•LightGrayColor•ExcellentCombinationofDurabilityandSurfaceFinishwithLessWeight

Thisgraycoloredpolyurethaneboardismanufacturedtomachinewell and produce good detail with less dust than other fixture board materials. Ideal for creating economical check fixtures, trim fixtures, and drill fixtures.

Catalog Number Description Thickness Width Length Bd. Ft.075614 RenShape 474 2" 24" 60" 20075622 RenShape 474 3" 24" 60" 30075630 RenShape 474 4" 24" 60" 40

RenShape 550 Intermediate Temperature Polyurethane Board

•53PoundDensity•CreamColor•HighTemperatureResistanceandCompressiveStrength

RenShape 550 is a polyurethane board that is designed for forming dimensionally accurate aerospace models and curing tools requiring elevated temperature resistances up to 200°F. Catalog Number Description Thickness Width Length Bd. Ft.075207 RenShape 550 2" 15.9" 56.9" 12.56

RenShape 5008 Intermediate Temperature Epoxy Modeling Board

•42PoundDensity•LightBlueColor•SuperiorDimensionalStabilityandPrepregCompatibility

RenShape5008isanepoxymodelingboarddesignedfortoolinguseupto250°F(121°C)andiswell-suitedforbuildingmastermodels,layup tools for low and medium temperature curing prepregs, and otherheat-resistanttooling.Thismediumdensityepoxymaterial features a very low coefficient of thermal expansion to produce outstanding accuracy and dimensional stability. Catalog Number Description Thickness Width Length Bd. Ft.075289 RenShape 5008 2" 24" 60" 20075290 RenShape 5008 4" 24" 60" 40075291 RenShape 5008 6" 24" 60" 60

RenShape 5166 Metal-Forming Board•103PoundDensity•CreamColor•MetalFormingApplications

RenShape 5166 is a polyurethane board that is designed for use in forming metal parts for prototype and low volume production. Catalog Number Description Thickness Width Length Bd. Ft.075237 RenShape 5166 2" 20" 60" 16.67075199 RenShape 5166 4" 20" 30" 16.67


RenShape 5169 Foundry Pattern & Tooling Board •75PoundDensity•RedColor•HighestWearResistance

RenShape 5169 is a polyurethane board that is designed for machin-ing extremely durable and wear resistant foundry patterns, core boxes and other tools that require high wear and impact resistance. Its supe-rior edge definition, dimensional stability and polishing characteristics also make it an excellent material for the rmoforming tools designed to produce clear plastic parts.Catalog Number Description Thickness Width Length Bd. Ft.075246 RenShape 5169 1" 20" 60" 8.3075232 RenShape 5169 2" 20" 60" 16.67075233 RenShape 5169 3" 20" 60" 25075234 RenShape 5169 4" 20" 60" 33.33075127 RenShape 5169 5⁄8" 24" 30" 3.1075131 RenShape 5169 ¾" 24" 30" 3.75075128 RenShape 5169 1" 24" 60" 10075129 RenShape 5169 1¼" 24" 60" 12.5075130 RenShape 5169 1½" 24" 60" 15075164 RenShape 5169 2" 24" 60" 20075165 RenShape 5169 3" 24" 60" 30075166 RenShape 5169 4" 24" 60" 40075247 RenShape 5169 5" 24" 30" 25075248 RenShape 5169 6" 24" 30" 30

RenShape 5179 Foundry Pattern & Tooling Board•73PoundDensity•RedColor•MachinesWellwithMinimalChipping

Thisredcoloredpolyurethaneboardisspecificallydesignedforthemachining of highly accurate, dimensionally stable, and wear resistant foundry patterns.Catalog Number Description Thickness Width Length Bd. Ft.075546 RenShape 5179 1" 24" 60" 10075554 RenShape 5179 2" 24" 60" 20075562 RenShape 5179 3" 24" 60" 30075570 RenShape 5179 4" 24" 60" 40075577 RenShape 5179 5" 24" 30" 25075585 RenShape 5179 6" 24" 30" 30

RenShape 2000 High-Temperature Epoxy Injection Mold Board

•112PoundDensity•GrayColor•PrototypeInjectionMolds

RenShape 2000 is specifically designed for the fast machining of injection molds, resin transfer molds, vacuum form molds, and other tooling that requires very high temperature and chemical resistances. Molds created from RenShape 2000 may be polished to a metallic finish and are capable of producing hundreds of accurate thermoplastic parts.Catalog Number Description Thickness Width Length Bd. Ft.075269 RenShape 2000 2" 24" 30" 10 075271 RenShape 2000 4" 24" 30" 20


Machinable M

edia


RenShape Machining SpecificationsRoughing

Speed (RPM)

Roughing Feed (IPM)

Finishing Speed (RPM)

Finishing Feed (IPM)

RenShape Modeling & Styling BoardsRenShape 5015 2,500 200 15,000 200RenShape 5020 2,500 200 15,000 200RenShape 5025 2,500 200 15,000 200RenShape 5030 2,500 200 15,000 200RenShape 5045 2,500 100 15,000 200RenShape 440 2,000 200 15,000 200RenShape 5440 2,000 100 15,000 200RenShape 450 2,000 100 15,000 200RenShape 5460 2,000 100 15,000 200RenShape 460 1,600 40 10,000 100

RenShape Tooling & High-Temperature Work BoardsRenShape 470 1,600 40 10,000 100RenShape 472 1,600 40 10,000 100RenShape 473 1,600 40 10,000 100RenShape 474 1,600 40 10,000 100RenShape 550 1,600 40 10,000 100RenShape 5166 1,600 40 10,000 100RenShape 5169 1,600 40 10,000 100RenShape 5179 1,500 60 10,000 100RenShape 5008 1,600 40 10,000 100RenShape 2000 6-10,000 240+ 15,000 300+

Cutters Used: Roughing–1"BallEndmill,4-Flute,CarbideFinishing – 5⁄8"BallEndMill,2-Flute,Carbide

Depth:Roughing – varied from ¼"to2½" deep with a 40% stepoverFinishing – 1⁄8" deep leaving 0.002 scallop height

Thesemachiningparametersarerepresentedasstartingpoints.Cuttertypeandmaterial,spindlespeed,feedrate,machinepowerand rigidity all affect machining results. User must determine best parameters for specific applications.

RenShape Accessories

Adhesives for RenShapeProduct Matched AdhesiveRenShape 5015 Repro Ultra LightRenShape 5020 Repro Ultra Light, Ren Weld 103RenShape 5025 Repro Ultra Light, Ren Weld 103RenShape 5030 Repro Ultra Light, Ren Weld 103RenShape 5045 Repro Ultra Light, Ren Weld 103RenShape 440 Repro Light, Ren Weld 103, RenLam 1700-1RenShape 5440 Repro Light, Ren Weld 103, RenLam 1700-1RenShape 450 Repro Light, Ren Weld 103, RenLam 1700-1RenShape 5460 Repro Light, Ren Weld 103, RenLam 1700-1RenShape 460 Repro Light, Ren Weld 103, RenLam 1700-1RenShape 470 Freeman 690, RenLam 1700-1RenShape 472 Freeman 690, Ren Weld 103, RenLam 1700-1RenShape 473 Freeman 690, Ren Weld 103, RenLam 1700-1RenShape 474 Freeman 690, Ren Weld 103, RenLam 1700-1RenShape 550 RenLam 4005/Ren 1500RenShape 5166 RenLam 1700-1RenShape 5169 Ren Weld 5169, Maxim FastRenShape 5179 Ren Weld 5169, Maxim FastRenShape 5008 Ren Weld 5008RenShape 2000 RenLam 4026/Ren 1501

Repair Pastes for RenShapeProduct Matched Repair PasteRenShape 5015 Freeman Quik-FilRenShape 5020 Freeman Quik-FilRenShape 5025 Freeman Quik-FilRenShape 5030 Freeman Quik-FilRenShape 5045 Freeman Quik-FilRenShape 440 Freeman Quik-FilRenShape 5440 Freeman Quik-FilRenShape 450 Freeman Quik-FilRenShape 5460 Freeman Quik-FilRenShape 460 Freeman Quik-FilRenShape 470 Freeman Tuf-Fil AluminumRenShape 472 Freeman Tuf-Fil AluminumRenShape 473 Freeman Tuf-Fil AluminumRenShape 474 Freeman Tuf-Fil AluminumRenShape 550 Freeman Hi-Temp Tuf-FilRenShape 5166 Freeman Tuf-Fil PineRenShape 5169 Ren Patch 5169, Maxim FastRenShape 5179 Ren Patch 5169, Maxim FastRenShape 5008 Freeman Hi-Temp Tuf-Fil RenShape 2000 RenLam 4026/Ren 1501

Machinable Media

8 1.800.321.8511

Forover50years,skilledcraftsmenhavemadePerfectPlanktheiroverwhelming choice when it comes to high quality pattern lumber. PerfectPlankismanufacturedtoprovideadry,thick,stress-free pattern plank that is uniform in texture, low in moisture and virtually defect-free.

PerfectPlankisdesignedtofreetheuserfromthetime-consum-ing tasks of planing, jointing, sizing, and gluing to assemble larger blocksforpatternconstruction.PerfectPlankmaximizestheskills,and best utilizes the production time of the pattern maker, mold maker, and model maker because each board is ready for use right off the shelf in a wide variety of sizes.

Virtually Defect-FreeAllPerfectPlankismadefromcarefully inspected pieces of lumber with very few of the defects that cost the user time andmoney.Thislumberispre-cisely dried and stress-relieved, then finger-jointed into narrow, vertical-grained strips.

Accurate ConstructionThestripsarethenaccuratelymachined prior to being glued face-to-face to form the stan-dardwidthplank.TheaccuracyofPerfectPlankisespeciallyevident in the glue lines of eachpiece.Thinlinesofwater-resistant glue are cured with state-of-the-art electronic glu-ingequipmenttomakePerfectPlankeasytocarveandmachinewithoutcausingunnecessarywearof woodworking tools and cutter blades.

Superior StabilityTheverticalgrainconstructionofPerfectPlankproducesapattern lumber that has much greater dimensional stability than ordinary, straight grain pattern lumber. Vertical grain PerfectPlankwillresisttwistingand cupping and will produce patterns, molds, and models that are far superior to those made from ordinary rough sawn lumber.

Properly StoredAllPerfectPlankisstoredinclimate controlled warehouses, which ensures consistent mois-ture content regardless of the location or time of year you require your next delivery.

Perfect Plank is:

Virtually Defect-Free

The pine species is equivalent to select grades of pattern lumber while the mahogany species is equivalent to FAS grades.

Grain Tight, straight, vertical grain as opposed to the wide, diagonal and/or straight grain commonly found in other products.

Moisture Content

Kiln-dried to a low and uniform moisture content throughout. (controlled to 8% - 10%)

Surfacing Each board is surfaced four sides

End Gluing Individual wood strips joined by precision finger-jointing with non-abrasive adhesives.

Edge Gluing Strips are edge-glued with uniformly thin glue lines of water-resistant glue.

Immediately Usable

Simply select the thickness needed, cut off the required length, and begin to build your pattern. With Perfect Plank, every cubic inch is usable.

Ordering Information:Thismaterialisorderedbythefullboard.Boardfeetperboardislisted as a reference. When ordering please indicate how many boards are needed.

Custom Ordering:Customordersareavailableinthicknessesfrom1"to6",widths 12"to48",andlengthsupto16".

MaplePerfectPlankisalsoavailablebyspecialorder.Leadtimesarebased on availability.

Pleasecontactcustomerserviceforpricinganddeliveryonall custom orders.

Perfect Plank® Specialty Lumber


Machinable M

edia

Perfect Plank® Specialty Lumber [CONTD.]

Perfect Plank PineThispopularlaminatedplankisuniformlydried,virtuallyfreefromdefects, and planed on all four sides for immediate use. An excellent alternativetotheselectSugarPinegradeswhicharebecomingincreasingly difficult to source.CatalogNumber Description Thickness Width Length

Board Feet/Piece

074005 4/4 Perfect Plank Pine 1" 18" 96" 12074007 5/4 Perfect Plank Pine 1¼" 18" 96" 15074010 6/4 Perfect Plank Pine 1½" 18" 96" 18074012 7/4 Perfect Plank Pine 1¾" 18" 96" 21074014 8/4 Perfect Plank Pine 2" 18" 96" 24074015 9/4 Perfect Plank Pine 2¼" 18" 96" 27074020 10/4 Perfect Plank Pine 2½" 18" 96" 30074025 12/4 Perfect Plank Pine 3" 18" 96" 36074028 13/4 Perfect Plank Pine 3¼" 18" 96" 39074030 14/4 Perfect Plank Pine 3½" 18" 96" 42074035 16/4 Perfect Plank Pine 4" 18" 96" 48074040 17/4 Perfect Plank Pine 4¼" 18" 96" 51074048 20/4 Perfect Plank Pine 5" 18" 96" 60074050 21/4 Perfect Plank Pine 5¼" 18" 96" 63074052 22/4 Perfect Plank Pine 5½" 18" 96" 66074055 24/4 Perfect Plank Pine 6" 18" 96" 72*Actual thicknesses are approximately 1⁄8"lessandactualwidthsare17"+/-¼".

Perfect Plank JelutongDuetoitsextremelyfinetextureandconsistentgrainstructure, thisspeciesofPerfectPlankisthebestforhandcarvingorCNCmachining.ConstructedfromJelutong,thislaminatedwoodproduct is uniformly dried, virtually free from defects, and planed on all four sides for immediate use.CatalogNumber Description

Nom.*Thickness

Nom.*Width Length

Board Feet/Piece

074310 6/4 Perfect Plank Jelutong 1½" 18" 96" 18074314 8/4 Perfect Plank Jelutong 2" 18" 96" 24074315 9/4 Perfect Plank Jelutong 2¼" 18" 96" 27074320 10/4 Perfect Plank Jelutong 2½" 18" 96" 30074325 12/4 Perfect Plank Jelutong 3" 18" 96" 36074326 13/4 Perfect Plank Jelutong 3¼" 18" 96" 39074335 16/4 Perfect Plank Jelutong 4" 18" 96" 48074340 17/4 Perfect Plank Jelutong 4¼" 18" 96" 51074349 20/4 Perfect Plank Jelutong 5" 18" 96" 60074350 21/4 Perfect Plank Jelutong 5¼" 18" 96" 63074354 23/4 Perfect Plank Jelutong 5¾" 18" 96" 69074355 24/4 Perfect Plank Jelutong 6" 18" 96" 72 *Actual thicknesses are approximately 1⁄8"lessandactualwidthsare17"+/-¼".

SEE ALSO: Product Page No.TUF-Fil® (for repairing Mahogany, Alder & Poplar) 56TUF-Carv® (for repairing Pine and Jelutong) 57Freeman White & Gold Wood Glues 66Wood Screws 96Abrasives 90Pattern Coatings (Primers, Paints & Sealers) 102-103

Perfect Plank MahoganyConstructedfromgenuineMahogany,thislaminatedwoodproductisthe best choice for high-tolerance patterns, models, and fixtures. It is uniformly dried, virtually free from defects, and planed on all four sides for immediate use.CatalogNumber Description Thickness

Width

Length

Board Feet/Piece

074600 4/4 Perfect Plank Mahogany 1" 18" 96" 12074602 5/4 Perfect Plank Mahogany 1¼" 18" 96" 15074604 6/4 Perfect Plank Mahogany 1½" 18" 96" 18074608 8/4 Perfect Plank Mahogany 2" 18" 96" 24074610 9/4 Perfect Plank Mahogany 2¼" 18" 96" 27074616 10/4 Perfect Plank Mahogany 2½" 18" 96" 30074618 12/4 Perfect Plank Mahogany 3" 18" 96" 36074620 13/4 Perfect Plank Mahogany 3¼" 18" 96" 39074622 14/4 Perfect Plank Mahogany 3½" 18" 96" 42074626 16/4 Perfect Plank Mahogany 4" 18" 96" 48074628 17/4 Perfect Plank Mahogany 4¼" 18" 96" 51074634 20/4 Perfect Plank Mahogany 5" 18" 96" 60074636 21/4 Perfect Plank Mahogany 5¼" 18" 96" 63074638 22/4 Perfect Plank Mahogany 5½" 18" 96" 66074640 23/4 Perfect Plank Mahogany 5¾" 18" 96" 69074642 24/4 Perfect Plank Mahogany 6" 18" 96" 72

Perfect Plank AlderRed Alder is a domestically grown species found primarily on the Pacificcoast.SlightlylighterinweightandcolorthanMahogany,thishardwood offers an excellent alternative to higher priced Mahogany. PerfectPlankconstructedfromAlderisuniformlydriedforstability, virtually free from defects, and planed on four sides for immediate use.CatalogNumber Description Thickness

Width

Length

Board Feet/Piece

074710 9/4 Perfect Plank Alder 2¼" 18" 96" 27074718 13/4 Perfect Plank Alder 3¼" 18" 96" 39074724 17/4 Perfect Plank Alder 4¼" 18" 96" 51074738 24/4 Perfect Plank Alder 6" 18" 96" 72Othersizesmaybeavailablebyspecialorder.Pleasecallfordetails.

Perfect Plank PoplarConstructedfromdomesticallygrownpoplar,thishardwoodplankoffersalowercostalternativetoMahoganyPerfectPlank.AswithallPerfectPlankproducts,itisuniformlydriedforstability,virtuallyfreefrom defects, and planed on four sides for immediate use.CatalogNumber Description Thickness

Width

Length

Board Feet/Piece

074810 9/4 Perfect Plank Poplar 2¼" 18" 96" 27074818 13/4 Perfect Plank Poplar 3¼" 18" 96" 39074824 17/4 Perfect Plank Poplar 4¼" 18" 96" 51074832 21/4 Perfect Plank Poplar 5¼" 18" 96" 63Othersizesmaybeavailablebyspecialorder.Pleasecallfordetails.

Machinable Media

10 1.800.321.8511

Rough Sawn Pattern Lumber – Soft Woods

Freeman offers a complete selection of soft woods graded specifically for pattern and model construction. All of our lumber adheres to accepted grading rules. We take great pride in the quality of our lumber and all of our lumber products are stored inside climate controlled warehouses to maintain specified moisture content and overall quality.

Many of our various grades of lumber are available surfaced two sides (S2S) for a small additional charge.

Ordering Information:Pleasemakeusawareifyouhavespecificrequirementsforboardswith random lengths. All dimensions are nominal.

How to Calculate Board Feet

LengthxWidthxThickness(inches)

144 = BoardFeet

Pattern Sugar PineAllSugarPinepatternlumberstockedbyFreemaniskiln-driedandselected to meet the exacting specifications and requirements of pat-ternandmodelmakers.Bymaintaininganaveragemoisturecontentof 10% to 12%, selecting from specific domestic mills, and storing in climate controlled warehouses, we ensure that our customers receive boards that are stable and consistent in quality.

No. 2 CommonAverypopularstandardgradeforthepatternmaker.Theentireboardcan be used in a wide range of applications where tight, sound knots donotaffectperformanceandcostisamajorfactor.Tightknotsaregenerallylimitedto3¾",butmostaresignificantlysmallerandwell-spaced. Spike knots are permitted, but we purchase our lumber with the objective of minimizing this defect.Catalog Number Description Thickness Width Length071225 4/4 No. 2 Common Pine 1" 12" 8'-16'071230 5/4 No. 2 Common Pine 1¼" 12" 8'-16'071235 6/4 No. 2 Common Pine 1½" 12" 8'-16'071240 8/4 No. 2 Common Pine 2" 12" 8'-16'071241 10/4 No. 2 Common Pine 2½" 12" 8'-16'071242 12/4 No. 2 Common Pine 3" 12" 8'-16'

No. 3 CommonThemosteconomicalchoiceforthepatternmaker.Thisgradeistypi-cally used for medium to large applications where cost of the lumber isofprimaryimportanceandsurfacereworkisallowed.Themostnotable surface imperfections are random knots on both surfaces. Tightknotsmaybeupto4½"indiameterwhilelooseknotsmay beupto2½"indiameter.Catalog Number Description Thickness Width Length071260S 4/4 No. 3 Common Pine (S4S) 1" 12" 8'-16'071270 6/4 No. 3 Common Pine 1½" 12" 8'-16'071275 8/4 No. 3 Common Pine 2" 12" 8'-16'S4S = Surfaced four sides

Eastern White PineItsstraightgrainandcomparativelyuniformtexturemakesEasternWhitePinesimilartoSugarPine,althoughitisnotaseasilycarvableasSugarPine.AllofourEasternWhitePineiskiln-driedandrankshighinstability.EasternWhitePineoffersaneconomicalalternativetoSugarPine.Itisavailablein#2Common,#3Commonandisstored inside climate controlled warehouses to maintain specified moisture content and overall quality.

No. 2 CommonCatalog Number Description Thickness Width Length071254 6/4 No. 2 Common Eastern White Pine 1½" 12" 6'-16'071251 8/4 No. 2 Common Eastern White Pine 2" 12" 6'-16'071246 10/4 No. 2 Common Eastern White Pine 2½" 12" 6'-16'071245 12/4 No. 2 Common Eastern White Pine 3" 12" 6'-16'

No. 3 CommonCatalog Number Description Thickness Width Length071247 6/4 No. 3 Common Eastern White Pine 1½" 12" 6'-16'071248 8/4 No. 3 Common Eastern White Pine 2" 12" 6'-16'

JelutongBecauseofitslowdensity,finetexture,andexceptionalworkability,Jelutongisidealforpatternshopapplicationsaswellasfinedetailworkandintricatecarving.Jelutongisawhitewoodwithapproxi-mately the same weight properties as sugar pine and accepts pattern coatingsverywell.Tominimizesplittingandchecking,allboardsarecarefully kiln-dried to under 12% moisture content and stored inside climate controlled warehouses to maintain specified moisture content and overall quality.Catalog Number Description Thickness Width Length073007 5/4 Jelutong 1¼" 12" 8'-18'073010 6/4 Jelutong 1½" 12" 8'-18'073015 8/4 Jelutong 2" 12" 8'-18'073016 8/4 Jelutong 2" 6+" 8'-18'


Machinable M

edia

Freeman offers a complete selection of hardwoods graded specifically for pattern and model construction. All of our lumber adheres to accepted grading rules. We take great pride in the quality of our lum-ber and all of our lumber products are stored inside climate controlled warehouses to maintain specified moisture content and overall quality.

Ordering Information:Pleasemakeusawareifyouhavespecificrequirementsforboardswithrandomwidthsand/orlengths.Alldimensionsarenominal.

How to Calculate Board Feet

LengthxWidthxThickness(inches)

144 = BoardFeet

MahoganyGenuineMahoganyisthemostpopularandbestknownofthe hardwoods used for pattern and model work. It is extremely stable, withstands abrasion, and wears well. It has straight and close grain andcarveseasily.AllMahoganyPatternLumberstockedbyFreemanis kiln-dried and stored inside our climate controlled warehouses to maintain specified moisture content and overall quality. Freeman has beenprovidingthetradewithstraight-grainedPatternMahoganyforover 50 years.

FAS Pattern MahoganyThehighestgradeofMahoganyavailable(virtuallydefect-free),this is selected for its straight grain and used for producing high quality, accurate patterns and models. We also offer FAS Mahogany in 6' to 7' lengths which provides a lower cost option for those jobs that do not require the longer length.Catalog Number Description Thickness Width Length072005 4/4 FAS Mahogany 1" 6"+ 8'-16'075010 5/4 FAS Mahogany 1¼" 6"+ 8'-16'072015 6/4 FAS Mahogany 1½" 6"+ 8'-16'072020 8/4 FAS Mahogany 2" 6"+ 8'-16'072025 10/4 FAS Mahogany 2½" 6"+ 8'-16'072030 12/4 FAS Mahogany 3" 6"+ 8'-16'072035 16/4 FAS Mahogany 4" 6"+ 8'-16'072120 4/4 FAS Mahogany 1" 6"+ 6'-7'072125 5/4 FAS Mahogany 1¼" 6"+ 6'-7'072130 6/4 FAS Mahogany 1½" 6"+ 6'-7'072135 8/4 FAS Mahogany 2" 6"+ 6'-7'

Freeman Pattern MahoganySimilartoourFASPatternMahogany,butatalowercost,thisgrade is selected for straight grain but allows for a small number of pin wormholesandotherminordefects.ThoughwidthsaresomewhatnarrowerthanourFASgrade,ourstockistypically6"andwider.Catalog Number Description Thickness Width Length072150 4/4 Freeman Pattern Mahogany 1" 6"+ 8'-16'072155 5/4 Freeman Pattern Mahogany 1¼" 6"+ 8'-16'072160 6/4 Freeman Pattern Mahogany 1½" 6"+ 8'-16'072165 8/4 Freeman Pattern Mahogany 2" 6"+ 8'-16'

PoplarPoplarisadomestically-grown,economicalhardwoodspeciesthatoffersgoodworkabilityandhardnesscharacteristics.Thispattern lumber is relatively clear and free of most defects. Stocked in “Face & Better”,thisspeciesoffersthepatternmakeraffordableperformancecomparedtoSugarPineandMahogany.Catalog Number Description Thickness Width Length075046 4/4 Poplar – Face & Better 1" 6"+ 8'-16'075047 5/4 Poplar – Face & Better 1¼" 6"+ 8'-16'075048 6/4 Poplar – Face & Better 1½" 6"+ 8'-16'075050 8/4 Poplar – Face & Better 2" 6"+ 8'-16'075051 10/4 Poplar – Face & Better 2½" 6"+ 8'-16'075052 12/4 Poplar – Face & Better 3" 6"+ 8'-16'075053 16/4 Poplar – Face & Better 4" 6"+ 8'-16'

Hard MapleA hard, strong, white-colored wood with excellent wear-resistant characteristics. Kiln dried for stability and consistent quality.Catalog Number Description Thickness Width Length075015 4/4 Hard Maple – FAS 1" 6"+ 8'-16'075025 6/4 Hard Maple – FAS 1½" 6"+ 8'-16'075030 8/4 Hard Maple – FAS 2" 6"+ 8'-16'

SEE ALSO: Product Page No.TUF-Fil® (for repairing Mahogany and Poplar) 56TUF-Carv® (for repairing Pine and Jelutong) 57Freeman White & Gold Wood Glues 66Wood Screws 96Abrasives 90Pattern Coatings (Primers, Paints & Sealers) 102-103

Rough Sawn Pattern Lumber – Hardwoods

Machinable Media

12 1.800.321.8511

Ren® Seamless Modeling Pastes and Clay

RenPaste® 4503-1 Seamless Modeling Paste•60-90MinutePotLife•60DShoreHardness•ExcellentMachinabilityandSurfaceFinish•AutomotiveDesignandStylingModels

RenPaste4503-1isalowdensity,twocomponentepoxypastethat may be machine dispensed in a uniform layer over an undersized, lightweight, and low cost substructure. After permitting the material tosolidifyforaminimumof1day,theRenPaste4503-1maybe easily machined to produce a model of excellent surface finish and good durability, with no evidence of any seam lines.Catalog Number Description Availability

Net Wt.(Lb.)

056176 RenPaste 4503-1 Resin Only 13 Gallon 66056177 Ren 4503-1 Hardener Only 13 Gallon 66075174 RenPaste 4503-1 Resin Only 55 Gallon 265075175 Ren 4503-1 Hardener Only 55 Gallon 265

RenPaste® 4618-1 Seamless Modeling Paste•15MinutePotLife•76DShoreHardness•LowShrinkage,MixesandDispensesEasily,Excellent MachinabilitywithLessDustGeneration

•LargeMarineandAerospaceModelsRenPaste4618-1isamediumdensityepoxyseamlessmodelingpaste that is specifically designed for building large, accurate models andplugsforthemarineandaerospaceindustries.Thepasteiseasyto dispense onto an undersized core in layers of 0.4 to 1.5 inches thickusingmeter/mixequipment.Aftercuringfor24to48hoursatroomtemperature,RenPaste4618-1epoxyseamlessmodelingpastecanbeCNCmachinedtoafinefinish.Catalog Number Description Availability

Net Wt.(Lb.)

056190 RenPaste 4618-1 Resin Only 55 Gallon 330056191 Ren 4618-1 Hardener Only 55 Gallon 330*Twodrumsofresinarerequiredforcorrectmixratiowithonedrumof hardener.Eachdrumsoldseparately.

Ren Seamless Modeling Paste Specifications ChartRenPaste

4503-1RenPaste

4618-1RenPaste

4618-1 / 4619Ren RP

4040 ASTMColor Brown Gray Gray Off WhiteMix Ratio – Resin to Hardener (by wt.) 100:100 100:50 100:50 N/AMix Ratio – Resin to Hardener (by vol.) 100:100 100:50 100:50 N/AGel Time (min) 15 15 120 N/A D-2471Density (g/cm3) 0.7-0.8 0.9 0.9 1.6 D-1963Hardness (Shore D) 60 76 84 88 D-2240Compressive Strength (psi) 1,668 9,280 11,145 20,500 D-695Flexural Strength (psi) 1,595 5,220 5,800 8,140 D-790Deflection Temp. (264 psi) (°F) 108 122 – – D-648Tg DMA Onset (°F) – – 207 – D-4065Tg DMA Peak (°F) – – 253 324 D-4065Coefficient of Thermal Expansion (in./in./°F) 56 x 10-6 30 x 10-6 24 x 10-6 10 x 10-6 D-3386

Huntsman Advanced Materials’ line of seamless modeling pastes and syntactic clay was created to meet the unique needs of those doing very large tooling, especially those in the aerospace, marine, andautomotiveindustries.RenPasteseamlessmodelingpastesaremachined dispensed, 2-part epoxy pastes that are applied to an undersized substructure (usually made of foam boards) enabling the toolmaker to achieve a high quality surface finish without the heavy weight, glue lines, and high costs associated with adhering multiple tooling boards together.

RenPaste® 4618-1/4619 Intermediate Temperature Seamless Modeling PasteRenPaste4618-1/Ren4619isamediumdensityepoxyseamlessmodeling paste that is suitable for 220°F curing of composite parts, providedapostcureiscompleted.Thisproductcuresandismachin-ablein24hours.Easytomachine,thiscompoundproducesvoidfreemodels without glue lines.Catalog Number Description Availability

Net Wt.(Lb.)

056190 RenPaste 4618-1 Resin Only 55 Gallon 330056201 Ren 4619 Hardener Only 55 Gallon 330*Twodrumsofresinarerequiredforcorrectmixratiowithonedrumof hardener.Eachdrumsoldseparately.

Ren RP 4040 Machinable Syntactic ClayRenRP4040isahightem-peratureresistant,lowCTE,machinable, one component epoxy designed for directly machining curing tools for pre-preg parts. Supplied in a patty form, these patties may be hand applied to a heat resis-tant substructure (such as Aluminum Honeycomb), heat cured, and finallymachinedtothedesiredtoolshape.Theresultingtoolcanbeused at 300°F continuously and intermittently up to 350°F under full autoclave conditions.Catalog Number Description Availability

Net Wt.(Lb.)

056152 Ren RP 4040 1.4" x 6" x 8.5" Patty

3.7


Machinable M

edia

MDF – Medium Density Fiberboard

MediumDensityFiberboard(MDF)isalowcostmachinablemediaforproducingmasterpatterns,models,andprototypes.Thisproductfeatures a uniform density for smooth machining and low tool wear. MDFwillacceptawiderangeofsealers,primers,andcoatingsto produce a hard, durable tool surface.

Physical PropertiesColor BeigeDensity 38 lbs./ft.3 +/-2 lbs.Internal Bond 90 lbs./in2

Moisture Content 5-8%Hardness (Shore D) 45-55

CatalogNumber Description Thickness Width Length

Board Feet/Piece

076225 Medium Density Fiberboard 2" 24" 96" 32076230 Medium Density Fiberboard 4" 24" 96" 64076226 Medium Density Fiberboard 2" 49" 97" 66075231 Medium Density Fiberboard 4" 49" 97" 132Other sizes available upon special request.

Richlite® Fibre-Laminate Sheets

RichliteFibre-LaminateSheetsofferexcellentmachinabilityanddimensionalstability.Theyareabrasion,moistureandchemicalresis-tant.Thisremarkablystrongmaterialresistswarpingandmaintainsa uniform flatness and thickness throughout.

Physical PropertiesSpecific Gravity 1.24Water Absorption (% @ 1"/25 hrs.) 1.45Impact Strength (ft. lbs./in.) 1.17Tensile Strength (lbs./sq. in.) 19,000Flexural Strength (lbs./sq. in.) 22,000Compressive Strength (lbs./sp. In.) 30,650Abrasion-Resistance (Taber CS-17–% loss/1,000 revolutions) 0.0107Hardness (Shore D) 86Coefficient of Thermal Expansion (in./in. °F) 1.1 x 10-6

Density (lbs./cu. ft.) 77.4UL Classified Class AColor Oak

User Tips:Sawing –Carbide-tippedsawbladesarerecommendedforboth circular and table saw cutting applications. Theproperfeedrate, combined with a sharp blade will result in coarse sawdust. All sawing should be performed dry.

Milling, Routing & Machining –Carbidecuttersarerecommended.Theproperfeedrate,combinedwithasharpcutterwillresultincoarse sawdust. All machining should be performed dry.

Drilling & Tapping –Theuseofhighspeedsteeldrillsandtapsarerecommended for short production runs and shallow holes. For longer production runs and deeper holes, use carbide-tipped drills and taps. WhentappingRichliteFibre-LaminateSheets use a slightly smaller pilotdrillthanspecifiedforthesizetaprequired.Thiswillassureopti-mum thread strength. Whenever possible, the piece to be machined should be backed up by another piece of scrap material to prevent chippingaroundtheholes.Liftthedrillfrequentlytoallowchipsto be removed and to prevent the build-up of excess heat. Holes drilled parallel to the lamination should be clamped or secured in a vise. All drilling and tapping should be performed dry.

Sanding & Buffing – Sanding can be performed by using a belt or disc sander, or by hand. Sand using the same procedures and techniquesasusedwithwood.Drysandingisrecommended.

Bonding Richlite Fibre-Laminate Sheet –Lightlysandthematingsurfacestobeglued.UseepoxyadhesivessuchasRenLam1700-1or Freeman 690.

Catalog Number Description Thickness Width Length076001 Richlite Fibre-Laminate Sheet ½" 16" 96"076036 Richlite Fibre-Laminate Sheet 5⁄8" 16" 96"076038 Richlite Fibre-Laminate Sheet ¾" 16" 96"076002 Richlite Fibre-Laminate Sheet 1" 16" 96"076041 Richlite Fibre-Laminate Sheet 1¼" 16" 96"076045 Richlite Fibre-Laminate Sheet 1½" 16" 96"076003 Richlite Fibre-Laminate Sheet 2" 16" 96"076004 Richlite Fibre-Laminate Sheet 3" 16" 96"076043 Richlite Fibre-Laminate Sheet ½" 24" 48"076035 Richlite Fibre-Laminate Sheet 5⁄8" 24" 48"076029 Richlite Fibre-Laminate Sheet ¾" 24" 48"076039 Richlite Fibre-Laminate Sheet 1" 24" 48"076040 Richlite Fibre-Laminate Sheet 1¼" 24" 48"076044 Richlite Fibre-Laminate Sheet 1½" 24" 48"076009 Richlite Fibre-Laminate Sheet 2" 24" 48"076047 Richlite Fibre-Laminate Sheet 3" 24" 48"076048 Richlite Fibre-Laminate Sheet ½" 24" 96"076049 Richlite Fibre-Laminate Sheet 5⁄8" 24" 96"076050 Richlite Fibre-Laminate Sheet ¾" 24" 96"076051 Richlite Fibre-Laminate Sheet 1" 24" 96"076052 Richlite Fibre-Laminate Sheet 1¼" 24" 96"076053 Richlite Fibre-Laminate Sheet 1½" 24" 96"076054 Richlite Fibre-Laminate Sheet 2" 24" 96"076042 Richlite Fibre-Laminate Sheet ½" 48" 48"076034 Richlite Fibre-Laminate Sheet 5⁄8" 48" 48"076037 Richlite Fibre-Laminate Sheet ¾" 48" 48"076025 Richlite Fibre-Laminate Sheet 1" 48" 48"076026 Richlite Fibre-Laminate Sheet 1¼" 48" 48"076033 Richlite Fibre-Laminate Sheet 1½" 48" 48"076027 Richlite Fibre-Laminate Sheet 2" 48" 48"076005 Richlite Fibre-Laminate Sheet ¼" 48" 96"076022 Richlite Fibre-Laminate Sheet ½" 48" 96"076023 Richlite Fibre-Laminate Sheet 5⁄8" 48" 96"076024 Richlite Fibre-Laminate Sheet ¾" 48" 96"076007 Richlite Fibre-Laminate Sheet 1" 48" 96"076031 Richlite Fibre-Laminate Sheet 1¼" 48" 96"076032 Richlite Fibre-Laminate Sheet 1½" 48" 96"076008 Richlite Fibre-Laminate Sheet 2" 48" 96"076046 Richlite Fibre-Laminate Sheet 3" 48" 96"Some sizes are special order and subject to extended lead times. Pleasecontactcustomerserviceforcompleteinformation.

Liquid Tool ing Mater ia ls

1.800.321.851114

Repro Fast-Cast Polyurethanes are world-renowned as the leading class of quick-curing casting resin systems available today. These products are designed for ease of mixing, quick demolding, and unsurpassed accuracy. Repro is manufactured by Freeman and has become the standard that all other fast-setting castable urethanes are measured against.

Repro features:•Onetoonemixratiobyweightorvolume•Verylowshrinkage•Lowviscosityensuringeasypouringcharacteristics

and excellent surface reproduction

Repro Fast-Cast Polyurethanes

LiquidToolingMaterials

Repro Fast-Cast Polyurethanes Specifications

Repro One 1:1 6-7 60 - 90 87 1.75 1,500 15.8 0.001 7,860 4,290 799,000 2,350 582,000 0.30 156°F/69°C 1.79 x 10-5

Repro 83 1:1 6-7 60 - 90 84 1.9 1,100 14.5 0.001 6,470 5,140 939,000 3,130 941,000 0.31 135°F/57°C 131°F/55°C –Repro NS 1:1 6-7 60 - 90 84 1.9 1,750 14.5 0.001 5,970 2,990 – 1,710 – 0.35 142°F/61°C 133°F/56°C 1.45 x 10-5

Repro Fast 1:1 4-5 15 - 30 84 1.9 1,100 14.5 0.002 6,470 5,140 939,000 3,130 941,000 0.31 135°F/57°C 131°F/55°C –Repro 10 1:1 5-6 30 - 60 84 1.9 1,100 14.5 0.001 6,470 5,140 939,000 3,130 941,000 0.31 135°F/57°C 131°F/55°C –Repro Slow 1:1 12-14 3 - 4 hr 84 1.9 1,100 14.5 0.001 6,470 5,140 939,000 3,130 941,000 0.31 135°F/57°C 131°F/55°C –Repro Light 1:1 6-8 90 - 120 68 0.9 1,500 30.0 0.001 3,980 2,620 347,000 1,530 350,000 0.15 132°F/56°C 118°F/48°C 3.50 x 10-5

Repro Ultra Light 1:1 10-11 2 - 3 hr 55 0.59 1,400 47.0 0.001 2,700 1,840 160,000 1,490 72,400 0.12 128°F/53°C 119°F/48°C 4.18 x 10-5

Repro 95 1:1 6-7 60 - 90 84 1.9 1,450 14.5 0.001 7,140 3,070 505,000 1,770 561,000 0.29 131°F/55°C 117°F/47°C 3.13 x 10-5

Surface Coat 1:1 13 3 - 4 hr 84 1.9 6,000 14.5 – – – – – – – – –Laminating Resin 1:1 15 3 - 4 hr 84 1.9 3,500 14.5 – – – – – – – – –

ASTM Tests D-2566 D-695 D-790 D-790 D-638 D-638 D-256 D-648 D-648 D-696-88*Dependant upon mass.

Choosing a Repro FormulationCriteria Product

Balance of Features Repro 83

Higher Temperatures ReproOne,ReproNS

Speed Repro Fast, Repro 10

Accuracy ReproSlow

LightWeight ReproLight,ReproUltraLight

Machinability Repro95,ReproUltraLight

LargeSize ReproSurfaceCoatandLaminatingResin

Heat

Defl

ectio

n

Tem

p. @

66

psi

Heat

Defl

ectio

n

Tem

p. @

264

psi

IZOD

Impa

ct S

treng

th

(ft.

lbs.

/in.)

Tens

ile M

odul

us (p

si)

Coef

ficie

nt T

herm

al

Exp

ansi

on

(i

n/in

/°F)

Tens

ile S

treng

th (p

si)

Flex

ural

Mod

ulus

(psi

)

Flex

ural

Stre

ngth

(psi

)

Com

pres

sive

S

treng

th (p

si)

Shrin

kage

(in.

/in.)*

Volu

met

ric Y

ield

(cu.

in./

lb.)

Mix

ed V

isco

sity

(CPS

) @ 1

min

.

Spec

ific G

ravi

ty

Hard

ness

(Sho

re D

)

Dem

old

Tim

e

(min

.) @

77°

F

Gel T

ime

(min

.) @

77°

F

Mix

Rat

io (b

y wt o

r vol

.)

www.freemansupply.com 15

Liquid Tooling Materials

Repro Fast•4-5MinGelTime•15-30MinDemold

Formulated to have the shortest demold time of all of the Repro products for maximum part production. Repro Fast is the best choice when time is most important.Catalog Number Description Availability

Net Wt. (Lbs.)

053181 Repro Fast – Tan Quart Unit 5053183 Repro Fast – Tan Gallon Unit 20053184 Repro Fast – Tan 5 Gallon Unit 100

Repro 10•5-6MinGelTime•30-60MinDemold

The original Repro formulation, this product has a slightly longer work time, longer demold time, and less shrinkage than Repro Fast.Catalog Number Description Availability

Net Wt. (Lbs.)

053060 Repro 10 – Tan Quart Unit 5053064 Repro 10 – Tan Gallon Unit 20053062 Repro 10 – Black Quart Unit 5053066 Repro 10 – Black Gallon Unit 20

Repro Slow•Highestlevelofaccuracyavailable•12-14MinGelTime•3-4Hr.Demold

Ourmostaccuratefast-castpolyurethanesystem,ReproSlow features extremely low shrinkage and an extended work time that allows for the creation of larger tools.Catalog Number Description Availability

Net Wt. (Lbs.)

053201 Repro Slow – Tan Gallon Unit 20053202 Repro Slow – Tan 5 Gallon Unit 100

Repro Light•1⁄2 the weight of Repro 83•6-8MinGelTime•90-120MinDemold

ReproLightisaversatilecastableurethanethatisapproximatelyonehalf the weight of our other Repro products. This material, which is colored brown, can be used for lightweight tools, backfill applications, and as an adhesive for many urethane modeling boards. Its hardness and color is an almost exact match to the popular tooling board RenShape450.Thismaterialalsoofferslowerinternalporositycom-paredtocompetitiveproducts.ReproLightofferseasymachinabilityand can be readily worked and carved with hand tools.Catalog Number Description Availability

Net Wt. (Lbs.)

053197 Repro Light – Brown Quart Unit 2.5053198 Repro Light – Brown Gallon Unit 10053199 Repro Light – Brown 5 Gallon Unit 50

Repro Fast-Cast Polyurethanes [CONTD.]

Repro One•Ourmostadvanced

fast-cast urethane•6-7MinGelTime•60-90MinDemold

ReproOneisthelatestformulationinour extensive line of fast-cast ure-thanes. This castable polyurethane can be used in durable foundry tooling, thermoforming applications, mold making, as well as most general plastic casting applications.

Additional Advantages:•Higherheatresistanceforelevatedtemperatureapplications•HigherShoreDhardnessforimprovedabrasionresistance•Lowermoisturesensitivityforvoid-freecastings• Improvedreleasecharacteristicsforeasierdemold•Lowerdensityforgreatervolumeyield•Non-settlingformulationforfastandeasymixing•Compatiblewithexpandedpolystyrene(Styrofoam)

Catalog Number Description Availability

Net Wt. (Lbs.)

053090 Repro One – Gray Quart Unit 5053093 Repro One – Gray Gallon Unit 20053095 Repro One – Gray 5 Gallon Unit 100

Repro 83•6-7MinGelTime•60-90MinDemold

Repro 83 is our most popular tooling urethane with a great balance of speed and accuracy. This castable polyurethane is used extensively in foundry and thermoforming applica-tions, mold making, and in most general plastic casting applications. Offeredinachoiceofblue,gray,orwhite.Catalog Number Description Availability

Net Wt. (Lbs.)

053150 Repro 83 – White Quart Unit 5053156 Repro 83 – White Gallon Unit 20053152 Repro 83 – Blue Quart Unit 5053158 Repro 83 – Blue Gallon Unit 20053164 Repro 83 – Blue 5 Gallon Unit 100053154 Repro 83 – Gray Quart Unit 5053160 Repro 83 – Gray Gallon Unit 20053166 Repro 83 – Gray 5 Gallon Unit 100

Repro NS (Non-Settling)•6-7MinGelTime•60-90MinDemold

ReproNSfeaturesanon-settlingadditivethateliminatesfiller “hard-packing” and dramatically reduces the time required to pre-mix thematerialforuse.Shakersandmixersarenolongerrequired–simply stir with a paint paddle!

It is formulated to match the color, mix ratio, work time, low shrinkage, and surface hardness of our most popular fast cast product,Repro83.However,ReproNSoffersahighertemperatureresistance. Therefore, like Repro 83, it is used in foundry and thermoforming applications, mold making, and in most general plastic casting applications.Catalog Number Description Availability

Net Wt. (Lbs.)

053153 Repro NS – Blue Quart Unit 5053159 Repro NS – Blue Gallon Unit 20053165 Repro NS – Blue 5 Gallon Unit 100


1.800.321.851116

Repro Ultra Light•1⁄3theWeightofRepro83•10-11MinGelTime•2-3Hr.Demold

Auniquecastableurethane,ReproUltraLightisaverylow-density,syntactic polyurethane casting resin designed for weight critical appli-cations and easy machinability. This cream colored formulation may beworkedwithhandtoolsorCNCmachiningequipmentwhencured. A long work time allows for large, accurate castings.

LikeReproLight,thismaterialoffersalowinternalporositythatproducesanexcellentmachinedsurfacefinish.ReproUltraLightisalso an excellent choice to use as a hardness-matched adhesive for RenShapeurethanefoamboards.Catalog Number Description Availability

Net Wt. (Lbs.)

053196 Repro Ultra Light – Cream Gallon Unit 7053200 Repro Ultra Light – Cream 5 Gallon Unit 35

Repro 95•Aluminum-Filled•6-7MinGelTime•60-90MinDemold

Repro 95 is a unique castable polyure-thane featuring a high aluminum content which provides excellent machining and polishing characteris-tics. This casting resin has a gray metal-like appearance and is ideal for prototype thermoforming and wax injection mold applications for investment casting.

Unique Advantages:•Dense,non-poroussurfaceevenaftermachining•Reducedtoolwearcomparedtostandardfast-cast

materials when machining•Theultra-smoothfinishofthematerial,evenafter

machining, allows for easy sand release in pattern and core box applications


Net Wt. (Lbs.)

053051 Repro 95 – Gray Quart Unit 5053052 Repro 95 – Gray Gallon Unit 20

Repro Surface Coat & Laminating Resin System•13MinGelTime(SurfaceCoat)•15MinGelTime(LaminatingResin)•3-4Hr.Demold(CompleteTool)

AFreemanexclusive!TheReproSurfaceCoatandLaminatingSystem is a low-cost, fast, and very accurate alternative to traditional epoxy fiberglass tooling. Although this tooling urethane is not designed to be usedinhigh-temperatureorhigh-wearapplications,ReproSurfaceCoatandLaminatingResinistheidealmaterialchoiceformanylarger moldmaking applications. Both materials are white in color.

Additional Advantages:•Lowexotherm

system provides for very low-shrinkage tools.Systemwillnotget hot even in thick applications.

•Quickthreehourdemold time versus 24hourcuretimeforepoxy systems.

•Veryeasysystem to use for first time toolmakers.

•Boththesurfacecoatand laminating resin will adhere to material that has previously been cured.


Net Wt. (Lbs.)

053188 Repro Surface Coat – White Quart Unit 5053189 Repro Surface Coat – White Gallon Unit 20053194 Repro Laminating Resin – White Gallon Unit 20053195 Repro Laminating Resin – White 5 Gallon Unit 100054073 1⁄4" Fiberglass Strand Box 5054071 1⁄4" Fiberglass Strand Box 50

SEE ALSO Product Page No.

Tooling Plastics Fillers 48-49

Red Devil Mixer 98

Mixing Cups, and Paddles 109

Pattern Coatings (Primers, Paints & Sealers) 102-103

Mold Releases 104-107

Freeman 302 Urethane Protectant 109

Repro Fast-Cast Polyurethanes [CONTD.]

1

3

2

4



Theseurethanesarehighlyfilled,veryhard(84ShoreD),fastsetting,low exotherm, low shrink, and low cost for producing foundry patterns, molds, fixtures, prototype vacuum form molds, or prototypes.

Pro-Cast 10•6-10MinuteGelTime•30-60MinuteDemold

This fast-setting, low-shrinkage polyurethane also features a low viscosity to reproduce fine detail. Ideal for producing prototype parts, molds and fixtures, foundry patterns, and core boxes. Catalog Number Description Availability

Net Wt. (Lbs.)

056361 Procast 10 – Black Gallon Unit 20056362 Procast 10 – Tan Gallon Unit 20


This fast-setting, low-shrinkage polyurethane features a cured hardnessof85ShoreD.Idealfor molds, patterns and core boxes. Catalog Number Description Availability

Net Wt. (Lbs.)

056364 Procast 20 – Gray Gallon Unit 20056365 Procast 20 – White Gallon Unit 20056363 Procast 20 – Blue Gallon Unit 20

Pro-Cast 3-33•7-10MinuteGelTime•60-90MinuteDemold

A low viscosity, fast setting, rigid polyurethane. This material, which is green in color, may be used to create patterns, coreboxes, and vacuum-form tools.Catalog Number Description Availability

Net Wt. (Lbs.)

056366 Procast 3-33 – Green Gallon Unit 20


FormerlyRenCast132.Thisdurable,fast-curingpolyurethaneoffersaccuratereproductionswithfinedetail.Goodforproducingholdingfixtures, foundry patterns and vacuum-forming molds. Catalog Number Description Availability

Net Wt. (Lbs.)

056347 ProCast 132 – Gray Gallon Unit 20

Pro-Cast Tool•10MinuteGelTime•60-90MinuteDemold

Formerly Pur-Fect Tool. Pro-Cast Tool is a fast-curing, gray polyurethanewithacuredhardnessof85ShoreDthatrequiresnospecializedmixingequipmenttodispersethefillers.Idealformolds,patterns, and core boxes.Catalog Number Description Availability

Net Wt. (Lbs.)

056345 Pro-Cast Tool – Gray Gallon Unit 20

RenCast 205-3•9-10MinuteGelTime•60-90MinuteDemold•80D-85DShoreHardness (w/DT082Filler)

This three-component, polyurethane cast-ing system features good dimensional stability, low shrink, and rapid cure.

TheadditionofDT082(1:1:3ratio)makesthismaterialideal for foundry patterns, pattern plates, core boxes, cores, gating, risers, prototypes, jigs and fixtures.Catalog Number Description Availability

Net Wt. (Lbs.)

056320 RenCast 205-3 – Tan Gallon Unit 15056321 RenCast 205-3 Resin Only 5 Gallon 38056322 Ren 205-3 Hardener Only 5 Gallon 38056236 Ren DT 082 High Density Filler 5 Gallon 33

RenCast 6426-1•7-8MinuteGelTime•60-120MinuteDemold•60D-65DShoreHardness(w/DT081Filler)•70D-80DShoreHardness(w/DT082Filler)

This unique three-component polyurethane features ease of mixing, good surface reproduction and excellent physical properties. Demold timeis60to120minutesdependinguponmassandcuretemperature.

Dependinguponproductapplication,eitherDT-081LowDensity(1:1:1ratio)orDT-082HighDensity(1:1:3ratio)fillerscanbeusedwithRenCast6426-1(soldseparately).Catalog Number Description Availability

Net Wt. (Lbs.)

056203 RenCast 6426-1 – Gray Gallon Unit 18056235 Ren DT 081 Low Density Filler 50 lb. Bag 50056236 Ren DT 082 High Density Filler 5 Gallon 33

RenCast 3265•3MinuteGelTime•15-30MinuteDemold•78DShoreHardness

This two component fast cast urethane features a fast demold time of 15 to 30 minutes, permitting multiple parts to be made in one day. This product is highly filled for low shrinkage and good wear resistance.Catalog Number Description Availability

Net Wt. (Lbs.)

056103 Ren 3265 Hardner Only 6 Quarts 18056101 RenCast 3265 Resin Only 6 Quarts 18

Pro-Cast Fast-Cast Polyurethanes Ren Fast-Cast Urethane Systems


1.800.321.851118

These hand pourable urethanes offer a wide range of hardnesses and working times, and can be demolded in as little as 30 minutes to two hours enabling the production of multiple thermoplastic-like prototypes and short run end use parts per day.

Freeman 1070 – Off-White•3MinGelTime|15-30MinDemold•70DShoreHardness

This off-white urethane elastomer is able to be hand mixed and poured tocreatepartsthatsimulateinjectionmoldedplastic.Freeman1070iseconomical and features very low viscosity and low moisture sensitivity. A demold time of 15 to 30 minutes enables many parts to be poured in one day without the expenditure for a meter-mix machine. Castable to 1⁄2" in thickness.Catalog Number Description Availability

Net Wt.(Lbs.)

055500 Freeman 1070 Pint Unit 2055406 Freeman 1070 Gallon Unit 15.4

Freeman 1080 – White•7Minor20MinGelTime|1-3Hr.or2-4Hr.Demold•80DShoreHardness

Thisbrilliantwhiteurethaneelastomerofferstwogeltimes,7minuteswithafasthardenerand20minuteswiththeslowhardener.Bothmaterialsfeaturea1:1mixratiobyvolume,alowviscosityforpouringthin-walled parts, and sufficient time to degas. The Freeman 1080 Fastcanbedemoldedwithin1-3hoursandtheSlowcanbedemoldedwithin2-4hours.Castableto1⁄2" in thickness.Catalog Number Description Availability

Net Wt.(Lbs.)

055409 Freeman 1080 Fast Gallon Unit 16055410 Freeman 1080 Fast 5 Gallon Unit 80055419 Freeman 1080 Slow Pint Unit 2055412 Freeman 1080 Slow Gallon Unit 16055411 Freeman 1080 Slow 5 Gallon Unit 80

Freeman 1085 – Tan•6MinGelTime|30-120MinDemold•69DShoreHardness

Freeman 1085 is an economical, tan colored urethane elastomer that is suitable for creating proto-type injection molded parts. This product is easy to use because of a1:1mixratiobyweightorvol-ume, low moisture sensitivity low viscosity for easy pouring, and can be cast to 11⁄2" thick.Catalog Number Description Available

Net Wt.(Lbs.)

055502 Freeman 1085 Pint Unit 2055127 Freeman 1085 Gallon Unit 15.2055125 Freeman 1085 Resin Only 5 Gallon 38055126 Freeman 1085 Hardener Only 5 Gallon 38

Polyurethane Elastomers – Intermediate Cure

Polyurethane Elastomers – Intermediate Cure Specifications

Freeman 1070 100:92 1:1 3 15-30 min 70 80 1.05 26.6 0.004 – – 3000 – – – –Freeman 1080 Fast 117:100 1:1 7 1-3 80 150 1.12 24.7 0.001 8,300 9,500 6,650 2.88 x 105 134 – –Freeman 1080 Slow 117:100 1:1 20 2-4 80 150 1.12 24.7 0.001 8,300 9,500 6,650 2.88 x 105 134 – –Freeman 1085 1:1 1:1 6 1/2 - 2 69 80 1.12 24.7 0.002 4,880 5,600 3,300 1.7 x 105 137 – –Freeman 1090 Fast 100:90 1:1 9 1/2 - 4 80 600 1.04 26.7 0.001 – 11,000 2,500 – – – –Freeman 1090 Slow 100:90 1:1 20 16 80 600 1.04 26.7 0.001 – 11,000 2,500 – – – –RenCast 6432-1 100:50 100:50 5-6 1-2 72 50/1,100 1.09 25.4 – 7,200 8,600 5,900 234,000 163 0.6 153RenCast 6463 Fast 1:1 1:1 4-6 4-6 79 280/700 1.09 25.4 – 6,800 10,800 5,700 230,000 152 1.1 -RenCast 6486 Slow 100:50 100:50 7-8 8 67 7,800/75 1.16 23.9 – – 4,800 3,600 110,000 156 6.6 217RenCast 6491 1:1 89:100 4-5 4-6 85 200/640 1.14 24.3 – 33,500 16,000 8,600 400,000 205 0.8 224RenCast 6496 1:1 89:100 5-6 2-4 68 – 1.10 25.2 – – – 4,000 110,000 140 0.8 –RenCast 6497 1:1 – 4-5 2 70A – 1.10 25.2 – – – 995 – – – –ASTM – – D-2471 – D-2240 D-2393 D-792 D-792 D-2566 D-695 D-790 D-638 D-790 D-648 D256 D4065

Izod

Impa

ct

(ft

.lb/in

.)Tg

per

DM

A

(°F

)

Defle

ctio

n

Tem

p. (°

F)

Flex

ural

M

odul

us (p

si)

Tens

ile S

treng

th

(p

si)

Flex

ural

Stre

ngth

(p

si)

Com

pres

sive

Stre

ngth

(psi

)

Shrin

k (in

/in)

Volu

met

ric Y

ield

(c

u.in

. / lb

.)

Dens

ity (g

/cc)

Visc

osity

R/H

or M

ixed

(cps

)

Hard

ness

(

Shor

e D)

Dem

old

Tim

e (

hour

s) @

72°

F

Gel T

ime

(min

.)

@ 7

2°F

Mix

Rat

io R

esin

:

Har

dene

r (by

vol.)

Mix

Rat

io R

esin

:

Har

dene

r (by

wt.)



Polyurethane Elastomers – Intermediate Cure [CONTD.]

Freeman 1090 – Clear•9Minor20MinGelTime•1⁄2-4Hr.or16Hr.Demold•80DShoreHardness

Freeman 1090 is a water clear urethane elastomer that is ideal for creating parts which require near-perfect clarity.

This product is available in both a fast formulation which has a demold time of a half hour to four hours, aswellasaslowformulation(forpouringlargerparts)whichrequiresa16hourcurebeforedemolding.Bothfeatureaonetoonemixratioand low mixed viscosity which makes it excellent for pouring thin-walled parts.

Freeman 1090 Fast may be cast up to 1⁄2" thick and the Freeman1090Slowmaybecastupto3"thick.

Note:PartthicknessgreatlyaffectsthecuringrateofFreeman1090. Thin-walled parts may require a post cure. Permit the material to solidify at room temperature and then heat cure the part in the mold at 110 to 150F for two to six hours. After cooling, the part is ready to demold.Catalog Number Description Availability

Net Wt.(Lbs.)

055440 Freeman 1090 Fast Gallon Unit 15.2055417 Freeman 1090 Slow Pint Unit 2055415 Freeman 1090 Slow Gallon Unit 15.2

RenCast 6432-1 – Off-White•5-6MinGelTime•1-2Hr.Demold•72DShoreHardness

RenCast6432-1isalowviscositypolyurethanecastingsystemforsimulating injection molded plastic parts. The five to six minute gel time permits hand mixing and pouring, yet the parts are demoldable in one to two hours. This enables production of multiple parts in one day without the expense of a meter-mix machine. Catalog Number Description Availability

Net Wt.(Lbs.)

056678 RenCast 6432-1 Gallon Unit 13.8056679 RenCast 6432-1 Resin Only 5 Gallon 37.5056680 RenCast 6432-1 Hardener Only 5 Gallon 37.5 *Please note that two 5 gallon pails of resin are required for each 5 gallon pail of hardener to provide the correct mix ratio.

RenCast 6463 Fast – Clear•4-6MinGelTime•4-6Hr.Demold•79DShoreHardness

Designed for production of crystal clear, durable, short run, and rapid prototyping parts using low cost tooling and hand mix and meter-mixing equipment. The low mixed viscosity helps produce quality parts. This material features a one-to-one mix ratio by weight or volume.Catalog Number Description Availability

Net Wt.(Lbs.)

056643 RenCast 6463 Fast Gallon Unit 14

RenCast 6486 Slow – Amber•7-8MinGelTime•8Hr.Demold•67DShoreHardness

An extremely tough material which featuresanotchedIZODimpactstrengthover6ft.lb./in.Thissystem is designed to closely simulate the performance characteristics of polyethylene and polypropylene. Longgeltimeformakinglargeparts.Catalog Number Description Availability

Net Wt.(Lbs.)

056634 RenCast 6486 Slow Gallon Unit 12

RenCast 6491 – Amber•4-5MinGelTime•4-6Hr.Demold•85DShoreHardness

RenCast6491isspecificallydesignedforsimulatingABSparts.Aflexuralmodulusof400,000psiandimpactresistanceof1.2ft.lb./in.gives this product an excellent combination of rigidity & durability. Heatresistanceis224°FTgbyDMA.Catalog Number Description Available

Net Wt.(Lbs.)

056675 RenCast 6491 Gallon Unit 16

RenCast 6496 – White•5-6MinGelTime•2-4Hr.Demold•68DShoreHardness

RenCast6496isanon-mercurypolyurethanesystemwhichcloselysimulatespolyethyleneandTPO.Afivetosixminutegeltimeenableshand mixing and pouring, but the product cures in two to four hours. Ideal for simulating thermoplastic parts.Catalog Number Description Availability

Net Wt.(Lbs.)


RenCast 6497 – Amber•4-5MinGelTime•2Hr.Demold•70AShoreHardness

RenCast6497isanambercoloredflexiblepolyurethanecasting system used to produce rubber-like parts quickly and easily. A four to five minute gel time permits hand mixing and pouring, yet the rapid cure enables multiple parts to be made in one day without the use of a meter-mix machine. Ideal for making rubber-like parts and molds requiring flexibility.Catalog Number Description Availability

Net Wt.(Lbs.)


SEE ALSO: Product Page No.Mixing Cups and Paddles 109Freeman Color Tints 49


1.800.321.851120

Polyurethane Elastomers – Overnight Cure – Flexible

Urethanerubberisgenerallylessexpensivethansiliconerubberandmore abrasion resistant, making it a preferred material for concrete and architectural castings. However, flexible urethanes are not self-releasingandthereforerequireamorethoroughprocedure(waxandPVA)tofacilitatecleanandeasypartrelease.

Freeman 1035 – Beige•Castableto2"inThickness•30MinGelTime|16Hr.Demold•35AShoreHardness

This flexible material is excellent for making molds with deep undercuts or where a flexible mold makes demolding easier. This economical urethane fea-tures a one to one mix ratio by weight or volume, making mixing easy and convenient.Catalog Number Description Available

Net Wt.(Lbs.)

055129 Freeman 1035 Pint Unit 2055401 Freeman 1035 Gallon Unit 16055402 Freeman 1035 5 Gallon Unit 80

Freeman 1035T – Beige•BrushableforCreatingGloveMolds•20MinGelTime|16Hr.Demold•40AShoreHardness

This flexible urethane features a thick viscosity which enables it to be brushed over the surface of larger models or patterns without sagging or flowing from vertical surfaces. By applying several coats, a flexible “skin” may be created and subsequently reinforced with a back-up structure to offer support during use.Catalog Number Description Available

Net Wt.(Lbs.)

055404 Freeman 1035T Gallon 18

Freeman 1040 – Off-White•Castableto2"inThickness•28MinGelTime|16Hr.Demold•52AShoreHardness

Thisflexibleurethaneisanexcellentlow-costalternativetoRTV siliconerubbermoldmakingmaterials.Likemostcastableurethanerubber systems, it is ideal for general flexible mold construction, flexible parts and gaskets, plaster casting, and prototypes. Freeman 1040 flows easily and features a high tear strength.Catalog Number Description Availability

Net Wt.(Lbs.)

055130 Freeman 1040 Gallon Unit 8.8055131 Freeman 1040 Resin Only 2 Quarts 4055132 Freeman 1040 Hardener Only 5 Gallons 40

RenCast 6400-1 – Off-White•Castableto1.5"inThickness•30MinGelTime|16Hr.Demold•52AShoreHardness

Featuresoutstandingtearstrengthandelongation.Moldsmade ofRenCast6401-1canbeflexedandstretched,allowingforeasyremoval of parts. Catalog Number Description Availability

Net Wt.(Lbs.)

056530 RenCast 6400-1 Gallon Unit 8.79056531 RenCast 6400-1 Resin Only 2 Quarts 4056532 Ren 6400-1 Hardener Only 5 Gallons 40

Overnight Cure Flexible Polyurethane SpecificationsMix

Ratio Resin:

Hardener (by wt.)

Mix Ratio Resin:

Hardener (by vol.)

Gel Time

(Min) @ 72° F

Demold Time

(hours) @ 72° F

Hardness (Shore)

Mixed Viscosity

(cps) Density (g/cc)

Volumetric Yield

(cu. in./lb.)Shrink

(in./in.)

Tensile Strength

(psi)

Tear Strength

(psi)Elongation

(%)

Tear, Die C (PLI)

Tear, Split (PLI)

Freeman 1035 1:1 1:1 30 16 35A 1,500 1.02 27.2 0.001 450 – – – –Freeman 1035T 80:100 1:1 20 16 40A Thixotropic 1.17 23.6 – – – – – –Freeman 1040 10:100 9:100 28 16 52A 1,350 1.04 26.6 0.001 1,190 110 410 – –RenCast 6400-1 10:100 9:100 30 16 52A 1,300 1.04 26.6 0.001 1,260 112 420 – –RenCast 6401-1 25:100 22:100 20 16 65A 1,000 1.07 25.9 0.0005 1,820 171 340 – –RenCast 6410-1 100:100 93:100 30 16 37A 1,200 1.04 26.6 0.003 505 74 330 – –RenCast 6434 25:100 25:100 17 16 35 - 40A 500 1.16 24.0 0.001 1,100 120 500 – –Por-A-Mold S111 100:88 1:1 20 16 20A 2,000 1.29 21.5 0.001 211 – 500 51 8.1Por-A-Mold S333 100:89 1:1 20 16 35A 1,500 1.11 24.9 0.001 400 – 450 78 9Por-A-Mold S333TA – 1:1 30 24 35A Thixotropic – – – – – – – –Por-A-Mold S555 100:80 1:1 15-20 16 50A 7,500 1.20 23.0 0.001 415 – 250 88 12Por-A-Mold SX50-1 1:1 1:1 20 16 50A 2,000 1.03 26.9 0.001 1,200 – 450 147 20ASTM – – D-2471 – D-2240 D-2393 D-792 D-792 D-2566 D-638 D-624 D-638



RenCast 6401-1 – Off-White•Castableto4"inThickness•20MinGelTime|16Hr.Demold•65AShoreHardness

Ideal for producing very flexible molds and resilient parts. Features one to one mix ratio by weight and low viscosity. Catalog Number Description Availability

Net Wt.(Lbs.)

056527 RenCast 6401-1 Gallon Unit 10056528 RenCast 6401-1 Resin Only Gallon 9056529 Ren 6401-1 Hardener Only 5 Gallon 36

RenCast 6434 – Light Amber•Castableto1"inThickness•17MinGelTime|16Hr.Demold• 8-40AShoreHardness

The most flexible of Huntsman’s urethanes. Its hardness may be variedfrom8to40ShoreAbytheadditionofAdditive-6434.Catalog Number Description Availability

Net Wt.(Lbs.)

056328 RenCast 6434 Gallon Unit 10056332 Additive 6434 5 Gallon 42

Ren Accelerator 178-62This liquid catalyst will accelerate the curing process, and reduce demoldtimes.Accelerator178-62shouldbemixedthoroughlyinthehardener before adding the required amount of resin.

ForuseonlywithpolyurethanesRenCast6400-1,RenCast6401-1,RenCast6402-1,RenCast6403-1,RenCast6405,RenCast6410-1,RenCast6419,andFreeman1040.PleasereadtheTechnicalDataSheetformixinginstructionsbeforeusingthismaterial.Catalog Number Description Availability

Net Wt.(Lbs.)

056556 Ren Accelerator 178-62 Quart 1.7

Por-A-Mold S111 – Off-White•Castableto2"inThickness•20MinGelTime|16Hr.Demold•20AShoreHardness

This flexible urethane is used to make molds of detailed master that contain moderately deep undercuts. The most common uses include architectural and sculpture reproductions, taxidermy, prototypes, and general moldmaking applications. This economical material features a 1:1mixratiobyvolumeforeasyuse.Catalog Number Description Availability

Net Wt.(Lbs.)

057531 Por-A-Mold S111 Gallon Unit 19

Polyurethane Elastomers – Overnight Cure – Flexible [CONTD.]

Por-A-Mold S333 – Blue•Castableto2"inThickness•20MinGelTime|16Hr.Demold•35AShoreHardness

This flexible urethane is used to make molds of detailed masters that contain shallow undercuts. The most common uses include architectural and sculpture reproductions, taxidermy, prototypes, and general moldmaking applications. This economical material featuresa1:1mixratiobyvolumeforeasyuse.Catalog Number Description Availability

Net Wt.(Lbs.)

057337 Por-A-Mold S333 Quart Unit 4.6057538 Por-A-Mold S333 Gallon Unit 18.5

Por-A-Mold S333TA – Blue•BrushableforCreatingGloveMolds•30MinGelTime|24Hr.Demold•35AShoreHardness

S333TAisathixotropicversionoftheS333thatisthickenoughtobeapplied with a brush or trowel. This provides an inexpensive and easy method for creating a flexible rubber mold of large masters. This flexi-ble “skin” may be reinforced with rigid materials to support the rubber part for molding.

Number Description AvailabilityNet Wt.(Lbs.)

057342 Por-A-Mold S333TA Quart Unit 4.8

Por-A-Mold S555 – Pink•Castableto2"inThickness•15-20MinGelTime|16Hr.Demold•50AShoreHardness

This flexible urethane is used to make molds of detailed masters that donotcontainundercuts.Thispinkrubberfeaturesa1:1mixratio by volume and is used for architectural and sculpture reproductions, taxidermy, prototypes, and general mold making applications.Catalog Number Description Availability

Net Wt.(Lbs.)

057348 Por-A-Mold S555 Gallon Unit 22057349 Por-A-Mold S555 5 Gallon Unit 99

Por-A-Mold SX50-1 – Beige•Castableto2"inThickness•20MinGelTime|16Hr.Demold•50AShoreHardness

This flexible urethane is used to make molds of detailed masters that do not contain undercuts. This beige colored product is ideal for making concrete molds and form lines.Catalog Number Description Availability

Net Wt.(Lbs.)

057541 Por-A-Mold SX50-1 Gallon Unit 16


1.800.321.851122

Polyurethane Elastomers – Overnight Cure – Semi-Rigid

Semi-rigidurethanesareknownfortheirexcellentimpactstrengthand abrasion resistance, making them ideal for foundry tooling as well as semi-rigid part production.

Freeman 1050 – Amber•Castableto4"inThickness•26MinGelTime|16Hr.Demold•85AShoreHardness

Freeman 1050 is a tough, semi-flexible urethane that is ideal for creating molds requiring some degree of flexibility, as well as for producing semi-rigid prototypes and finished parts. A one to one mix ratiobyweight.Its26minutegeltimeprovidesampletimetovacuumdegaspriortopouring.Overnightdemoldtimeisrequired.Catalog Number Description Availability

Net Wt.(Lbs.)

055142 Freeman 1050 Quart Unit 2.5055141 Freeman 1050 Gallon Unit 10055139 Freeman 1050 Resin only 5 Gallon 25055140 Freeman 1050 Hardener only 5 Gallon 25

Freeman 1060 – Red or Black•Castableto2"inThickness•28MinGelTime|16Hr.Demold•60DShoreHardness

This semi-rigid polyurethane casting resin is renown throughout the industry for its excellent impact strength and abrasion resistance, particularly in foundry tooling and other modeling and prototyping applications requiring strength and durability. Catalog Number Description Availability

Net Wt.(Lbs.)

055108 Freeman 1060 Black Quart Unit 2.5055106 Freeman 1060 Black Gallon Unit 10055110 Freeman 1060 Red Gallon Unit 10055107A Freeman 1060 Resin Only 5 Gallon 31.25055107B Freeman 1060 Black Hardener Only 5 Gallon 18.75055111B Freeman 1060 Red Hardener Only 5 Gallon 18.75055116 Freeman 1060 Resin Only 55 Gallon 460055117 Freeman 1060 Black Hardener Only 55 Gallon 280

Overnight Cure Semi-Rigid Polyurethane Specifications Mix Ratio

Resin: Hardener (by wt.)

Mix Ratio Resin:

Hardener (by vol.)

Gel Time (Min)

@ 72° F

Demold Time

(hours) @ 72° F

Hardness (Shore)

Mixed Viscosity


Volumetric Yield

(cu. in./lb.)Shrink

(in./in.)

Tensile Strength

(psi)

Tear Strength

(psi)Elongation

(%)Freeman 1050 1:1 100:94 26 16 85A 1,650 1.10 25.2 0.001 2,050 280 510Freeman 1060 100:60 100:60 28 16 60D 2,600 1.05 26.4 0.001 3,200 545 320Freeman 1066 100:50 100:50 15-17 2-4 65D 3,200 1.03 26.9 0.003 3,100 630 140RenCast 6402-1 35:100 31:100 20 16 82A 900 1.08 25.6 0.001 2,200 180 320RenCast 6403-1 50:100 44:100 15 16 92A 800 1.10 25.2 0.001 2,500 470 240RenCast 6442 1:1 100:94 28 16 85A 1,600 1.09 25.4 0.001 2,100 290 525RenCast 6443 100:60 100:60 18 16 95A 2,450 1.06 26.1 0.001 3,500 375 475RenCast 6444 100:60 100:60 27 16 60D 2,500 1.05 26.4 0.001 3,400 550 325RenCast 178-88/ Ren 6444

100:60 100:60 27 16 60D 2,500 1.05 26.4 0.001 3,400 550 325

Flexane 80 Liquid 100:30 – 30 – 87A 10,000 – 26.5 0.002 2,100 – –Flexane 94 100:45 – 10 – 97A 6,000 – 26.5 0.001 2,800 – –Por-A-Mold 2070 96:100 1:1 15 16 70A 2,650 1.06 26.2 0.001 1,468 – 443ASTM – – D-2471 – D-2240 D-2393 D-792 D-792 D-2566 D-638 D-624 D-638

Freeman 1066 – Red or Black•Castableto2"inThickness•15-17MinGelTime|2-4Hr.Demold•65DShoreHardness

Freeman1066isa65ShoreDpolyurethaneelastomerspecificallydesigned for highly abrasive resistant foundry tooling. Harder than ourFreeman1060,thisproductwillnotdeflectasmuchunderhighpressure molding processes. Plus, it has increased rigidity in thin wall sections and is able to be machined or sanded without softening. Freeman1066alsofeaturesafastdemoldtimeoftwotofourhoursandaheatdeflectiontemperatureof181°F.Catalog Number Description Availability

Net Wt.(Lbs.)

055120 Freeman 1066 Black Gallon Unit 9.75055119 Freeman 1066 Red Gallon Unit 9.75055121 Freeman 1066 Resin Only 5 Gallon 32.5055122 Freeman 1066 Black Hardener Only 5 Gallon 16.25055118 Freeman 1066 Red Hardener Only 5 Gallon 16.25055123 Freeman 1066 Resin Only 55 Gallon 420055124 Freeman 1066 Black Hardener Only 55 Gallon 210055112 Freeman 1066 Red Hardener Only 55 Gallon 210

RenCast 6402-1 – Off White•Castableto1"inThickness•20MinGelTime|16Hr.Demold•82AShoreHardness

Ideal for production models, metal-forming pads, and a variety of mechanical parts.Catalog Number Description Available

Net Wt.(Lbs.)

056533 RenCast 6402-1 Gallon Unit 7.75056534 RenCast 6402-1 Resin Only Gallon 9.1056535 Ren 6402-1 Hardener Only 5 Gallon 26



Polyurethane Elastomers – Overnight Cure – Semi-Rigid [CONTD.]

RenCast 6403-1 – Off White•Castableto1⁄2" in Thickness•15MinGelTime|16Hr.Demold•92AShoreHardness

Ideal for metal-forming applications and parts such as impellers, rollers, gears and wheels. Features low viscosity, fast cure, high tensile strength and good load recovery.Catalog Number Description Availability

Net Wt.(Lbs.)

056536 RenCast 6403-1 Gallon Unit 12056537 RenCast 6403-1 Resin Only 5 Gallon 40056538* Ren 6403-1 Hardener Only 5 Gallon 40 *Please note that two 5 gallon pails of hardener are required per each 5 gallon pail of resin to provide the correct mix ratio.

RenCast 6442 – Light Amber•Castableto4"inThickness•28MinGelTime|16Hr.Demold•85AShoreHardness

Ideal for vibration-dampening applications as well as production andprototypeparts.RenCast6442featuresonetoonemixratio by weight, long pot life, low viscosity and good wear resistance. 4" maximum thickness.Catalog Number Description Availability

Net Wt.(Lbs.)

056542 RenCast 6442 Gallon Unit 13.8056543 RenCast 6442 Resin Only 5 Gallon 40056544 Ren 6442 Hardener Only 5 Gallon 40

RenCast 6443 – Light Amber•Castableto2"inThickness•19MinGelTime|16Hr.Demold•95AShoreHardness

Usedforfoundrypatternsandcoreboxesbecauseitfeaturesgoodabrasion resistance and is moisture tolerant during casting. Cures semi-rigid in mass and is flexible in thin cross-sections. Catalog Number Description Availability

Net Wt.(Lbs.)

056545 RenCast 6443 Gallon Unit 11.2056546 RenCast 6443 Resin Only 5 Gallon 40056547 Ren 6443 Hardener Only 5 Gallon 24

RenCast 6444 – Light Amber•Castableto2"inThickness•27MinGelTime|16Hr.Demold•60DShoreHardness

A semi-rigid, amber-colored, elastomer for use where wear-resistance is required such as foundry patterns and core boxes. Features low viscosity and good working life allowing for ease of handling and release of entrapped air. Catalog Number Description Availability

Net Wt.(Lbs.)

056521 RenCast 6444 Gallon Unit 11.2056522 RenCast 6444 Resin Only 5 Gallon 40056523 Ren 6444 Hardener Only 5 Gallon 24056669 RenCast 6444 Resin Only 55 Gallon 460056670 Ren 6444 Hardener Only 55 Gallon 276

RenCast 178-88 / Ren 6444 – Red•Castableto2"inThickness•27MinGelTime|16Hr.Demold•60DShoreHardness

ThisistheredversionofRenCast6444forfoundrypatterns.ItusestheRen6444hardener.Catalog Number Description Availability

Net Wt.(Lbs.)

056519 RenCast 178-88 Resin Only 5 Gallon 40056523 Ren 6444 Hardener Only 5 Gallon 24056672 RenCast 178-88 Resin Only 55 Gallon 460056670 Ren 6444 Hardener Only 55 Gallon 276

Ren Accelerator 178-57This liquid catalyst will accelerate the curing process and reduce demoldtimes.Accelerator178-57shouldbemixedthoroughlyinthehardener before adding the required amount of resin.

ForuseonlywithpolyurethanesRenCast6442,RenCast6443,RenCast6444,Freeman1050,&Freeman1060.

PleasereadtheTechnicalDataSheetformixinginstructionsbefore using this material.Catalog Number Description Availability

Net Wt.


Flexane® 80 – Black•30MinGelTime•87AShoreHardness

Devcon Flexane 80 features low shrink and high chemical and abrasion resistance. It is ideal for creating flexible molds and holding fixtures.TheFlex-AddadditivemaybeusedwithFlexane80Liquidtoproduce a lower durometer castable urethane.Catalog Number Description

Net Wt.(Lbs.)

054625 Devcon Flexane 80 Liquid 1054626 Devcon Flexane 80 Liquid 10054642 Flex-Add Additive 8 fl.oz.

Flexane® 94 – Black•10MinGelTime•97AShoreHardness

Devcon Flexane 94 features low shrink and high chemical and abrasion resistance. It is a semi-rigid material for creating extremely tough, flexible molds and non-marring holding and assembly fixtures.Catalog Number Description

Net Wt.(Lbs.)

054627 Devcon Flexane 94 Liquid 1054628 Devcon Flexane 94 Liquid 10

Por-A-Mold 2070 – Amber•Castableto2"inThickness•15MinGelTime|16Hr.Demold•70AShoreHardness

This semi-rigid urethane is used to make molds of detailed masters that do not contain undercuts. The most common uses include foundry patterns and core boxes, gaskets, liners, and fixtures. This economical materialfeaturesa1:1mixratiobyvolumeforeaseofuse.Catalog Number Description Availability

Net Wt.(Lbs.)

057527 Por-A-Mold 2070 Gallon Unit 17.5


1.800.321.851124

Polyurethane Elastomers – Overnight Cure – Rigid

This selection of harder polyurethanes have a wide variety of end uses including prototyping thermoplastic-like parts, constructing molds for low volume metal forming applications, and making heat resistant foundry tooling. All of these products have a long gel time to provide theusersufficienttimetovacuumdegaspriortopouring.A16-18hour cure time is required before demolding.

Overnight Cure Rigid Polyurethane Specifications Mix Ratio

Resin: Hardener (by wt.)

Mix Ratio Resin:

Hardener (by vol.)

Gel Time (Min)

@ 72° FHardness (Shore D)

Mixed Viscosity


Volumetric Yield

(cu. in./lb.)Shrink

(in./in.)

Tensile Strength

(psi)

Tear Strength

(psi)Elongation

(%)RenCast 6405 100:100 90:100 20 75 240 1.07 25.9 0.003 5,300 300 13.3RenCast 6419 100:80 100:85 20 85 250 1.25 22.1 0.002 10,000 – 6.7RenCast 6463 Slow 100:100 100:100 18-25 79 500 1.09 25.4 0.002 4,800 – –RenCast 6470 80:100 – 60-80 86 250-500 1.23 22.5 0.002 4,700 – 1.3RenCast 178-59-1 36:100 50:100 20 88 4,000 1.61 17.2 0.001 5,500 – –ASTM D-2471 D-2240 D-2393 D-792 D-792 D-2566 D-412 D-624 D-638

RenCast 6405 – White•Castableupto1⁄2" in Thickness•20MinGelTime•75DShoreHardness

Ideal for prototyping of injection molded or thermo-formed parts. Features low viscosity, minimal air entrapment, and easy mixing. RenCast6405producesabrilliantwhitecoloredpart.Catalog Number Description Availability

Net Wt.(Lbs.)

056270 RenCast 6405 Gallon Unit 16056273 RenCast 6405 Resin Only 5 Gallon 38056274 Ren 6405 Hardener Only 5 Gallon 38

RenCast 6419 – Off White•Castableupto½"inThickness•20MinGelTime•85DShoreHardness

Developed specifically for prototyping, this elastomer passes UL94V-Oatathicknessof.125inchesforflameretardency.Catalog Number Description Availability

Net Wt.(Lbs.)


RenCast 6463 Slow – Clear•Castableupto1⁄2" in Thickness•18-25MinGelTime•79DShoreHardness

Designed for production of crystal clear, durable, short run, and rapid prototyping parts using low cost tooling and hand mix and meter-mixingequipment.The1:1weightandvolumemixratio, combined with a low mixed viscosity, help produce high quality parts.Catalog Number Description Availability

Net Wt.(Lbs.)

056581 RenCast 6463 Slow Gallon Unit 14

RenCast 6470 – Off White•Castableupto3⁄4"(or10"withDT082Filler)inThickness•60-80MinGelTime•85DShoreHardness

A polyurethane casting system ideal for sheet metal forming tools, duplicate milling models, foundry pattern plates, vacuum-forming tools,negativemolds/fixturesandlargevolumemoldsforthe ceramic industry.Catalog Number Description Availabilty

Net Wt.(Lbs.)

056559 RenCast 6470 Resin Only 5 Gallon 32056560 Ren 6470 Hardener Only 5 Gallon 40056236 Ren DT 082 High Density Filler 5 Gallon 33

RenCast 178-59-1 – Red Brown•Castableupto11⁄2" in Thickness•22MinGelTime•85DShoreHardness

A polyurethane that forms a very hard, durable, heat-resistant com-pound.Usedinfoundryapplicationswithhotsandconditions.Catalog Number Description Availability

Net Wt.(Lbs.)

056354 RenCast 178-59-1 Resin Only 5 Gallon 45056355* Ren 178-59-1 Hardener Only 5 Gallon 41 *Please note that three 5 gallon pails of hardener are required per each 5 gallon pail of resin to provide the correct mix ratio.

Ren Accelerator 178-62This liquid catalyst will accelerate the curing process, and reduce demoldtimes.Accelerator178-62shouldbemixedthoroughlyinthehardener before adding the required amount of resin.

ForuseonlywithpolyurethanesRenCast6400-1,RenCast6401-1, RenCast6402-1,RenCast6403-1,RenCast6405,RenCast6410-1,andRenCast6419.PleasereadtheTechnicalDataSheetformixinginstructions before using this material.Catalog Number Description Availability

Net Wt.(Lbs.)




Polyurethane Elastomers – Rapid Cure

This group of polyurethanes are used to produce parts that simulate the appearance and performance of injection molded thermoplastic parts. These products are low viscosity systems designed to be used withautomateddispensingequipment(pg.99)andlowcosttooling.Withtheirextremelyfastgeltimes,theseformulaspermitdemoldingof durable parts in 15-45 minutes.

Rapid Cure Polyurethane Elastomers SpecificationsMix Ratio

Resin: Hardener (by vol.)

Gel Time (seconds) @ 72° F

Demold Time (Min)

@ 72° F

Viscosity Resin: Hardener

(cps.)Density (g/cc)

Ultimate Compressive Strength (psi)

Hardness (Shore D)

Ultimate Flexural Strength

(psi)

Ultimate Tensile

Strength (psi)

Flexural Modulus

(psi)

Deflection Temp.*

(264 psi) (°F)

Izod Impact (ft.lb./in.)

Tg per DMA (°F)

RenPIM 6450 67:100 45-65 15-30 170 / 1,600 1.16 23,100 77 7,000 4,900 184,000 208 0.9 306RenPIM 6451 67:100 65-85 20-45 170 / 1,600 1.16 17,900 76 6,900 4,200 174,000 212 0.6 302RenPIM 6452 67:100 50-70 15-30 30 / 1,600 1.16 22,300 79 7,900 4,300 198,000 162 0.8 252RenPIM 6456 50:100 45-65 15-30 170 / 1,600 1.15 8,700 70 5,700 3,800 143,000 190 0.5 270RenPIM 6458 100:100 35-60 15-30 75 / 400 1.21 14,500 86 16,500 10,200 432,000 129 0.9 190RenPIM 6460 67:100 45-65 15-30 170 / 1,500 1.18 24,500 80 7,100 5,400 181,000 232 1.1 320ASTM test D2393 D792 D695 D2240 D790 D638 D790 D648 D256 D4065

RenPIM 6450 – Buff•GeneralPurposePolyurethane•45-65SecondGelTime•15-30MinuteDemold•77DShoreHardness

Ideal for the casting of prototypes that weigh up to 10 lbs. Offersgooddimensionalstability,heatresistanceandimpactstrength. Can be demolded in 15 to 30 minutes.Catalog Number Description Availability

Net Wt.(Lbs.)

056553 RenPIM 6450 Iso (Resin) 5 Gallon 32056554 RenPIM 6450 Polyol (Hardener) 5 Gallon 40

RenPIM 6451 – Black•SlowerSetGeneralPurposePolyurethane•65-85SecondGelTime•20-45MinuteDemold•76DShoreHardness

This material provides a slightly longer gel time for casting larger parts16to22lbs.Excellenthightemperatureperformance(250°F)for prototype parts requiring heat resistance.Catalog Number Description Availability

Net Wt.(Lbs.)

056568 RenPIM 6451 Iso (Resin) 5 Gallon 32056596 RenPIM 6451 Polyol (Hardener) 5 Gallon 40*BuffcoloredPolyolisavailablebyspecialorder.Leadtimesandminimumsapply.

RenPIM 6452 – Off-White•HighFlexuralModulusPolyurethane•50-70SecondGelTime•15-30MinuteDemold•79DShoreHardness

Ideal for the casting of prototypes that weigh up to 10 lbs in less than 30 minutes, this material offers good durability, compressive and flexural strengths.Catalog Number Description Available

Net Wt.(Lbs.)

056571 RenPIM 6452 Iso (Resin) 5 Gallon 32056572 RenPIM 6452 Polyol (Hardener) 5 Gallon 40

RenPIM 6456 – Black•MediumFlexuralModulusPolyurethane•46-65SecondGelTime•15-30MinuteDemold•70DShoreHardness

Its70Dhardnessisidealforcastingprototypesrequiring polyethylene-likeperformance.Becauseofa50:100mixratio, RenPIM6456canbedispensedfromautometer/mixequipment or dual-barrel cartridges.Catalog Number Description Availability

Net Wt.(Lbs.)

056593 RenPIM 6456 Iso (Resin) 5 Gallon 24056577 RenPIM 6456 Polyol (Hardener) 5 Gallon 40056631 RenPIM 6456 Iso (Resin) 55 Gallon 270056632 RenPIM 6456 Polyol (Hardener) 55 Gallon 450

RenPIM 6458 – Clear Amber•VeryHighFlexuralModulusPolyurethane•35-60SecondGelTime•15-30MinuteDemold•86DShoreHardness

A fast-setting polyurethane with an outstanding flexural modulus of 432,000psi,excellentflexuralstrengthof16,500psiandgoodizodimpactstrengthof0.9ft.lb./in.


056507 RenPIM 6458 Iso (Resin) 5 Gallon 45056608 RenPIM 6458 Polyol (Hardener) 5 Gallon 38.25

RenPIM 6460 – Black•HeatResistantPolyurethane•45-65SecondGelTime•15-30MinuteDemold•80DShoreHardness

Thismaterialfeaturesaglasstransitiontemperatureof320°F,excellentizodimpactstrengthof1.1ft.lb./in.andagooddimensionalstability.


056574 RenPIM 6460 Iso (Resin) 5 Gallon 32056671 RenPIM 6460 Polyol (Hardener) 5 Gallon 40*BuffcoloredPolyolisavailablebyspecialorder.Leadtimesandminimumsapply.


1.800.321.851126

Mold Making Silicone Rubbers

BluestarRTVSiliconeRubber(alsoknownasRhodorsil®)is used extensively in applications where a flexible, self-releasing mold material is required, specifically rapid prototype tooling, polyurethane casting, and general silicone mold-making. This top quality line of silicone systems offers high accuracy, high heat resistances, and excellent tear strength and elongation properties.

Siliconerubbersareavailableintwotypes—additioncure formulations that feature a platinum-based catalyst and condensation cure silicones that feature a tin-based catalyst.

Addition Cure Silicone RubberAdditionCureSiliconesOfferTheFollowing:

1.Unlimitedshelflife(incuredstate)2.Verylowshrinkage–forincreasedmoldaccuracy3.Higherdurometers–forgreatermoldstability4.Excellentheatresistance–upto400°Fintermittently5. A platinum based catalyst that makes it ideal for polyurethane

casting because this material, when cured, won’t inhibit the curing of the urethane.

Condensation Cure Silicone RubberCondensationCureSiliconesOfferTheFollowing:

1.Lowshrinkage,thoughnotaslowasplatinum-catalyzedrubber2.Softercuredhardness(lowerdurometer)thanadditioncure

materials, making them ideal for molds with deep undercuts.3.Heatresistanceupto350°Fintermittently.4. A tin based catalyst that creates a more inhibition resistant

material. However, these rubbers, when cured, may inhibit the curing of urethanes when poured into them.

Addition Cure Silicone Rubber Specifications

Hardness (Shore A)

Mixed Viscosity

(cps) Mix Ratio (by wt.)

Gel Time (Min)

@ 72° F

Demold Time (hours) @ 72° F

Elongation (%)

Tear Strength

(ppi) ColorSpecific Gravity

Volumetric Yield (cu.in./lb.)

V-240 60 100,000 10:1 150 16 160 74 Gray 1.23 22.5V-243* 60 100,000 10:1 300 16 – – Beige 1.24 22.3V-330 (w/ CA35) 25 10,000 10:1 100 16 510 180 Blue 1.30 21.3V-330 (w/ CA45) 33 10,000 10:1 100 16 500 170 Blue 1.30 21.3V-340 (w/ CA35) 40 25,000 10:1 100 16 500 180 Blue 1.33 21.0V-340 (w/ CA45) 45 25,000 10:1 100 16 400 150 Blue 1.33 21.0V-340 (w/ CA55) 55 25,000 10:1 100 16 340 75 Gray 1.33 21.0V-3040 39 40,000 10:1 120 16 350 135 Clear 1.08 25.6RTV-3460 60 85,000 10:1 90 16 230 140 Gray 1.20 23.1

*Heat Cure Required 3-4 hours @ 300 degrees F.

Condensation Cure Silicone Rubber Specifications

Hardness (Shore A)

Mixed Viscosity

(cps) Mix Ratio (by wt.)

Gel Time (Min) @

72° F

Demold Time (hours) @

72° FElongation

(%)

Tear Strength

(ppi) ColorSpecific Gravity

Volumetric Yield (cu.in./lb.)

GP-25/Hi-Pro Green 25 50,000 10:1 210 16 380 150 Green 1.20 23.1GP-25/Hi-Pro Blue 25 50,000 10:1 90 6 370 115 Blue 1.16 23.9V-1062/Hi-Pro Green 14 35,000 10:1 270 16 520 120 Green 1.10 25.2V-1062/Hi-Pro Blue 15 32,000 10:1 90 6 500 110 Blue 1.11 24.9V-1065/Hi-Pro Green 25 45,000 10:1 180 16 440 120 Green 1.11 24.9V-1065/Hi-Pro Blue 30 43,000 10:1 120 6 430 100 Blue 1.11 24.9V-1067/1067B 40 50,000 100:2.5 240-300 16 300 50 Blue 1.12 24.7V-1067/Hi-Pro Blue 37 50,000 10:1 60 6-8 250 40 Blue 1.12 24.7V-1068/Hi-Pro Clear 14 25,000 10:1 240 16 450 115 Translucent 1.10 25.2V-1082/Hi-Pro Clear 10 35,000 10:1 210 16 550 120 Translucent 1.10 25.1RTV-3625/Hi-Pro Green 25 20,000 10:1 240 16 450 120 Green 1.10 25.2RTV-3625/Hi-Pro Blue 27 20,000 10:1 30 4 390 120 Blue 1.10 25.2



Bluestar Addition Cure Silicone Rubbers

V-240 Silicone Rubber•60AShoreHardness•100,000cpsViscosity•74ppiTearStrength

BluestarV-240isanextremelydurableandaccuratesilicone rubber that features a high platinum content, which offers excellent resistancetocureinhibition.Usedinrapidprototyping,especiallyinthe simulation of injection-molded plastic parts.Catalog Number Description Availability

Net Wt. (Lbs.)

054834 V-240 5 kg Unit 11054846KG V-240 - Base Only 20 kg 44.1054847KG V-240 - Catalyst Only 2 kg 4.4054819KG V-240 - Base Only 200 kg 440.9054820KG V-240 - Catalyst Only 20 kg 44.1

V-243 Heat Cure Silicone Rubber•60AShoreHardness•100,000cpsViscosity

BluestarV-243isatwocomponent,highstrength,siliconesystemthatrequiresaheatcuretoobtainoptimumproperties.Longworklife,high strength properties, and its ability to accept high levels of silicone diluent fluid make it an excellent choice for transfer print pad and roll applications.Catalog Number Description Availability

Net Wt. (Lbs.)

054922KG V-243 - Base Only 20 kg 44.1054923KG V-243 - Catalyst Only 2 kg 4.4

V-330 Silicone Rubber•25Aor30AShoreHardness•10,000cpsViscosity•180ppi(CA35)or170ppi(CA45)TearStrength

BluestarV-330isasiliconethatofferstheflexibility of two different cured hardnesses dependingonthecatalystused.V-330/CA-35curestoa25AShorehardnesswhileV-330/CA-45resultsinaslightly harder compound of 33A. Both systems have high tear strength and offer the lowest viscosity in our platinum mold making line.Catalog Number Description Availability

Net Wt.(Lbs.)

054809 V-330/CA-45 1 kg Unit 2.2054810 V-330/CA-35 5 kg Unit 11054808 V-330/CA-45 5 kg Unit 11054805KG V-330 Base Only 20 kg 44.4055218KG CA-35 Catalyst Only 2 kg 4.4055203KG CA-45 Catalyst Only 2 kg 4.4054804KG V-330 Base Only 200 kg 440.9055219KG CA-35 Catalyst Only 20 kg 44.4055206KG CA-45 Catalyst Only 20 kg 44.1

V-340 Silicone Rubber• 40A,45A,or55AShoreHardness•25,000cpsViscosity• 180ppi(CA35),150ppi(CA45),or75ppi(CA55)TearStrength

BluestarV-340isoneofourmostpopularsilicone rubber systems for prototype mold-ingapplications,V-340isaversatilesystemwhich offers the flexibility of three different cured hardnesses depending on the catalyst used. This is a low viscosity silicone which offers high strength and is economically priced.Catalog Number Description UM

Net Wt.(Lbs.)

055209 V-340/CA-45 1 kg Unit 2.2055217 V-340/CA-35 5 kg Unit 11055200 V-340/CA-45 5 kg Unit 11055201 V-340/CA-55 5 kg Unit 11055202KG V-340 Base Only 20 kg 44.1055218KG CA-35 Catalyst Only 2 kg 4.4055203KG CA-45 Catalyst Only 2 kg 4.4055204KG CA-55 Catalyst Only 2 kg 4.4055205KG V-340 Base Only 200 kg 440.9055219KG CA-35 Catalyst Only 20 kg 44.4055206KG CA-45 Catalyst Only 20 kg 44.1055207KG CA-55 Catalyst Only 20 kg 44.1

V-3040 Clear Silicone Rubber• 39AShoreHardness•40,000cpsViscosity•135ppiTearStrength

BluestarV-3040isspecificallyformulatedtomakeclearrubbermolds.V-3040featuresthehigh strength and excellent clarity required in high-end prototyping applications.Catalog Number Description Availability

Net Wt.(Lbs.)

054903 V-3040 1 kg Unit 2.2054823 V-3040 5 kg Unit 11054857KG V-3040 Base Only 20 kg 44.1054858KG V-3040 Catalyst Only 2 kg 4.4054871KG V-3040 Base Only 200 kg 440.9054869KG V-3040 Base Only – Unlined Drum 200 kg 440.9054872KG V-3040 Catalyst Only 20 kg 44.1

RTV-3460 Silicone Rubber• 60AShoreHardness•85,000cpsViscosity•140ppiTearStrength

BluestarRTV3460isdesignedfortheprototypeandarchitectural industries where urethane elastomers and foams are commonly used. MoldsmadefromRTV3460featurehightearstrength, excellent dimen-sional stability in high pressure applications, and improved release characteristics for long mold life.Catalog Number Description Availability

Net Wt.(Lbs.)

054936 RTV 3460 5 kg Unit 11054934KG RTV-3460 Base Only 20 kg 44.1054935KG RTV-3460 Catalyst Only 2 kg 4.4054932KG RTV-3460 Base Only 200 kg 440.9054933KG RTV-3460 Catalyst Only 20 kg 44.1

Mold Making Silicone Rubbers [CONTD.]


1.800.321.851128

Mold Making Silicone Rubbers [CONTD.]

Bluestar Condensation Cure Silicone Rubbers

GP-25 Silicone Rubber•25AShoreHardness•50,000cpsViscosity•150ppior115ppiTearStrength

BluestarGP-25featuresanexcellentmoldlifewhencastingpolyesterorplasterparts.UsedwithHi-ProGreenorHi-ProBluecatalyst.Catalog Number Description Availability

Net Wt.(Lbs.)

054811KG GP-25 Base Only 20 kg 44.1054813KG Hi-Pro Green Catalyst Only 2 kg 4.4054812KG GP-25 Base Only 200 kg 440.9054814KG Hi-Pro Blue Catalyst Only 20 kg 44.1054815KG Hi-Pro Green Catalyst Only 20 kg 44.1

V-1062 Silicone Rubber•14Aor15AShoreHardness•35,000or32,000cpsViscosity•120ppior110ppiTearStrength

BluestarV-1062isahigh-performance,tin-catalyzed,roomtempera-turecuringsilicone.TheV-1062basemaybeusedwiththeHi-ProGreenCatalystataratioof10:1(basetocatalyst)toproducealowshrinkrubberwitha16hourdemoldtime.

TheV-1062basemayalsobeusedwithHi-ProBluecatalyst ataratioof10:1(basetocatalyst).Thisfastercuringsystemisabletobedemoldedin6hours.

Both rubbers are commonly used for production of polyester figurines, giftware casting, and general purpose and production molding applications.Catalog Number Description Availability

Net Wt.(Lbs.)

054836 V-1062/Hi-Pro Green 4 kg Unit 8.8054837KG V-1062 Base Only 20 kg 44.1055213KG Hi-Pro Green Catalyst Only 2 kg 4.4054878KG Hi-Pro Blue Catalyst Only 2 kg 4.4

V-1065 Silicone Rubber•25Aor30AShoreHardness•45,000or43,000cpsViscosity•120ppior100ppiTearStrength

BluestarV-1065isahigh-performance,tin-catalyzed,roomtempera-ture curing silicone. This popular rubber may be used with the Hi-Pro GreenCatalystataratioof10:1(basetocatalyst)toproducealowshrink,25shoreArubberwitha16hourdemoldtime.

TheV-1065basemayalsobeusedwithHi-ProBluecatalyst ataratioof10:1(basetocatalyst).Thisfastercuringsystemisabletobedemoldedin6hours.

Both rubbers are commonly used for production of polyester figurines, giftware casting, and production molding applications.Catalog Number Description Availability

Net Wt.(Lbs.)

055210 V-1065/Hi-Pro Green 1 kg Unit 2.2055211 V-1065/Hi-Pro Green 4 kg Unit 8.8055212KG V-1065 Base Only 20 kg 44.1055213KG Hi-Pro Green Catalyst Only 2 kg 4.4054878KG Hi-Pro Blue Catalyst Only 2 kg 4.4055214KG V-1065 Base Only 200 kg 440.9055215KG Hi-Pro Green Catalyst Only 20 kg 44.1054879KG Hi-Pro Blue Catalyst Only 20 kg 44.1

V-1067 Silicone Rubber•40Aor37AShoreHardness•50,000cpsViscosity•50ppior40ppiTearStrength

BluestarV-1067isahighperformance,tin-catalyzed,roomtempera-turecuringsilicone.ThisrubbermaybeusedwiththeV-1067Bcatalystataratioof100:2.5(basetocatalyst)toproducealowshrink,40ShoreArubberwitha16hourdemold.

TheV-1067basemayalsobeusedwithHi-ProBluecatalystataratioof10:1basetocatalyst.Thisfastercuringsystemisableto bedemoldedwithin6-8hours.Bothsystemsareidealforgeneralmoldmaking applications.Catalog Number Description Availability

Net Wt.(Lbs.)

054883KG V-1067 Base Only 20 kg 44.1054884 V-1067 Catalyst (Blue) Only Pint 1054878KG Hi-Pro Blue Catalyst Only 2 kg 4.4054921KG V-1067 Base Only 200 kg 440.9054919KG V-1067 Catalyst (Blue) Only 6 kg 13.2054879KG Hi-Pro Blue Catalyst Only 20 kg 44.1

V-1068 Special Effects Silicone Rubber•14AShoreHardness•25,000cpsViscosity•115ppiTearStrength

BluestarV-1068isatranslucentsiliconerubberthatmaybeeasilypigmented for making robotic and animatronic skins, prosthetics, and props for theme parks and the film industry.Catalog Number Description Availability

Net Wt.(Lbs.)

054888KG V-1068 Base 20 kg 44.1054889KG Hi-Pro Clear Catalyst Only 2 kg 4.4

V-1082 Special Effects Silicone Rubber•10AShoreHardness•35,000cpsViscosity•120ppiTearStrength

BluestarV-1082isaslightlysofterversionoftheV-1068.Alsotrans-lucent, this product may be easily pigmented for making robotic and animatronic skins, prosthetics, and props for theme parks and the film industry.Catalog Number Description Availability

Net Wt.(Lbs.)

054904KG V-1082 Base Only 20 kg 44.1054889KG Hi-Pro Clear Catalyst Only 2 kg 4.4054906KG V-1082 Base Only 200 kg 440.9054886KG Hi-Pro Clear Catalyst Only 20 kg 44.1

RTV-3625 Silicone Rubber•25Aor27AShoreHardness•20,000cpsViscosity•120ppiTearStrength

BluestarRTV3625isalowviscosity,tin-catalyzed,roomtemperaturecuringsiliconerubber.Itisavailablewithtwocatalysts.Hi-ProGreencatalystwillprovideverylowshrinkwitha16-18hourdemold,whileHi-Pro Blue is able to be demolded in 4 hours with slightly higher shrink. Available in drums only.Catalog Number Description Availability

Net Wt.(Lbs.)

054926KG RTV 3625 Base 200 kg 440.9054879KG Hi-Pro Blue Catalyst Only 20 kg 44.1055215KG Hi-Pro Green Catalyst Only 20 kg 44.1



Silicone Rubbers & Accessories

Bluestar Aerospace & Electronics Silicone Rubbers

V-612 Pratt & Whitney Specification Sealant BluestarV-612isablack,twocomponent,thixotropic,addition cure,aerospacesealant.QualifiedtoPratt&WhitneyspecificationPWA-404-2,thisproductisasealantdesignedasavanepottinganddamping material.Catalog Number Description Availability

Net Wt.(Lbs.)

054895KG V-612 5 KG Kit 5 kg Unit 11

V-622 Pratt & Whitney Specification SealantBluestarV-622isablacktwocomponentaerospacesealantwhichadherestoPratt&WhitneySpecificationPWA407.Thismaterialisdesigned for use as abradable air seals for compressor blades of jet engines.Catalog Number Description Availability

Net Wt.(Lbs.)

054894KG V-622 2.74 kg Unit 6.04

V-695 GE Aircraft Engine Specification SealantBluestarV-695isablacktwocomponentaerospacesealantwhichadherestoGeneralElectricAircraftEngineSpecificationA15F18A1.This material is designed for use as abradable air seals for compres-sor blades of jet engines.Catalog Number Description Availability

Net Wt.(Lbs.)

054893KG V-695 2.74 kg Unit 6.05

V-205 Silicone Electronic CoatingBluestarV-205isaonecomponentadditioncuresiliconerubber compound. This opaque black product is formulated to provide a protective coating for light sensitive transistors and integrated circuits. Features include primerless adhesion to inorganic substrates. Product must be refrigerated when not in use.

CureScheduleforthicksections(25-50ml)is2hoursat230°Fandforthinsections(lessthan20ml)is15-60Minat300°F.Catalog Number Description Availability

Net Wt.(Lbs.)

054838KG V-205 454 Grams 1

V-1022 Electronic Potting SiliconeBluestarV-1022isatwocomponentcondensationcuresilicone rubber specifically designed for potting and encapsulating electronic andelectricalcomponents.NoprimerisrequiredandV-1022bondsto most metals and plastics.Catalog Number Description Availability

Net Wt.(Lbs.)

054821KG V-1022 Base Only 20 kg 44.1054822KG V-1022 Catalyst Only 0.4 kg 0.88

Bluestar Silicone Rubber Accessories

47V-50 Silicone FluidBluestar47V-50(alsoknownasV-50)isanon-reactive,50cps viscosity, silicone fluid that is used to reduce the viscosity of the siliconerubber.Adding47V-50tothe“A”side(base)willalsoreducethehardnessoftherubberbyaslightamount.Maximumusageshould not exceed 10% by weight.Catalog Number Description Availability

Net Wt.(Lbs.)

054924 47V-50 Silicone Liquid Quart 2054832 47V-50 Silicone Liquid Gallon 8054833KG 47V-50 Silicone Liquid 20 kg 44.1054925KG 47V-50 Silicone Liquid 200 kg 441

V-04 Silicone Adhesion PrimerBluestarV-04SiliconePrimerisadilutesolutionofreactivesiliconeresin in naphtha, used to provide adhesion to various metal and wood substrates.Catalog Number Description Availability

Net Wt.(Lbs.)

054816 V-04 Blue Primer Pint 0.75054920KG V-04 Clear Primer 3 kg 6.6

V-06 Silicone Adhesion PrimerBluestarV-06SiliconePrimerisadilutedsolutionofareactivesiliconeresin in naptha used as an adhesion promoter with Bluestar aerospace and industrial grade materials. This primer is qualified to Pratt & Whitneyspec#PWA-556andAlliedSignalspec#PCS-5611TypeX.Catalog Number Description Availability

Net Wt.(Lbs.)

054828KG V-06R Primer Pint 0.75

Vicure #2 CatalystBluestarVicure#2Catalystisafastreactingcatalystusedwith condensation cure silicone rubbers to accelerate cure times. Please consultProductDataSheetbeforeusingthisproduct.Catalog Number Description Availability

Net Wt.(Lbs.)

054829KG #2 Catalyst 110 gm Bottle 0.25

Thixo Additive 22646BluestarThixoAdditive22646,whenaddedtoanycondensation cure and some addition cure silicone rubbers as a third component, changes the viscosity from a pourable consistency to brushable. The use of this additive is perfect for making glove molds. A typical ratio is 100 parts base to 10 parts catalyst to 0.5 parts Thixo Additive. Multiplelayersmaybeappliedtobuildthickness.Catalog Number Description Availability

Net Wt.(Lbs.)

054826KG Thixo Additive 22646 227 grms 0.5054825KG Thixo Additive 22646 20 kg 44.1

PT AcceleratorBluestar PT Accelerator, when added to addition cure silicone rubbers as a third component, can significantly reduce the waiting time required to demold. Ratios of 100 parts base to 10 parts catalyst to2partsPTAcceleratorwillresultina2hourdemoldtime.Catalog Number Description Availability

Net Wt.(Lbs.)

054839KG PT Accelerator 454 grms 1


1.800.321.851130

Epoxy Casting Resins

FreemanandHuntsmanAdvancedMaterialsofferabroad,diverselineof pourable epoxy casting resins for the production of foundry patterns, core boxes, molds, fixtures, and tooling.

Iron-filledepoxycastingresins(blackincolor)areheavy,highlywear-resistant compounds that are suitable for foundry patterns or thin-gauge metal-forming tools. Aluminum-filled epoxy casting resins (grayincolor)arenotasheavy,aremorereadilymachinable,andareavailablewithhighertemperatureresistances.Epoxycastingresinsgenerateheat(exotherm)duringthecuringprocess.Thisheatcan become excessive if the epoxy is poured thicker than the sug-gestedcastingthickness,causingwarping,crackingand/orbrittleness.Therefore, be careful to choose the correct system to pour your part.

Epoxy Casting Resin Specifications

Product Number

Mix Ratio (by wt.) Resin:

Hardener

Mix Ratio (by vol.) Resin:

Hardener

Gel Time (Min)

@ 72°F

Demold Time

(hours) @ 72°F

Hardness (Shore D)

Mixed Viscosity

(cps)Density (g/cc)

Volumetric Yield

(cu. in./lb.)Shrink (in/in)

Compressive Strength

(psi)

Flexural Strength

(psi)

Tensile Strength

(psi)C.T.E.

(in/in/°F)*Deflection Temp. (°F)

Tg(°F)

Aluminum-Filled Epoxy Casting Resins

Freeman 801 100:12 100:23 150 24 86 4,650 1.70 16.3 0.002 12,500 11,590 7,280 3.82 x 10-5 142 –Freeman 805 100:18 100:29 150 24 88 9,750 1.47 18.8 0.001 17,200 9,600 8,100 – 200 –RenCast 3269 100:9 100:18 60 24 87 4,300 1.78 15.6 0.001 14,400 13,000 8,700 3.76 x 10-5 – 171Devcon Aluminum Liquid 100:11 3:1 75 24 85 15-25,000 1.58 17.5 0.001 9,820 3,540 2,700 5.20 x 10-5 250* –

High Temperature Aluminum-Filled Epoxy Casting Resins

RenCast 4036 / Ren 1500

100:6 100:10 60 24 90 20,000 1.69 16.5 0.004 30,000 7,500 6,500 1.90 x 10-5 – 300


100:13 100:22 140 24 91 15,000 1.58 17.6 0.005 25,800 9,300 6,300 2.25 x 10-5 – 350


100:13 100:22 140-165 24 91 12-18,000 1.58 17.6 0.005 25,800 9,300 6,300 2.25 x 10-5 – 350

Iron-Filled Epoxy Casting Resins

Freeman 855 100:10 100:25 150 24 87 13,950 2.23 12.4 0.001 13,400 9,100 6,800 – 230 –RenCast 3209 /Ren 3209-1

100:10 100:25 90 24 75 15,000 2.04 13.5 0.005 16,500 8,400 5,500 2.60 x 10-5 163 160

RenCast 3209 / Ren 3209-2

100:11 100:28 240 24 85 15,000 2.15 12.9 0.006 11,500 8,000 5,000 3.20 x 10-5 120 138

RenCast 3215-1/ Ren 3215-2

100:18 100:35 200 24 88 3,600 1.65 16.9 0.004 11,100 7,300 4,900 3.80 x 10-5 132 154

RenCast 3253 100:5 100:16 30 24 90 7,500 2.99 9.3 0.002 15,200 8,500 7,100 3.26 x 10-5 120 169RenCast 3261 100:5 100:16 25 24 88 35,000 2.94 9.4 0.003 16,500 8,500 6,000 3.00 x 10-5 138 180Steel-Filled Epoxy Casting ResinDevcon Plastic Steel Liquid 100:11 3:1 45 24 85 15-25,000 2.11 13.1 0.001 10,200 7,480 4,900 3.80 x 10-5 250* –

ASTM – – D-2471 – D-2240 D-2393 D-792 D-792 D-2566 D-695 D-790 D-638 D-696 D-648 D-648

*Maximum operating temperature



Epoxy Casting Resins [CONTD.]

Aluminum-Filled Room Temperature Resins

Freeman 801•Castableto3"inThickness•150MinGelTime•86DShoreHardness

This product is an economical alumi-num-filled epoxy casting resin that is excellent for making wear resistant core boxes, patterns, and tooling fixtures.Lowshrinkage,longgeltime,andlowerexotherm,enablesthis material to be poured to 3" in thickness.


055626Q Freeman 801 Resin Only Quart 2.65055627Q Freeman 801 Hardener Only Pint 0.32055626 Freeman 801 Resin Only 6 Quarts 15.9055627 Freeman 801 Hardener Only 6 Pints 1.92055630 Freeman 801 Resin Only 5 Gallon 60055631 Freeman 801 Hardener Only Gallon 7.2

Freeman 805 •Castableto½" in Thickness•150MinGelTime•88DShoreHardness

Freeman 805 is also an aluminum-filled epoxy casting resin that is similar in wear characteristics to the 801, but is designed for smaller jobs where the maximum casting thickness is only ½". This product also works very well for the construction of foundry tooling.Catalog Number Description Availability

Net Wt.(Lbs.)

055812 Freeman 805 Resin Only Quart 2055813 Freeman 805 Hardener Only ½ Pint 0.36055809 Freeman 805 Resin Only 6 Quarts 12055810 Freeman 805 Hardener Only 6 – ½ Pints 2.17055807 Freeman 805 Resin Only 5 Gallons 45055808 Freeman 805 Hardener Only Gallon 8.1

RenCast 3269 •Castableto¾" in Thickness•60MinGelTime•87DShoreHardness

This aluminum-filled epoxy features a slightly lower viscosity than the Freeman 801 and 805 for ease of pouring. Castable to ¾", RenCast 3269isalsodesignedforsmaller tooling projects that require good durability and wear resistance.Catalog Number Description Availability

Net Wt.(lbs.)

056116 RenCast 3269 Resin Only 5 Gallon 60056117 Ren 3269 Hardener Only Gallon 5.5

Devcon Plastic Aluminum•Castableto¾" in Thickness•75MinGelTime•85DShoreHardness

This aluminum-filled epoxy is ideal for producing low-cost molds for plastic and rubber parts or applications requiring high strength athighertemperatures.Alsoavailableinputtyform.Seepage58 for details.Catalog Number Description Mfg. No.

Net Wt.(lbs.)

054600 Devcon Plastic Aluminum Liquid F2-1 1054605 Devcon Plastic Aluminum Liquid F2-3 3

Aluminum-Filled High Temperature Resins

RenCast 4036/Ren 1500 •Castableto1"inThickness•60MinGelTime•90DShoreHardness

This product is an aluminum-filled casting resin formulated for con-structing hard and durable molds that will be subjected to elevated temperaturesupto300°F.Withamaximumcastingthicknessof1",4036isexcellentformakingsmallervacuumformtools,prototypeinjection molds, and other tooling requiring a high temperature resin.Catalog Number Description Availability

Net Wt.(Lbs.)

056161 RenCast 4036 Resin Only 5 Gallon 65056020 Ren 1500 Hardener Only Gallon 4

RenCast 4036/Ren 1511 •Castableto4"inThickness•140MinGelTime•91DShoreHardness

RenCast4036/Ren1511isalowerexothermformulationofthe4036/1500,enablingthisproducttobepouredtoamaximum thickness of 4" for larger high temperature tooling.Catalog Number Description Availability

Net Wt.

056166Q RenCast 4036 Resin Only Quart 3.12056167Q Ren 1500 Hardener Only Quart 0.24056166 RenCast 4036 Resin Only 6 Quarts 18.72056167 Ren 1500 Hardener Only 6 Quarts 1.44056161 RenCast 4036 Resin Only 5 Gallon 65056160 Ren 1511 Hardener Only 2 Gallon 8.4

RenCast 4037 Cast-IT™ System•Castableto4"inThickness•140-165MinGelTime•91DShoreHardness

This economical, high temperature, aluminum-filled epoxy is excellent for constructing larger vacuum form tools, prototype injection molds, compressionmolds,andotherhightemperaturetooling.Maximumcontinuoustemperaturesof300°Fandcastableto4"inthicknessmakes this a very versatile resin system.

ImportantNote:Theamountofresinandhardenercontainedinthispackagesizeisapproximately2.5gallonstotal.Themanufacturerlimits the liquid volume and uses a 5 gallon pail so there is adequate space for the addition of aluminum fillers.Catalog Number Description Availability

Net Wt.(Lbs.)

056162 RenCast 4037 Resin Only 5 Gallon 33056163 Ren 4037 Hardener Only Gallon 4.4


1.800.321.851132

Iron-Filled Casting Resins

Freeman 855 •Castableto½" in Thickness•150MinGelTime•87DShoreHardness

This iron-filled epoxy tooling resin features higher abrasion resistance than our aluminum-filled epoxies. Freeman 855 is used in foundry patterns, corebox construction, and some metal forming applications.Catalog Number Description Availability

Net Wt.

055857 Freeman 855 Casting Resin Only 5 Gallon 45055858 Freeman 855 Casting Hardener Only Gallon 4.5

RenCast 3209•Castableto2"or6"inThickness•90or240MinGelTime•75or85DShoreHardness

RenCast3209-1ResinwithRen3209-1Hardenerisaniron-filledcastingresinthatisabletobepouredtoamaximumthicknessof2".Features include high impact strength, 90 minute gel time, and low shrink. The material is excellent for stretch press forms, foundry patterns, and molds.

RenCast3209-1ResinwithRen3209-2Hardenerisaslowercuringversionofthe3209-1/3209-1.Thismaterialmaybecastupto6"inthickness.Thisproductalsofeaturesgoodimpactstrengthandwear resistance for light gage metal forming and foundry patterns.Catalog Number Description Availability

Net Wt.(Lbs.)

056059Q RenCast 3209-1 Resin Only Quart 3.71056061Q Ren 3209-1 Hardener Only Quart 0.40056059 RenCast 3209-1 Resin Only 6 Quarts 22.24056061 Ren 3209-1 Hardener Only 6 Quarts 2.40056062 RenCast 3209-1 Resin Only 5 Gallon 39056063 Ren 3209-1 Hardener Only Gallon 3.9056068 Ren 3209-2 Hardener Only Gallon 4.29

RenCast 3215•Castableto6"inThickness•200MinGelTime•88DShoreHardness

RenCast3215-1ResinwithRen3215-2Hardenerisaniron-filledcastingresinthatisabletobepouredtoamaximumthicknessof6".Averylong200minutegeltimepermitscastingverylargeparts. Thin sections may require a 48 hour demold time.Catalog Number Description Availability

Net Wt.(Lbs.)

056072 RenCast 3215-1 Resin Only 5 Gallons 60056078 Ren 3215-2 Hardener Only 2 Gallons 10.81

Epoxy Casting Resins [CONTD.]

RenCast 3253•Castableto¾" in Thickness•30MinGelTime•90DShoreHardness

A very tough material with excellent abrasion resistance. Ideal for dies, core boxes, foundry patterns, hammer forms, and fixtures.Catalog Number Description Availability

Net Wt.(Lbs.)

056087 RenCast 3253 Resin Only 5 Gallon 60056088 Ren 3253 Hardener Only Gallon 3

RenCast 3261•Castableto½" in Thickness•25MinGelTime•88DShoreHardness

A dual purpose material which may be used as a casting resin or a surface coat, this resin offers fine surface detail and impact resistance and is well suited for patterns, hammer form dies, core boxes and housing fixtures.Catalog Number Description Availability

Net Wt.(Lbs.)

056092Q RenCast 3261 Resin Only Quart 4.99056098Q Ren 3261 Hardener Only Quart 0.28056092 RenCast 3261 Resin Only 6 Quarts 29.94056098 Ren 3261 Hardener Only 6 Quarts 1.68

Steel-Filled Casting Resin

Devcon Plastic Steel•Castableto¾" in Thickness•45MinGelTime•85DShoreHardness

Contains80%steel,20%epoxyresinsandmodifiers.Thisdarkgrayproduct is very machinable with a high impact strength and an excel-lent resistance to chemicals and solvents. Also available in putty form. Seepage58fordetails.Catalog Number Description Mfg. No.

Net Wt.(Lbs.)

054570 Devcon B-1 Liquid-Type Plastic Steel 1 Lb 10210 1054575 Devcon B-4 Liquid-Type Plastic Steel 4 Lb 10220 4054580 Devcon B-25 Liquid-Type Plastic Steel 25 Lb 10230 25

SEE ALSO: Product Page No.Tooling Plastics Fillers 48-49Mixing Cups, Paddles and Shop Rags 109Gloves and Protective Wear 108Pattern Coatings (Primers, Paints & Sealers) 102-103Mold Releases 104-107



Epoxy Laminating ResinsEpoxy Laminating Resin Specifications

ProductNumber

Mix Ratio(by wt.)Resin:

Hardener

Mix Ratio(by vol.)Resin:

Hardener

GelTime(Min)

@ 72°F

DemoldTime

(hours)@ 72°F

Hardness(Shore D)

MixedViscosity

(cps) Density(g/cc)

VolumetricYield

(cu. in./lb.)

CompressiveStrength

(psi)

FlexuralStrength

(psi)

FlexuralModulus

(psi)

TensileStrength

(psi)C.T.E.

(in/in/°F)

DeflectionTemp. (°F)

Tg(°F)

Room Temperature Laminating ResinsFreeman 601 100:10 100:14 28 24 88 3,000 1.39 19.9 39,900 34,600 – 25,000 – 128 –Freeman 605 - 15 100:16 100:20 20 24 82 2,850 1.30 21.3 40,000 33,500 1.8 x 106 25,300 – 188 –Freeman 605 - 45 100:20 100:26 37 24 86 2,800 1.28 21.6 40,000 33,500 1.8 x 106 25,300 – 188 –Freeman 690 100:33 100:37 90 24 85 1,445 1.10 25.0 26,500 39,900 1.3 x 106 35,500 – 180 –Miapoxy 100/95 100:24 100:25 38 24 90 800 1.13 24.5 26,000 39,000 – 36,000 0.93 x 10-5 128 –Miapoxy 100/97 100:26 100:25 20 24 90 1,120 1.13 24.5 28,000 37,000 – 26,000 1.0 x 10-5 128 –RenLam 1700-1/ Ren 1700-1 100:26 100:28 20 24 90 2,000 1.13 24.5 28,100 37,000 1.5 x 106 26,000 1.00 x 10-5 128 –

RenLam 1700-1/ Ren 956 100:23 100:25 36 24 89 2,000 1.13 24.5 24,700 40,700 1.7 x 106 34,900 0.97 x 10-5 129 –

RenLam 1710/ Ren 1710 100:16 100:23 22 24 90 3,500 1.35 20.5 23,000 30,000 1.8 x 106 25,000 1.20 x 10-5 129 –

RenLam 1710/ Ren 956 100:16 100:23 35 24 89 2,000 1.35 20.5 26,900 32,900 1.5 x 106 25,000 0.81 x 10-5 – –

RenLam 1720/ Ren 956 100:15 100:21 40 24 90 3,200 1.34 20.5 – 36,000 1.6 x 106 – 1.02 x 10-5 – 164

RenLam 177-114/ Ren 956 100:24 – 38 24 90 800 1.15 24.1 26,000 39,000 – 36,000 0.93 x 10-5 – 273

High Temperature Laminating ResinsFreeman 917 100:10 100:13 52 24 92 4,000 1.46 19.0 24,500 30,574 1.6 x 106 23,000 2.56 x 10-5 – 301RenLam 1310/ Ren 1510 100:15 – 400 24 91 9,000 1.22 22.7 43,000 82,000 5.7 x 106 77,000 – – 412

RenLam 4005/ Ren 1500 100:14 100:15 50 24 90 1,900 1.19 23.3 28,000 35,000 1.6 x 106 26,000 0.85 x 10-5 289 338

RenLam 4014/ Ren 1500 100:11 100:14 55 24 90 4,000 1.34 20.8 28,000 34,000 1.7 x 106 24,000 1.41 x 10-5 – 333

RenLam 4017/ Ren 1510 100:15 100:18 90 24 93 8,000 1.42 19.6 44,000 77,000 – 80,000 3.4 x 10-6 – 385

RenLam 5052 100:38 100:47 7 hrs. 24 – 500 1.17 20.2 – 19,580 4.5 x 106 8,700 – – 273ASTM – – D-2471 – D-2240 D-2393 D-792 D-792 D-695 D-790 D-790 D-638 D-696 D-648 D-648

Room Temperature Laminating Resins

Freeman 601 – White•Economical,GeneralPurpose•28MinGelTime•88DShoreHardness

This economical epoxy laminating resin is used for large composite toolingandmoldconstructionandcheckfixtures.Freeman601iswhiteincolorandisdesignedtobeusedwithFreeman701SurfaceCoat.Catalog Number Description Availability

Net Wt.(Lbs.)

055621 Freeman 601 Resin Only 5 Gallon 45055622 Freeman 601 Hardener Only Gallon 4.5055623 Freeman 601 Resin Only 55 Gallon 400055624 Freeman 601 Hardener Only 5 Gallon 40

Freeman 605 – White•GeneralPurpose&

Plastic Faced Plaster•20MinGelTime (605-15)

•37MinGelTime (605-45)

•82DShoreHardnessThis epoxy laminating resin is used for general composite tooling and moldconstruction.Freeman605iswhiteincolor,featuresavariablegeltime(dependingonthehardenerused)andisdesignedtobeusedwithFreeman705andFreeman706surfacecoats.Catalog Number Description Availability

Net Wt.(Lbs.)

055612 Freeman 605 Resin Only Quart 2055606 Freeman 605-15 Hardener Only ½ Pint 0.32055613 Freeman 605-45 Hardener Only ½ Pint 0.4055609 Freeman 605 Laminating Resin Only 6 Quarts 12055605 Freeman 605-15 Hardener Only 6 – ½ Pints 1.93055610 Freeman 605-45 Hardener Only 6 – ½ Pints 2.4055607 Freeman 605 Laminating Resin Only 5 Gallon 45055608 Freeman 605-45 Hardener Only 2 – 1 Gallons 9055614 Freeman 605 Laminating Resin Only 55 Gallon 450055615 Freeman 605-45 Hardener Only 2 – 5 Gallons 45


1.800.321.851134

Epoxy Laminating Resins [CONTD.]

Freeman 690 – Translucent•ClearEpoxyLaminatingResin•90MinGelTime•85DShoreHardness

Freeman690featuresalonggeltimeforconstructionoflargelami-nated molds and finished parts. This product is clear, making it easy to identify any air entrapment. It is low in viscosity for easy cloth wet out.Catalog Number Description Availability

Net Wt.(Lbs.)

055015 Freeman 690 Resin Only 5 Gallon 45055016 Freeman 690 Hardener Only 2 – 1 Gallons 14.85

Miapoxy 100 – Translucent•ClearEpoxyLaminatingResin•38MinGelTime(Mia95)•20MinGelTime(Mia97)•90DShoreHardness

Miapoxy100isaclear,twocomponentepoxy laminating system specifically designed for producing strong and accurate fiberglass laminates or repairs. Thisproductfeaturestwohardeners:Mia95,forlonger38minuteworkingtimeforlargerparts,andMia97,forsmallerpartsorrepairswitha20minuteworkingtime.Thisproductisavailablewithconvenientproportioningpumps(pg.99)forquick,accurate, and trouble-free metering of the correct amount of resin and hardener.Catalog Number Description Availability

Net Wt.(Lbs.)

405665 Miapoxy 100 Resin Only Quart 2405615 Mia 95 Hardener Only Pint 0.5405630 Mia 97 Hardener Only Pint 0.5405660 Miapoxy 100 Resin Only Gallon 8405620 Mia 95 Hardener Only Quart 2405635 Mia 97 Hardener Only Quart 2.1405650 Miapoxy 100 Resin Only 5 Gallon 32405610 Mia 95 Hardener Only Gallon 8405625 Mia 97 Hardener Only Gallon 8405655 Miapoxy 100 Resin Only 55 Gallon 450405605 Mia 95 Hardener Only 5 Gallon 40405624 Mia 97 Hardener Only 5 Gallon 40

RenLam 177-114 – Amber•UnfilledLaminatingSystem•38MinGelTime•90DShoreHardness

RenLam177-114isanunfilledambercoloredlaminatingresin.Verylow viscosity and a 38 minute gel time makes this an excellent resin for constructing large fiberglass tools and parts.Catalog Number Description Availability

Net Wt.(Lbs.)

056212 RenLam 177-114 Resin Only 55 Gallon 450056202 Ren 956 Hardener Only 55 Gallon 450

RenLam 1700-1 – Translucent•UnfilledLaminatingSystem•PopularAdhesiveforLumberandRenShape

•20MinGelTime•90DShoreHardness

This unfilled, general purpose laminat-ing system features excellent moisture and chemical resistance. Also used for adhesive applications and rec-ommendedforbondingwoodandRen-Shape.RenLam1700-1ResincanalsobeusedwithRen956Hardenerforextendedworkingtime.Catalog Number Description Availability

Net Wt.(Lbs.)

056042Q RenLam 1700-1 Resin Only 1 Quart Quart 1.63056044Q Ren 1700-1 Hardener Only 1 Pint Pint 0.47056042 RenLam 1700-1 Resin Only 6 Quart 6 Quarts 9.79056044 Ren 1700-1 Hardener Only 6 Pint 6 Pints 2.82056045 RenLam 1700-1 Resin Only 5 Gallon 5 Gallon 42056046 Ren 1700-1 2 Gallon Hardener Only 2 – 1 Gallons 10.92056043 RenLam 1700-1 55 Gallon Resin Only 55 Gallon 480056048 Ren 1700-1 5 Gallon Hardener Only 5 Gallon 31.2056192 Ren 956 5 Gal Hardener Only 5 Gallon 40

RenLam 1710 – White•GeneralPurpose•22MinGelTime•90DShoreHardness

This laminating system features low odor, excellent wetting qualities, room-temperature cure and works very well on vertical surfaces. RenLam1710ResincanalsobeusedwithRen956Hardenerforextended working time.Catalog Number Description Availability

Net Wt.(Lbs.)

056047Q RenLam 1710 Resin Only Quart 2056058Q Ren 1710 Hardener Only Quart 0.35056047 RenLam 1710 Resin Only 6 Quarts 12056058 Ren 1710 Hardener Only 6 Quarts 2.08056050 RenLam 1710 Resin Only 5 Gallon 38056051 Ren 1710 Hardener Only Gallon 6.08056334 RenLam 1710 Resin Only 55 Gallon 500056192 Ren 956 Hardener Only 5 Gallon 40

RenLam 1720 – White•DimensionallyStable•40MinGelTime•90DShoreHardness

RenLam1720resinwithRen956hardenerisawhite,roomtempera-ture curing laminating resin system. This material is ideal for a variety of room temperature applications where a stable fiberglass laminate is required. This product features a 40 minute gel time for larger tooling. It is approved and commonly used in the automotive and aircraft industry for close tolerance tools.Catalog Number Description Availability

Net Wt.(Lbs.)

056052 RenLam 1720 Resin Only 5 Gallon 45056192 Ren 956 Hardener Only Gallon 40



High Temperature Laminating Resins

Freeman 917 – Gray•Economical•52MinGelTime•92DShoreHardness

This aluminum-filled laminating resin is used in large elevated temperaturefixtures&tooling.Freeman917isdesignedtowork withFreeman945SurfaceCoat.Catalog Number Description Availability

Net Wt.(Lbs.)

055976 Freeman 917 Resin Only 5 Gallon 45055977 Freeman 917 Hardener Only Gallon 4.5

RenLam 1310 / Ren 1510 – Black•UltraHighTemperature•400MinGelTime•91DShoreHardness

RenLam1310Resin/Ren1510Hardenerisahightemperatureepoxylaminatingresinthatfeaturesa412°FTg.Thismaterialisidealforlaminatedtoolingrequiring350°Ftemperatureresistancewithextendedservicelife.Caution:Thisproductwillproducehighexothermandgiveoffacridsmokeiflefttocureinthickermasses.Leftovermixed resin and hardener should be spread out in a thin layer to cure.Catalog Number Description Availability

Net Wt.(Lbs.)

056181 RenLam 1310 Resin Only 5 Gallon 45056040 Ren 1510 Hardener Only Gallon 6.75

RenLam 4005 / Ren 1500 – Amber•Unfilled,HighTemperatureSystem•50MinGelTime•90DShoreHardness

This laminating system is an unfilled, heat-resistant epoxy suitable for continu-oustemperatureof300°F.Thismaterial is an excellent adhesive for bonding high-temperature tooling boards.Catalog Number Description Availability

Net Wt.(Lbs.)

056132Q RenLam 4005 Resin Only Quart 2056133Q Ren 1500 Hardener Only Pint 0.3056132 RenLam 4005 Resin Only 6 Quarts 12056133 Ren 1500 Hardener Only 6 Pints 1.8056136 RenLam 4005 Resin Only 5 Gallon 43056039 Ren 1500 Hardener Only Gallon 6056137 RenLam 4005 Resin Only 55 Gallon 500056038 Ren 1500 Hardener Only 5 Gallon 40

Epoxy Laminating Resins [CONTD.]

RenLam 4014 / Ren 1500 – Gray•Aluminum-Filled,HighTemperatureSystem

•55MinGelTime•90DShoreHardness

This laminating system is an aluminum- filled, general-purpose product used for toolingupto300°F.Idealforvacuum-forming,foammolds,andRIMmolds.Catalog Number Description Availability

Net Wt.(Lbs.)

056141 RenLam 4014 Resin Only 5 Gallon 54.5056039 Ren 1500 Hardener Only Gallon 6056142 RenLam 4014 Resin Only 55 Gallon 550056038 Ren 1500 Hardener Only 5 Gallon 40

RenLam 4017 / Ren 1510 – Black•HighTemperatureSystem•90MinGelTime•93DShoreHardness

This laminating system features an extended gel time and good cloth wet-out for construction of large, high temperature tools which mayoperateattemperaturesupto350°F.Allowsenoughtimeforvacuum bagging when required and is ideal for bonding fixtures, prepreg lay-up molds, and vacuum-form molds. Catalog Number Description Availability

Net Wt.(Lbs.)

056146 RenLam 4017 Resin Only 5 Gallon 45056040 Ren 1510 Hardener Only Gallon 6.75

RenLam 5052 – Translucent •UnfilledLaminatingSystem•7HourGelTime

RenLam5052hasa7hourgeltimeforlargetoolandpartconstruc-tion.Designedforwetlayup,RTM,pressuremolding,andfilamentwinding, this system will cure at room temperature and may also be postcured at elevated temperatures for higher mechanical properties.Catalog Number Description Availability

Net Wt.(Lbs.)

056283 RenLam 5052 Resin Only 5 Gallon 37056284 Ren 5052 Hardener Only 2 – 1 Gallons 14


1.800.321.851136

Epoxy Surface Coats

Epoxy Surface Coat Specifications

ProductNumberRoom Temperature Surface Coats

Freeman 701 100:8 100:13 15 24 87 Thixotropic 1.5 18.7 – 13,200 10,800 – 6,100 – 127 –Freeman 705 - 15 100:14 100:20 15 24 90 18,300 1.4 19.6 – 16,800 7,000 0.76 x 106 5,100 – 250 –Freeman 705 - 45 100:14 100:20 45 24 90 18,300 1.4 19.6 – 16,800 7,000 0.76 x 106 5,100 – 250 –Freeman 706 100:14 100:20 45 24 90 15,000 1.3 21.0 – 16,800 7,000 0.76 x 106 5,100 – 250 –RenGel 1118 100:9 100:13 30 24 90 Paste 1.5 19.0 0.002 13,400 6,500 – 3,500 2.56 x 10-5 235 169RenGel 1124 100:18 100:27 25 24 90 Paste 1.4 19.0 0.002 14,500 10,000 – 6,200 2.86 x 10-5 127 149RenGel 1126 100:18 100:25 24 24 90 Paste 1.4 19.7 0.002 12,000 6,800 – 4,700 2.6 x 10-5 127 165RenGel 1129 100:20 100:26 20 24 85 Paste 1.4 19.9 0.002 13,800 15,500 0.49 x 106 4,900 3.16 x 10-5 117 156RenGel 3260 100:9 100:16 33 24 88 30,000 1.9 14.6 0.002 17,000 9,600 1.4 x 106 6,500 2.10 x 10-5 138 181

High Temperature Surface Coats

Freeman 935 - 15 100:11 100:18 28 24 88 27,500 1.6 17.7 – 26,500 7,900 1.3 x 106 4,000 2.3 x 10-5 370 –Freeman 935 - 30 100:11 100:18 43 24 90 29,500 1.6 17.3 – 26,500 7,950 1.3 x 106 4,000 2.3 x 10-5 370 –Freeman 935 - 90 100:11 100:18 90 24 88 25,350 1.6 17.4 – 26,500 7,950 1.3 x 106 4,000 2.3 x 10-5 370 –Freeman 945 100:10 100:14 50 24 90 Thixotropic 1.4 19.9 – 25,000 8,000 – 5,000 3.7 x 10-5 310 –RenGel 4026 / Ren 1500

100:10 100:14 50-60 24 90 Paste 1.4 19.5 – 27,000 8,500 – 5,500 3.7 x 10-5 – 310

RenGel 4026 / Ren 1501

100:10 100:14 30-40 24 90 Paste 1.4 19.5 – 27,000 8,000 – 4,000 3.2 x 10-5 – 310

RenGel 4026 / Ren 1510

100:10 100:14 120-150 24 90 Paste 1.4 19.5 – 26,000 8,700 – 6,000 3.8 x 10-5 – 335

RenGel 177-144 / Ren 1500

100:10 100:15 60 24 92 Paste 1.6 17.8 0.002 28,000 12,500 0.7 x 106 7,000 2.4 x10-5 – 284

ASTM – – D-2471 – D-2240 D-2393 D-792 D-792 D-2566 D-695 D-790 D-790 D-638 D-696 D-648 D-648

These epoxy surface coats by Freeman and Huntsman AdvancedMaterialsareidealforcreatingsuperiortoolsurfaceson general purpose laminated tools as well as more demanding abrasion-resistant or heat-resistant laminated tools.

Almost Tack-Free – Testing A Surface CoatThe surface coat should dent, but leave no deposit on the finger. Atthisstagethenextcoatisapplied;surfacecoat(2ndapplica-tion),couplingcoat,orlaminateasrequired.

Tacky

Wrong

Tack-Free

Right

Hard

Wrong

C.T.

E. (i

n/in

/°F)

Defle

ctio

n

Tem

p. (°

F)

Tens

ile

Stre

ngth

(psi

)

Flex

ural

M

odul

us (p

si)

Tg (°

F)

Flex

ural

S

treng

th (p

si)

Com

pres

sive

S

treng

th (p

si

Shrin

k (in

/in)

Volu

met

ric

Yie

ld (c

u. in

./lb.

)

Dens

ity (g

/cc)

Mix

ed V

isco

sity

(

cps)

Hard

ness

(

Shor

e D)

Dem

old

Tim

e

(ho

urs)

@ 7

2°F

Gel T

ime

(min

.)

@ 7

2°F

Mix

Rat

io (b

y vo

l.)

Res

in: H

arde

ner

Mix

Rat

io (b

y wt

.)

Res

in: H

arde

ner



Room Temperature Resins

Freeman 701– White•Economical,GeneralPurpose•15MinGelTime

This economical epoxy surface coat is used for constructing larger laminated tools, fixtures, and molds where a general purpose product willmeetthenecessarytoolingrequirements.The701isathick viscosity material that will not sag on vertical walls. Catalog Number Description Availability

Net Wt.(Lbs.)


Freeman 705 – White•GeneralPurpose&Plastic

Faced Plaster•15MinGelTime(705-15)•45MinGelTime(705-45)

Freeman705isadurableandtoughepoxy surface coat for making a wide variety of composite tooling. Because this product will cure in the presence of moisture, it is ideal for constructing plastic-face plaster tools.Otherfeaturesincludetwohardenersenablingtheselectionofthe proper working time for smaller of larger parts. Catalog Number Description Availability

Net Wt.(Lbs.)

055712 Freeman 705 Resin Only Quart 2055706 Freeman 705-15 Hardener Only ½ Pint 0.28055713 Freeman 705-45 Hardener Only ½ Pint 0.28055709 Freeman 705 Resin Only 6 Quarts 12055705 Freeman 705-15 Hardener Only 6 – ½ Pints 1.69055710 Freeman 705-45 Hardener Only 6 – ½ Pints 1.69055707 Freeman 705 Resin Only 5 Gallon 45055704 Freeman 705-15 Hardener Only Gallon 6.3055708 Freeman 705-45 Hardener Only Gallon 6.3

Freeman 706 – Blue•GeneralPurpose&PlasticFacedPlaster•45MinGelTime

Freeman706isverysimilarintoourFreeman705exceptthatit has a powder blue color. This epoxy surface coat also cures in the presence of moisture for making plastic-faced plasters Catalog Number Description Availability

Net Wt.(Lbs.)

055714 Freeman 706 Resin Only Quart 2055715 Freeman 706-45 Hardener Only ½ Pint 0.28055703 Freeman 706 Resin Only 6 Quarts 12055716 Freeman 706-45 Hardener Only 6 – ½ Pints 1.69055717 Freeman 706 Resin Only 5 Gallon 45055718 Freeman 706-45 Hardener Only Gallon 6.3

RenGel 1118 – Blue•GeneralPurpose&PlasticFacedPlaster•30MinGelTime

This epoxy surface coat will cure in the presence of moisture and is specificallydesignedforcreatingplastic-facedplastertooling.RenGel1118 is a thick viscosity that will not sag on vertical walls. Catalog Number Description Availability

Net Wt.(Lbs.)

056011Q RenGel 1118 Resin Only Quart 2.63056013Q Ren 1118 Hardener Only Quart 0.23056011 RenGel 1118 Resin Only 6 Quarts 15.75056013 Ren 1118 Hardener Only 6 Quarts 1.53056016 RenGel 1118 Resin Only 5 Gallon 40056017 Ren 1118 Hardener Only Gallon 3.6

Epoxy Surface Coats [CONTD.]

RenGel 1124 – White•GeneralPurpose•25MinGelTime

This durable epoxy surface coat system has a green color indicator added to the resin that changes to amber when the product is com-pletelymixed.RenGel1124isalsoformulatedsomultipleapplicationsof successive layers aggressively bond to themselves, even if the underlying layer is fully cured.Catalog Number Description Availability

Net Wt.(Lbs.)

056040Q RenGel 1124 Resin Only Quart 2.81056042Q Ren 1124 Hardener Only Quart 0.51056040 RenGel 1124 Resin Only 6 Quarts 16.86056042 Ren 1124 Hardener Only 6 Quarts 3.06056343 RenGel 1124 Resin Only 5 Gallon 56056344 Ren 1124 Hardener Only 2 – 1Gallon 10

RenGel 1126 – White•GeneralPurpose•24MinGelTime

RenGel1126isageneralpurposeepoxysurfacecoatthatislower inviscositythanthe1124,butwillstillprovideuniformcoverageonvertical surfaces without sagging. This product has slightly lower mechanical properties than the other surface coats in the Huntsman line for less demanding applications.Catalog Number Description Availability

Net Wt.(Lbs.)

056023Q RenGel 1126 Resin Only Quart 2.27056024Q Ren 1126 Hardener Only Quart 0..44056023 RenGel 1126 Resin Only 6 Quarts 13.60056024 Ren 1126 Hardener Only 6 Quarts 2.64056026 RenGel 1126 Resin Only 5 Gallon 45056027 Ren 1126 Hardener Only Gallon 8.3

RenGel 1129 – White• ImpactResistant•20MinGelTime

This epoxy surface coat is formulated to produce a very high impact resistantanddurablesurfaceforlaminatedtooling.1129hasamediumviscosity for easy application but still resists sagging on vertical walls.Catalog Number Description Availability

Net Wt.(Lbs.)

056031 RenGel 1129 Resin Only 5 Gallon 45056032 Ren 1129 Hardener Only Gallon 9

RenGel 3260 – Blue•SiliconCarbideFilled•Castableupto½ inch thick•33MinGelTime

RenGel3260isasiliconcarbidefilledsurfacecoatthatoffersveryhighwear resistance and excellent mechanical properties for laminated tool-ing used in very demanding applications. This product is recommended for making foundry tooling, check fixtures, and metal forming dies. Alterations to the cured resin are very difficult due to the carbide filler.Catalog Number Description Availability

Net Wt.(Lbs.)

056085Q RenGel 3260 Resin Only Quart 2.93056086Q Ren 3260 Hardener Only Quart 0.29056085 RenGel 3260 Resin Only 6 Quarts 17.55056086 Ren 3260 Hardener Only 6 Quarts 1.74056090 RenGel 3260 Resin Only 5 Gallon 60056091 Ren 3260 Hardener Only Gallon 5.5


1.800.321.851138

Epoxy Surface Coats [CONTD.]

High Temperature Resins

Freeman 935 – Gray•High-TemperatureTooling•28MinGelTime(935-15)•43MinGelTime(935-30)•90MinGelTime(935-90)

This product is a high temperature resistant epoxy surface coat for con-structing laminated tooling that will be subjected to elevated temperatures such as vacuum forming tools and prototype injection molds. Freeman 935 is available with three different hardeners for a variety of gel times.Catalog Number Description Availability

Net Wt.(Lbs.)

055942 Freeman 935 Hi-Temp Resin Only Quart 2055943 Freeman 935-30 Hi-Temp Hardener Only ½ Pint 0.22055939 Freeman 935 Hi-Temp Resin Only 6 Quarts 12055940 Freeman 935-30 Hi-Temp Hardener Only 6 – ½ Pints 1.32055937 Freeman 935 Hi-Temp Resin Only 5 Gallon 45055944 Freeman 935-15 Hi-Temp Hardener Only Gallon 4.94055938 Freeman 935-30 Hi-Temp Hardener Only Gallon 4.94055947 Freeman 935-90 Hi-Temp Hardener Only Gallon 4.94

Freeman 945 – Gray•High-TemperatureTooling•50MinGelTime

This epoxy surface coat is an economical alternative to Freeman 935, for constructing large laminated tools that will be subjected to high temperatures.Usesincludemakingvacuumformtools,moldstopro-duce composite parts that require an elevated cure to solidify, as well as variety of other high temperature applications. 945 is a medium viscosity material that will not sag on vertical walls. Catalog Number Description Availability

Net Wt.(Lbs.)


RenGel 4026 – Gray•AluminumFilled•50MinGelTime(Ren1500) 30MinGelTime(Ren1501) 150MinGelTime(Ren1510)

•90DShoreHardnessRenGel4026isspecificallyformulatedwhere a high temperature resistant epoxy surface coat is required. This product features a medium viscosity for ease of application but will not sag on vertical mold surfaces. This material is designed for constructing vacuum form tools, prototype injection molds, and high temperature molds for the manufacture of composite parts requiring an elevated temperature cure. Catalog Number Description Availability

Net Wt.(Lbs.)

056153Q RenGel 4026 Resin Only Quart 2.18056154Q Ren 1501 Hardener Pint 0.24056153 RenGel 4026 Resin Only 6 Quarts 13.08056154 Ren 1501 Hardener 6 Pints 1.44056156 RenGel 4026 Resin Only 5 Gallon 60056039 Ren 1500 Hardener Only Gallon 6056157 Ren 1501 Hardener Only Gallon 7.5056040 Ren 1510 Hardener Only Gallon 6.75

RenGel 177-144 – Gray•SiliconCarbideFilled,StyreneResistant•60MinGelTime•92DShoreHardness

This epoxy surface coat is specifically designed for constructing close tolerance and long lasting molds to produce polyester parts. It is formulated with a silicon carbide filler to resist wear from abrasive materials, a chemistry that resists the effect of styrene monomer on the tool surface, and has a high temperature resistance to withstand the high exotherm generated during the polyester curing process. Catalog Number Description Availability

Net Wt.(Lbs.)

056025 RenGel 177-144 Resin Only 5 Gallon 60056039 Ren 1500 Hardener Only Gallon 6

SEE ALSO: Product Page No.TUF-Fil White 56TUF-Fil Hi-Temp 57Brushes 110



Araldite LY 8601 / Aradur 8601 – ClearA two-component, low viscosity system with excellent toughness and enhancedwet-ability.Forusesupto140°F(60°C)withonlyaroomtemperature cure.Catalog Number Description Availability

Net Wt.(Lbs.)

056708 Araldite LY 8601 Resin 5 Gallon 36056719 Aradur 8601 Hardener 5 Gallon 36

Araldite LY 8601 / Aradur 8602 – ClearAralditeLY8601/Aradur8602isastrongerandfastercuring versionoftheLY8601/8601.TheuseoftheAradur8602hardenerprovides improved flexural, tensile, and compressive strength to the LY8601Resin.Catalog Number Description Availability

Net Wt.(Lbs.)

056708 Araldite LY 8601 Resin 5 Gallon 36056713 Aradur 8602 Hardener 2 Gallons 9

Araldite LY 8605 / Aradur 8605 – ClearRenInfusion8605featuresexceptionallylongroomtemperaturegeltimeforusesupto300°F(149°C)afterheatedpostcure.Catalog Number Description Availability

Net Wt.(Lbs.)

056697 Araldite LY 8605 Resin - 5 Gal 5 Gallon 40056698 Aradur 8605 Hardener - 5 Gal 5 Gallon 31.5056699 Aradur 8605 Hardener - 2 Gal 2 Gallons 14056711 Araldite LY 8605 Resin - 55 Gal 55 Gallon 450056712 Aradur 8605 Hardener - 55 Gal 55 Gallon 315

Araldite LY 8615 / Aradur 8615 – Light AmberFeatures exceptionally long room temperature gel time for uses up to 400°F(204°C)afterheatedpostcure.Catalog Number Description Availability

Net Wt.(Lbs.)

056702 Araldite LY 8615 Resin 5 Gallon 45056703 Aradur 8615 Hardener 5 Gallon 22.5

Polyester Resins & Gelcoats

Ordering Instructions: ForQuartofResinpurchaseone0.75ozCatalyst ForGallonofResinpurchasetwo0.75ozCatalysts For5-GallonofResinpurchaseonePintCatalyst

MiaLam F-37 Polyester Laminating Resin – Light AmberMiaLamF-37isageneralpurposepolyester laminating resin that is specifically designed for making high quality fiberglass reinforced moldsandparts.Excellentchemicalandwater resistance make this product ideal for boatrepairorconstruction.CatalyzedwithMethylEthylKetonePeroxide(MEKP)ataratioof1.25%byweight.Catalog Number Description Availability

Net Wt.(Lbs.)

406135 MiaLam F-37 Resin Only Quart 2.2406130 MiaLam F-37 Resin Only Gallon 8.8406110 MiaLam F-37 Resin Only 5 Gallon 44.1412161 MEKP Liquid Hardener 0.75 oz 0.05412114 MEKP 9 Liquid Hardener Pint 1412115 MEKP 9 Liquid Hardener Gallon 8

MiaGel F-707 Polyester Gelcoat – WhiteThis polyester gelcoat is a brilliant white color for making high quality fiberglass parts. It is ideal for the boating industry due to its excellent waterresistanceandglossretention.CatalyzedwithMethylEthylKetonePeroxide(MEKP)atasuggestedrateof1.8%byweight.Catalog Number Description Availability

Net Wt.(Lbs.)

406170 MiaGel F-707 Quart 2.2406165 MiaGel F-707 Gallon 8.82406160 MiaGel F-707 5 Gallon 44.09412161 MEKP Liquid Hardener 0.75 oz 0.05412114 MEKP 9 Liquid Hardener Pint 1412115 MEKP 9 Liquid Hardener Gallon 8

MiaGel F-944 Polyester Gelcoat – NeutralThis polyester gelcoat is neutral in color, enabling the user to custom colorthisproductasdesired.Usepolyestercoloringpastes(pg.49)onlyforahighqualitysurface.Excellentfortheboatingindustryduetoexcellentwaterresistanceandglossretention.CatalyzedwithMethylEthylKetonePeroxide(MEKP)atasuggestedrateof1.8% by weight.Catalog Number Description Availability

Net Wt.(Lbs.)

411760 MiaGel F-944 Gallon 8.8412161 MEKP Liquid Hardener 0.75 oz. 0.05

Orange Tooling Gelcoat – Brilliant OrangeOrangeToolingGelcoatisapolyesterbasedcompoundspecificallydesigned for making fiberglass molds. Formulated to resist mold dis-tortion from repeated use, this product also features a high gloss and adurablefinishforlongmoldlife.CatalyzedwithMethylEthylKetonePeroxide(MEKP)atasuggestedrateof1.8%byweight.Catalog Number Description Availability

Net Wt.(Lbs.)

411023 Orange Tooling Gelcoat Gallon 9411025 Orange Tooling Gelcoat 5 Gallon 44412161 MEKP Liquid Hardener 0.75 oz 0.05412114 MEKP 9 Liquid Hardener Pint 1412115 MEKP 9 Liquid Hardener Gallon 8

Resin Infusion Epoxy Systems


1.800.321.851140

Freeman 1010 High-Density Epoxy Paste•Recommended½"inThickness•60MinGelTime•77DShoreHardness

This high density epoxy paste is a two component “clay-like” material that can be rolled out to a uniform thickness and applied behind an epoxy surface coat to provide a quick and easy method of surface coat reinforcement. Freeman 1010 is much stiffer in consistency than ourFreeman1020.Catalog Number Description Availability

Net Wt.(Lbs.)

055101 Freeman 1010 Gallon Unit 12055105 Freeman 1010 5 Gallon Unit 60

Freeman 1015 High-Density Epoxy Paste•Recommended½"inThickness•90MinGelTime•65DShoreHardness

Freeman 1015 is a two component epoxy paste material that may be rolled out to a uniform thickness and applied behind an epoxy surface coat to provide a quick and easy method of surface coat reinforcement.

Freeman1015isbetweenourFreeman1010and1020inhard-ness and strength. It features much improved mixing properties when compared to our Freeman 1010.Catalog Number Description Availability

Net Wt.(Lbs.)

055003 Freeman 1015 Gallon Unit 10.8

Specialty Tooling Pastes & Resin Systems

Freeman 1020 Low-Density Epoxy Paste •Recommended½"inThickness•50MinGelTime•55DShoreHardness

This is a lightweight paste laminate for surface coat or fiberglass reinforcement.Freeman1020iseasilyhand-mixedintoa dough-like consistency.Catalog Number Description Availability

Net Wt.(Lbs.)

055001 Freeman 1020 Gallon Unit 3.52055002 Freeman 1020 5 Gallon Unit 17.6

Freeman 1030 Polyurethane Reinforcement Paste•Recommended½"inThickness•TrowelableConsistancy•9MinGelTime•70DShoreHardness

This fiber-filled urethane paste is perfect for creating a strong, yet lightweight back-up for flexible urethanes, silicones, or epoxies. Featuresincludeeasymixing(1:3ratiobyvolume),easyapplicationwithout sagging, low shrinkage, a quick 90 minute demold time.Catalog Number Description Availability

Net Wt.(Lbs.)

055418 Freeman 1030 Gallon Unit 11.4

Room Temperature Surface Coats

Specialty Tooling Pastes & Resin Specifications

ProductNumberFreeman 1010 100:100 100:100 60 24 77 Paste 0.95 29.1 0.001 5,000 4,600 3.1 x 105 3,800 – 180 GreyFreeman 1015 100:20 – 90 24 65 Paste 1.05 26.4 0.001 – – – – – 180 GreyFreeman 1020 100:33 100:36 50 24 55 Paste 0.46 60.7 0.001 – – – – – 190 BiegeFreeman 1030 41:100 33:100 9 90 Min 70 Paste 1.04 26.7 – – – – – – – Off–WhiteRenLam 569/ Ren 569-1 100:11 100:18 35 24 80 Paste 1.20 23.0 – 5,000 4,600 3.8 x 105 2,800 3.8 x10-5 150 Blue

RenLam 569/ Ren 569-2 100:14 100:23 50 24 80 Paste 1.14 21.0 – 8,000 4,000 2.5 x 105 1,800 4.8 x10-5 138 Blue

RenPaste 1250 100:100 100:100 28 24 87 Paste 1.52 18.2 0.002 12,000 7,300 – 3,800 2.16x10-5 176 GrayRenPaste 1257-3 100:100 100:100 30 24 – Paste 1.71 16.2 – 13,000 6,000 – 3,980 – – BlueRenPaste 8281 100:100 100:100 90-165 24 45 Paste 0.60 46.2 0.001 1,300 549 1.2 x 105 413 9.4 x 10-6 118 BluePor-A-Foam 90:100 100:100 2 15-20 Min – 540 0.072 – – – – – – – – Lt. Yellow ASTM – – D–2471 – D–2240 D-2393 D-792 D-792 D–2566 D-695 D-790 D-790 D-638 D-696 D-648

These epoxy repair materials and paste compounds by Freeman and HuntsmanAdvancedMaterialsrepresentawiderangeofspecialtytooling materials for unique tool construction, repair, and alteration. Manyofthesematerialsarealsooftenusedasanalternativeto fiberglass cloth reinforcement behind surface coats.

C.T.

E. (i

n/in

/°F)

Defle

ctio

n

Tem

p. (°

F)

Tens

ile

Stre

ngth

(psi

)

Flex

ural

M

odul

us (p

si)

Colo

r

Flex

ural

S

treng

th (p

si)

Com

pres

sive

S

treng

th (p

si

Shrin

k (in

/in)

Volu

met

ric

Yie

ld (c

u. in

./lb.

)

Dens

ity (g

/cc)

Mix

ed V

isco

sity

(

cps)

Hard

ness

(

Shor

e D)

Dem

old

Tim

e

(ho

urs)

@ 7

2°F

Gel T

ime

(min

.)

@ 7

2°F

Mix

Rat

io (b

y vo

l.)

Res

in: H

arde

ner

Mix

Rat

io (b

y wt

.)

Res

in: H

arde

ner



Specialty Tooling Pastes & Resin Systems [CONTD.]

RenLam 569 / Ren 569-1 Fiber-Reinforced Epoxy Paste•Recommended½"inThickness•35or50MinGelTime•80DShoreHardness

This glass fiber reinforced laminating paste simplifies construction of intricatetoolsandtoolingaids.Maybecleanedupwithwarmwater.Mechanicalmixingproducesthebestresults,howeversmallerquanti-ties may be hand kneaded.Catalog Number Description Availability

Net Wt.(Lbs.)

056007 RenLam 569 Resin Only 5 Gallon 23056008 Ren 569-1 Hardener Only Gallon 2.53056012 Ren 569-2 Hardener Only Gallon 3.22

RenPaste 1250 High-Density Epoxy Paste•Aluminum-Filled•28MinGelTime•87DShoreHardness

This1:1mixratio,aluminum-filledepoxypastecombinesexcellentadhesive qualities with the machining characteristics of aluminum. Bonds to most metals, ceramics, glass, concrete and wood. This material is an excellent choice for potting drill bushings in composite materials and metal tools.Catalog Number Description Availability

Net Wt.(Lbs.)

056036Q RenPaste 1250 Resin Only Quart 2.5056037Q Ren 1250 Hardener Only Quart 2.5056036 RenPaste 1250 Resin Only 6 Quarts 15056037 Ren 1250 Hardener Only 6 Quarts 15

RenPaste 1257-3 Highly Filled Fairing Compound•Non-metallic•28MinGelTime•CreamyConsistency

This epoxy paste is excellent for fairing conventional aerodynamic surfaces.Widelyusedbyaircraftmanufacturesforblendingcontoursand surface repairs for flyaway and prototype windtunnel applications. Onetoonemixratio,creamyconsistancy,noelectrolyticcorrosion,andgreat adhesion combine to make this product high in performance and easy to use.Catalog Number Description Availability

Net Wt.(Lbs.)

056014 RenPaste 1257-3 Resin Only 6 Quarts 18.02056015 Ren 1257-3 Hardener Only 6 Quarts 18.02

RenPaste 8281 Granular Backfill•Maximum8"inThickness•150MinGelTime•50DShoreHardness

This two-part epoxy system is ideal for negative mold and core mask construction as well as internal core structures for production patterns and core boxes. It is lightweight, features low shrink, and offers excellent dimensional stability.Catalog Number Description Availability

Net Wt.(Lbs.)

056150 RenPaste 8281 Resin Only 5 Gallon 16056151 Ren 8281 Hardener Only 5 Gallon 16

Por-A-Foam Expanding Urethane Foam•2MinGelTime•4-5lb/cuft.Density

This compound is a two part component liquid urethane foam that rises to approximately 15 times its original poured volume. Por-A-Foam features a 1:1mixratiobyvolume,lowviscosity,4to5lb/cuft.cureddensity,anda15to20minutedemold,dependingonvol-ume. The product makes an excellent light weight backup material or void filler.Catalog Number Description Availability

Net Wt.(Lbs.)

057539 Por-A-Foam Gallon Unit 16057542 Por-A-Foam 5 Gallon Unit 80


1.800.321.851142

USG Specifications

USG Gypsum Cements Ultracal 30 38 25-35 0.08 115.0 99.0 6,000 Ultracal 60 39 75-90 0.07 114.4 97.5 5,000 Hydrocal A-11 42 16-20 0.12 112.5 93.8 5,500 Hydrocal B-11 44 25-35 0.11 111.2 91.6 4,500 White Hydrocal 45 25-35 0.39 110.6 90.0 5,000 Hydrocal FGR-95 30 50-70 – 112.0 101.6 – Medium-High Expansion 48 25-35 1.05 108.7 – – Hydrostone 32 17-20 0.24 119.4 108.7 10,000 USG Industrial Plasters #1 Moulding Plaster 70 27-37 0.20 99.0 69.0 2,000 #1 Casting Plaster 65 27-37 0.22 100.0 72.5 2,400 #1 Pottery Plaster 70 27-37 0.21 99.0 69.0 2,400 Lab Dental Plaster 70 6-9 – 99.0 69.0 2,000 Puritan Pottery Plaster 66 27–37 0.22 100.5 72.5 2,400 Duramold Pottery Plaster 62 27–37 0.22 102.0 75.0 2,900

AcompletelineofIndustrialPlastersandGypsumCementsforthetooling,art,andcastingmarkets.WeareabletosupplymostallUSGplasters with minimum quantities. Please call our customer service departmentat800-321-8511forfurtherdetails.

USG Gypsum Cements

Ultracal 30Primarily used as a “mass-casting material” where the mold is poured fromsolidgypsum.Ultracal30isthemostpopulargypsumusedintooling applications because of its good surface hardness, high com-pressive strength and low expansion. This material offers a slightly higher surface hardness and compressive strength then Hydrocal B-11.

Number DescriptionNet Wt.(Lbs.)

036055 Ultracal 30 50036005 Ultracal 30 100

Ultracal 60SimilartoUltracal30butfeaturesalmosttwicetheworkingtimewhichmakes it suitable for larger molds. It is ideal for applications where extreme accuracy is required.


036007 Ultracal 60 100

Availablebyspecialorderonly.Minimum40bags(1skid)

Hydrocal A-11Primarily used in the “splash casting” technique of producing large hemp-reinforced models of high accuracy, high strength and low cost. Fast setting time permits mold construction to be completed quickly and accurately.


036009 Hydrocal A-11 100

Hydrocal B-11SimilartoHydrocalA-11insettingexpansionandaccuracy.Themaindifference with Hydrocal B-11 is that it is formulated to have a longer period of plasticity enabling it to be used with templates to screed models directly from gypsum. This material has slightly less strength than Hydrocal A-11.


036069 Hydrocal B-11 50036010 Hydrocal B-11 100

White HydrocalBasic Hydrocal Cement with a gradual set time. This product may be carved after it solidifies. For areas that need modification, additional layers of Hydrocal can be applied to itself.


036037 White Hydrocal 100

Hydrocal FGR-95This material is a high-strength gypsum cement designed for use with glass fiber for fabricating glass-reinforced gypsum cement products. Excellentchoiceforlargearchitecturalapplications.


036022 Hydrocal FGR-95 100


Medium-High ExpansionMedium-HighExpansionPlasterexpandsinacontrollablemannertocompensate for metal shrinkage in foundry applications. Patterns may be expanded from 1⁄8" to 3⁄16" per linear foot with a single pour.


036020 Medium-High Expansion 100


HydrostoneHydrostone is the strongest and hardest gypsum cement available.Usedprimarilyintoolingandhighqualityartobjectapplications. This is an extremely wear-resistant material.


036034 Hydrostone 100

Mix

Rat

io P

arts

Wat

er B

y Wt.P

er

10

0 Pa

rts P

last

erSe

t Tim

e (M

in)

% S

ettin

g

Exp

ansi

on M

ax.

Dens

ity

(lb.

/ft.3)

Wet

Com

pres

sion

Stre

ngth

(psi

) Dry

Dens

ity

(lb.

/ft.3)

Dry

Plaster, Gypsum Cements & Accessories



USG Industrial Plasters

#1 Moulding PlasterA general-purpose plaster, commonly known as Plaster of Paris, that produces casts of nominal strength, hardness and of the finest detail reproduction.CastsmadeofMouldingPlasterareporousandmustbe carefully sealed.


036060 #1 Moulding 50036015 #1 Moulding 100

#1 Casting PlasterThe industry standard for figurines, plaques and cast objects. Produces a hard surface finish, minimal paint absorption and good resistance to chipping. This material offers higher strength and chip resistancethanMouldingPlaster.


036030 #1 Casting 100

#1 Pottery Plaster Becauseofitsstrengthandlongmoldlife,#1PotteryPlasterisidealfor use in the ceramic industry for making slip molds.


036028 #1 Pottery 50036027 #1 Pottery 100

Laboratory Dental PlasterSimilartoMouldingPlaster,thisformulationproducesintricate detail with acceptable hardness and strength with a set time of 6to9minutes.


036025 Lab Dental Plaster 100


Puritan Pottery PlasterSimilarto#1PotteryPlaster,thisformulationproducesslightlydenserand longer wearing molds for the ceramic industry.


036029 Puritan Pottery 50


Duramold Pottery Plaster Designed for use at a lower water to plaster ratio, this plaster has a higher wet strength for less breakage in process and provides longer mold-casting life.


036040 Duramold Plaster 100


Plaster Accessories

Manila HempSpecial,fibrousmaterialusedforreinforcementofshell-typeplasterreproductions. A premium-quality grade that is soft and absorbent with a good tensile strength.


054485 Manila Hemp 40–45 Lbs.

Rubber Plaster Mixing ContainersAvailableinvarioussizes,thesecontainersaremadeofblack neoprene rubber for flexibility, durability and a non-stick surface. Thismaterialisnotattackedbyplastersorgypsumcements.Not recommended for use with thermoset type epoxies, urethanes, or polyesters.


054440 Rubber Mixing Bowl 12 oz054445 Rubber Mixing Bowl 20 oz054450 Rubber Mixing Bowl 11⁄2 Qt054455 Rubber Mixing Bowl 5 Qt

Freeman Plaster Release, Liquid or PowderFreemanLiquidPlasterReleaseisamixturecontainingalightoilandpowderedmica.Whenappliedtothemoldsurface,thisproductwill create a thin wet film for effective plaster release. Powdered mica is also sold separately for people who make their own release.


054405 Plaster Release – Powdered Mica Pound054410 Plaster Release – Liquid Quart054412 Plaster Release – Liquid Gallon

Freeman PVC Fre-SealerFreemanPVCFre-Sealerisusedtosealplasters.Itformsamoistureandchemicalbarrier.Enoughcoatsshouldbeappliedtoproduceaglossonthemoldface.CAUTION:Fre-Sealerisnotarelease,butabarrier coat.


027880 PVC Fre-Sealer Quart

Ren 802 PVC Lacquer SealerA green-colored, lacquer-type sealing agent recommended for plaster surfaces.


056213 Ren RP 802 PVC Sealer 12 oz Spray056215 Ren RP 802 PVC Sealer Quart

Plaster GlovesMadeofatough,syntheticrubberthatisresistanttomosttypesofsolvents.


054062 Plaster Gloves (Nitrile Rubber) 12 Pair

Plaster Release, Steric Acid PowderStericacidpowder,whenmeltedandmixedwithkerosenetoamilkyconsistency, provides an excellent for plaster.


054430 Plaster Release – Steric Acid Pound

Plaster, Gypsum Cements & Accessories [CONTD.]

Fabrics, F i l lers & Bagging

44 1.800.321.8511

Fabrics, Fillers & Bagging

Used to construct laminate plastic parts and tooling with epoxy and polyester resins, Freeman fiberglass fabrics are first quality materials manufactured by BGF and are compatible with both epoxy and polyester resin systems.

Available by the yard (unless otherwise noted) and in full rolls.

Fiberglass Fabrics Specifications

StyleWeight

(oz./sq.yd) WeaveThickness (inches)

Yarn Description -

Warp*

Yarn Description -

Fill*

Yarns Per Inch

(Ends x Picks)

Breaking Strength -

Warp (lbs/in.)

Breaking Strength -

Fill (lbs/in.) Finish120 3.12 4 HS 0.005 ECD 450 1/2 ECD 450 1/2 60 X 58 105 87 504 Volan1522 3.64 Plain 0.006 ECG 150 1/2 ECG 150 1/2 24 X 22 65 60 504 Volan3733 5.75 Plain 0.008 ECG 37 1/0 ECG 37 1/0 18 X 18 150 115 504 Volan7533 5.90 Plain 0.009 ECG 75 1/2 ECG 75 1/2 18 X 18 110 100 504 Volan2532 7.00 Plain 0.011 ECG 25 1/0 ECG 25 1/0 16 X 14 150 100 504 Volan7532 7.10 Plain 0.010 ECG 75 1/3 ECG 75 1/3 16 X 14 135 100 504 Volan7725 8.50 2x2 Twill 0.010 ECG 75 1/0 ECG 75 1/0 54 X 18 - - 504 Volan7725 Black 8.70 2x2 Twill 0.010 ECG 75 1/0 ECH 25 1/0 54 X 18 - - A4547781 8.71 8 HS 0.009 ECDE 75 1/0 ECDE 75 1/0 57 X 54 242 231 504 Volan1800 9.30 Plain 0.012 ECK 18 1/0 ECK 18 1/0 16 X 13 400 300 Volan7500 9.64 Plain 0.015 ECG 37 1/2 ECG 37 1/2 16 X 14 235 215 504 Volan7544 18.23 2 End Plain 0.021 ECG 37 1/2 ECG 37 1/4 27 X 14 450 390 504 Volan7587 20.10 Mock Leno 0.030 ECG 37 1/2 ECG 37 1/2 39 X 21 420 215 504 Volan1597 38.00 Triple Plain 0.039 ECG 37 1/4 ECG 37 1/4 30 X 30 700 600 504 Volan*E = E Glass C = Continuous filament D = 5 micron diameter DE = 6 micron diameter G = 9 micron diameter H = 10 micron diameter K = 13 micron diameter

Fiberglass Fabrics

3 oz. Fiberglass Cloth (Style 120)This fiberglass cloth is tightly woven and has a soft, smooth surface, making it ideal for demanding applications where print-through must be minimized or avoided. This cloth conforms easily to contoured surfaces and compound curves. It is commonly used in aerospace and other high quality fabrications.Catalog Number Description Width

Full Roll Length (Yds.)

054152 3 oz. – 4 HS Weave Cloth 38" 500

4 oz. Fiberglass Cloth (Style 1522)This lightweight fiberglass cloth works well for most light-duty applica-tions where a clear wet-out is required. Sometimes referred to as “deck cloth”, it is popular in the construction of lightweight models, RC aircraft, surfboards, sailboards, and canoes. It is frequently used as a surfacing fabric to stop print through when backed by layers of heavier fabric in molded parts.Catalog Number Description Width


054096 4 oz. – Plain Weave 50" 125

6 oz. Fiberglass Cloth (Style 3733)This fabric is a flexible fabric that wets-out transparently and is well suited to a wide range of lightweight, general purpose applications including laminating, reinforcing and sheathing / waterproofing. It is also widely used in boat building, cedar strip canoes, and lightweight repairs. Catalog Number Description Width


054093 6 oz. – Plain Weave 38" 125

Types of Weaves Available:

Plain – The warp (length-wise) and fill (cross-wise) yarns cross over and under each other. This weave has the maximum number of interlacings, the most crimp, and is the most stable weave. It is excellent for use in flat panel laminates.

Mock Leno – The yarns in this type run in groups in both warp and fill, locking each other in place at the interlacings. This style gives maxi-mum thickness, good dimensional stability and medium-stiff drapeability. Excellent in tooling applications.

Satin – The warp yarn crosses over four or more fill yarns, under one, over four, etc. Very drapeable, it conforms well to contoured surfaces in manufactured parts. Often used to reinforce plastics due to high bidirectional strength.

Triple Plain – This special weave features very good drapeability and conforms readily to contoured plains.



Fiberglass Fabrics [CONTD.]

6 oz. Fiberglass Cloth (Style 7533)This fabric is well suited to a wide range of lightweight, general purpose applications including small craft boat building, reinforcing, sheathing/waterproofing, and lightweight tooling.Catalog Number Description Width


054089 6 oz. – Plain Weave 38" 125054087 6 oz. – Plain Weave 50" 125

7 oz. Fiberglass Cloth (Style 2532)This is an easy to use, medium weight cloth that is commonly referred to as “boat cloth” because of its wide range of marine construction, waterproofing, and repair applications.Catalog Number Description Width


054082 7 oz. – Plain Weave 50" 125

7 oz. Fiberglass Cloth (Style 7532)This is an easy to use, medium weight cloth that is widely used in marine construction and repairs and tooling applications. Available in full roll only.Catalog Number Description Width


054086 7 oz. – Plain Weave 38" 125

8.5 oz. Fiberglass Cloth (Style 7725)This cloth is characterized by its diagonal weave pattern (2 x 2 twill), which is highly desired for its cosmetic appearance. It is a highly conformable fiberglass cloth, allowing it to fit in tight areas and around complex shapes, and is used in many high performance applications.Catalog Number Description Width


054098 8.5 oz. – 2x2 Modified Twill 38" 125

8.7 oz. Black Fiberglass Cloth (Style 7725)This is a medium weight fiberglass cloth for those applications where the “look” of carbon fiber cloth is desired but the superior strength to weight ratio of carbon fiber is not required. This black fiberglass cloth features a 2x2 twill weave (two over and two under) and maintains the highly conformable characteristics of other 7725 style cloth, allowing it to fit into tight areas and around complex shapes. Catalog Number Description Width


054100 Black 8.5 oz. – 2x2 Modified Twill 38" 125

8.8 oz. Fiberglass Cloth (Style 7781)This tightly woven fiberglass cloth is used where a high glass to resin ratio is required, producing a stronger, lighter composite than is possible with a plain weave. Also, its eight-harness satin weave pattern enables it to conform around curved surfaces more easily than a plain weave, making it a popular choice in aerospace and other high end applications.Catalog Number Description Width


054153 8.8 oz. – 8 HS Weave 50" 125

10 oz. Fiberglass Cloth (Style 7500)This is the most popular medium weight fiberglass fabric, featuring an excellent balance of cost, weight, and strength. Its well-known versatil-ity makes it popular for tooling, FRP boat construction, sandwich core panels, waterproofing and other high-strength layup applications.Catalog Number Description Width


054144 10 oz. – Plain Weave 38" 125054091 10 oz. – Plain Weave 50" 125

10 oz. Fiberglass Cloth (Style 1800)This is an economical medium weight tooling fabric, used in FRP boat construction, tooling, and other layup applications. Catalog Number Description Width


404450 10 oz. – Plain Weave 60" 125

18 oz. Fiberglass Cloth (Style 7544)This heavy duty cloth features a plain weave that is less “open” than a mock leno weave, resulting in a higher glass to resin ratio. It is primar-ily used in place of multiple layers of a medium weight fabric when a rapid build-up is required. Since heavier weight fiberglass fabrics do not conform to tight radii as easily as medium weight fabrics, they are better suited for flat or slightly curved shapes, and/or as back-up layers behind lighter surfacing layers.Catalog Number Description Width


054147 18 oz. – 2 End Plain Weave 38" 125

20 oz. Fiberglass Cloth (Style 7587)This heavy duty cloth features a mock leno weave that is more “open” than a plain weave, making it easier to wet-out. It is primarily used in place of multiple layers of a medium weight fabric when a rapid build-up is required. Since heavier weight fiberglass fabrics do not conform to tight radii as easily as medium weight fabrics, they are better suited for flat or slightly curved shapes, and/or as back-up layers behind lighter surfacing layers.Catalog Number Description Width


054148 20 oz. – Mock Leno Weave 38" 80

38 oz. Fiberglass Cloth (Style 1597)This is our heaviest fiberglass cloth and features a triple weave. It is primarily used with epoxy in applications where a very strong, rapid build-up is required or to reinforce wood. Since heavier weight fiber-glass fabrics do not conform to tight radii as easily as medium weight fabrics, they are better suited for flat or slightly curved shapes, and/or as back-up layers behind lighter surfacing layers.Catalog Number Description Width


054151 38 oz. – Triple Plain 38" 50

Fiberglass Tapes (8.75 oz)Plain weave fiberglass tape in various widths used with fiberglass cloth or sep-arately to laminate plastic tooling for exact duplication applications. Material is manufactured with bound/hemmed edges and a 627 silane finish. Sold in full rolls only.Catalog Number Description


054129 1" Fiberglass Tape 50054130 2" Fiberglass Tape 50054131 3" Fiberglass Tape 50054132 4" Fiberglass Tape 50054133 6" Fiberglass Tape 50054134 12" Fiberglass Tape 50


46 1.800.321.8511

Other Fiberglass ReinforcementsFiberglass StrandIdeal for use with Repro Laminating Resin or epoxy laminating resins where a faster layup is required. Fiberglass strand is also easier to apply than cloth around irregular areas.Catalog Number Description

Net Wt.(Lbs.)

054074 1⁄8" Fiberglass Strand 5054072 1⁄8" Fiberglass Strand 55054073 1⁄4" Fiberglass Strand 5054071 1⁄4" Fiberglass Strand 50

Fiberglass Veil Cloth Flexiveil 130 Fiberglass Veil Cloth is a non-woven, continuous-strand fiberglass lightweight mat that provides a resin rich surface reinforce-ment to fiberglass gel coats or epoxy surface coats. This product will strengthen the surface, help prevent print-through of woven reinforcing layers of fiberglass cloth, shield against corrosion and stress, and protect against excessive wear. This product is made to conform easily to contoured surfaces, is 10 mil thick (0.010"), and is manufactured using A glass for superior corrosion and chemical resistance.Catalog Number Description Width Length054136 Flexiveil 130 (10 mil) 40" 50'054135 Flexiveil 130 (10 mil) 40" 1200'

Fiberglass Woven RovingThis heavy fiberglass cloth allows for easy hand or machine layups of strong, yet economical laminations. It is often used along with other types of fiberglass reinforcements to fabricate large components for boats, automobiles, and home furnishings.Catalog Number Description Width404800 Woven Roving 18 oz. 60"

StitchmatAlso referred to as Biaxial Mat, Stitchmat is a heavy 18 ounce woven roving, stitched to a light 3⁄4 ounce fiberglass mat. The mat helps hold the roving together during cutting and laminating. Used mainly with polyester laminating resins for building laminate strength and thickness.Catalog Number Description Width Length404748 Stitchmat 18 oz. roving with 3⁄4 oz. mat 50" 76 yards

Fiberglass Chopped Strand MatAn unwoven reinforcement fabric that is manufactured from chopped fiberglass strands secured with a powder binder. Compatible with polyester, vinyl ester, and epoxy resins, this product is most commonly used in the hand lay up process. Ideal for constructing a wide variety of laminated parts.Catalog Number Description Width Length404830 1.5 oz. Chopped Strand Mat 38" 200'404835 1.5 oz. Chopped Strand Mat 50" 200'

Lengths are an approximation.

Kevlar® FabricsKevlar fiber, (also known as aramid fiber) is most widely known for its superior resistance from impact, fatigue, wear, and tear. All of our Kevlar woven fabrics are made with Kevlar 49, which is the structural grade of Kevlar material for composite reinforcement (as opposed to Kevlar 29, which is the ballistic grade material).

Kevlar is used extensively in the manufacture of sporting goods equipment, marine vessels of all sizes, and throughout the automotive and aerospace industries. It is lighter than fiberglass, but heavier than carbon fiber. It is often used in conjunction with either fabric to improve the toughness, flexibility, abrasion resistance, and most importantly, impact resistance of a composite part.

Kevlar will degrade when exposed to UV light, so accommodation should be made in part design or choice of matrix materials and additives.

Kevlar is a registered trademark of DuPont.

1.7 oz. Kevlar Cloth – Plain WeaveThis is our thinnest and lightest Kevlar cloth, used in many smaller applications or in larger composite applications that require the performance of Kevlar with the least amount of additional weight or part thickness. Finish 618Warp 195 T965 Kevlar 49Fill 195 T965 Kevlar 49Construction (Ends X Picks) 34 X 34 (per inch)Breaking Strength: 200 lb / in (in both directions)Thickness 0.004 in

Catalog Number Description Width404301 Kevlar – 1.7 oz. (Style 5120) 38"

5 oz. Kevlar Cloth – Plain WeaveThis is our standard weight Kevlar fabric in plain weave form. The plain weave provides uniform properties throughout and is a bit stiffer than the highly conformable 4-harness satin weave, making it easier to handle.Finish 618Warp 1140 T965 Kevlar 49Fill 1140 T965 Kevlar 49Construction (Ends X Picks) 17 X 17 (per inch)Breaking Strength: 650 lb / in (in both directions)Thickness 0.01 in

Catalog Number Description Width404306 Kevlar – 5 oz. (Style 5281) 38"

5 oz. Kevlar Cloth – 4HS WeaveThis is our standard weight Kevlar fabric in 4-harness satin weave form. The 4HS weave provides greater conformability for working with irregular shapes and in corners. It will, however, be a little more difficult to handle than the plain weave fabric.Finish 618Warp 1140 T965 Kevlar 49Fill 1140 T965 Kevlar 49Construction (Ends X Picks) 17 X 17 (per inch)Breaking Strength: 650 lb / in (in both directions)Thickness 0.01 in

Catalog Number Description Width404312 Kevlar – 5 oz. (Style 5285) 38"



Carbon Fiber Reinforcements

Carbon fiber fabric is well known as one of the strongest and stiffest reinforcement materials available. While more expensive than glass, it easily justifies its premium price when used in high performance applications.

All Freeman carbon fabrics are first quality materials manufactured by BGF and made exclusively from polyacrylonitrile (PAN) precursors, thus making them suitable for all high performance applications.

Available by the yard and in full rolls.

3K Carbon Fiber Cloth – Plain WeaveThis is our lightest carbon fiber cloth. It features a plain weave (the one over and one under pattern gives it a checkerboard appearance) that is commonly used by manufacturers of light-weight aerodynamic parts. While not as drapable as the 2x2 twill weave, it is easier to handle.Warp 3KFill 3KConstruction (Ends x Picks) 12 x 12Weight (oz./sq.yd) 5.7

Catalog Number Description Width


404005 3K Plain Weave 50" 100

3K Carbon Fiber Cloth – 2x2 Twill WeaveThis is our lightest carbon fiber cloth that features the popular 2x2 twill weave (the two over and two under pattern gives it a diagonal appearance) that many recognize as “the look” of carbon fiber. This weave also makes it more drapable, yet more delicate to handle.Warp 3KFill 3KConstruction (Ends x Picks) 13 x 13Weight (oz./sq.yd) 6.2



404015 3K 2x2 Twill Weave 50" 100

6K Carbon Fiber Cloth – 2x2 Twill WeaveThis medium weight carbon fiber cloth features the popular 2x2 twill weave (the two over and two under pattern gives it a diagonal appearance) that many recognize as “the look” of carbon fiber. However, since it is not as drapable as the 3k carbon cloth, it is more often used in structural applications.Warp 6KFill 6KConstruction (Ends x Picks) 12 x 12Weight (oz./sq.yd) 11.2



404020 6K 2x2 Twill Weave 50" 100

6K Carbon Fiber Cloth – 5HS WeaveThis medium weight carbon fiber cloth features a five harness satin weave which gives it higher drapability than the 6K 2x2 twill weave.Warp 6KFill 6KConstruction (Ends x Picks) 12 x 12Weight (oz./sq.yd) 11.2



404010 6K 5HS Weave 50" 100

12K Carbon Fiber Cloth – 2x2 Twill WeaveThis heavy duty carbon fiber cloth features the popular 2x2 twill weave, giving it adequate drapability for its size. While more difficult to form than lighter carbon cloths, this fabric enables rapid buildup, making it ideally suited for the construction of flat parts with high strength and stiffness requirements.Warp 12K T300Fill 12K T300Construction (Ends x Picks) 11 x 11Weight (oz./sq.yd) 19.2



404030 12K 2x2 Twill Weave 50" 100

Unidirectional Carbon Fiber TapesThese tapes are made from filaments of carbon that are flat (not twisted, like yarns), and provide the strengths and stiffness of carbon fiber in one direction only, thus enabling the maximum precision in orientation. Sold by the yard.Warp 12KFill G150 FiberglassConstruction (Ends x Picks) 11 x 8Weight (oz./sq.yd) 11.4

Catalog Number Description


404060 1" Unidirectional Carbon Tape 100404062 2" Unidirectional Carbon Tape 100404064 3" Unidirectional Carbon Tape 100404066 4" Unidirectional Carbon Tape 100404068 6" Unidirectional Carbon Tape 100


48 1.800.321.8511

Aluminum FillersFreeman offers a wide range of aluminum fillers that are commonly used with epoxies and other tooling resins. Selection of the proper filler for spe-cific applications is largely dependent on the particle size of the filler.

Aluminum Powder is typically added to resin systems in smaller concentrations (up to 10%) for appearance purposes or to increase machinablity or wear resistance. The other sized fillers are used to reduce exotherm, increase casting thickness, and reduce shrinkage. The size of the filler used depends on the size of the tool and other specific requirements. The sizes, from smallest to largest, are:

Particle Size Mesh DescriptionAluminum Powder 0.0006" N/A Fine powderAluminum Sand 0.006" – 0.040" 100 – 18 Sand Aluminum Grain 0.063" (diameter) x 0.25" – 0.375" long N/A Cut wireAluminum Spheres 0.020" – 0.074" 30 – 10 Coarse sandAluminum Shot 0.125", 0.25", & 0.30" N/A Flattened and

round pelletsAluminum Puffs 0.25" to 0.375" N/A Flattened pellets


Net Wt.(Lbs.)

406383 Aluminum Powder (Mia 82) 2.5056230 Aluminum Powder 40059015 Aluminum Sand 2.5054497 Aluminum Sand 50056234 Aluminum Grain 50059010 Aluminum Spheres 2.5054495 Aluminum Spheres 50059005 Aluminum Shot 2.5054491 Aluminum Shot 50054493 Aluminum Puffs 50

Ren DT 081 & Ren DT 082 Liquid Tooling FillersDT-081 is a low density filler for use with RenCast 6426 or epoxy laminating resins as a lightweight back-up material.

DT-082 is a high density filler for use with RenCast 6426-1, RenCast 6470 or epoxy laminating resins as a back-up material.Catalog Number Description Availability

Net Wt.(Lbs.)

056235 Ren DT 081 Low Density Fill Bag 50056236 Ren DT 082 High Density Fill Pail 33

Alumina Trihydrate (ATH)Alumina Trihydrate is used as a filler for epoxy, urethane, or polyester resins, where fire retardant properties or increased thermal conductivity are required. This material is white in color.Catalog Number Description Availability

Net Wt.(Lbs.)

406372 Mia 67 Alumina Tri Hydrate Quart 2406374 Mia 67 Alumina Tri Hydrate 2 Quart 3.75406376 Mia 67 Alumina Tri Hydrate Gallon 11.5

Walnut ShellsLow-cost material used to extend the resin and reduce the weight of cast parts. Easily mixed into epoxy and polyurethane resins. This filler will not sink to the molded surface of most plastics due to its light density.Catalog Number Description Availability

Net Wt.(Lbs.)

054488 Walnut Shells 8/12 Mesh 2 Quart 2.5054490 Walnut Shells 8/12 Mesh Bag 50

Tooling Plastics Fillers

Glass BubblesGlass Bubbles are very light-weight, hollow glass spheres that may be added to epoxy, urethane, or polyester resins to make them lighter in weight, shrink less, and machine easier. Depending on the degree of filler added, paste consistencies may be obtained.Catalog Number Description Availability

Net Wt.(Lbs.)

406352 Mia 65 Glass Bubbles Quart 0.75406354 Mia 65 Glass Bubbles 2 Quart 0.75406356 Mia 65 Glass Bubbles Gallon 1.1

Calcium CarbonateCalcium Carbonate is a white, powder-type filler that may be added to epoxy or polyester resins to reduce costs, reduce shrinkage, increase viscosity, and/or improve physical properties.Catalog Number Description Availability Net Wt.406312 Mia 61 Calcium Carbonate Quart 1.9406314 Mia 61 Calcium Carbonate 2 Quart 3.7406316 Mia 61 Calcium Carbonate Gallon 10

Ceramic SpheresCeramic Spheres are hollow light weight fillers used to reduce weight and shrinkage in epoxy, urethane, or poly-ester resins. Gray in color.Catalog Number Description Availability

Net Wt.(Lbs.)

406342 Mia 64 Ceramic Spheres Quart 0.8406344 Mia 64 Ceramic Spheres 2 Quart 1.7406346 Mia 64 Ceramic Spheres Gallon 4.8412415 Ceramic Spheres (Extendospheres SG) Bag 50

Milled Glass FibersMilled Glass Fibers are finely cut fiberglass filaments that are used for thickening epoxy, polyester, or urethane resin systems, or to increase their physical and mechanical properties. Also, this material may be used to promote adhesion when applying additional laminations to a cured laminate.Catalog Number Description Availability

Net Wt.(Lbs.)

406362 Mia 66 Glass Fiber Quart 1.5406364 Mia 66 Glass Fiber 2 Quart 3406366 Mia 66 Glass Fiber Gallon 8054075 Milled Glass Fibers (Glass Flock) 1⁄32" Long Bag 50056229 Ren RP 32 Glass Fibers Box 50



Tooling Plastics Fillers [CONTD.]

Cotton Flock Also referred to as milled cotton fibers, cotton flock is used as a filler to thicken epoxy resins or to promote adhesion between laminate layers. It offers dimensional stability and enhance com-pound strength. It is also used for patching and repairing surfaces, although it is not recommended for boat hull repairs. This filler is best suited in areas that will not be submerged or in constant contact with water.Catalog Number Description Availability

Net Wt.(Lbs.)

406302 Mia 60 Cotton Flock Quart 0.75406304 Mia 60 Cotton Flock 2 Quart 1.2406306 Mia 60 Cotton Flock Gallon 2.5054080 Cotton Flock (Milled Cotton Fibers) Box 50

Fumed SilicaFumed Silica—sometimes referred to as Cab-O-Sil (registered trademark of Cabot) or Aerosil (registered trademark of Degussa)—is a thickening agent that may be added to epoxy, urethane, or polyester resins to increase the viscosity. High filler loading will produce paste-like consistencies, ideal for creating fillets, repair materials, or making fairing compounds smoother and easier to apply.Catalog Number Description Availability

Net Wt.(Lbs.)

406332 Mia 63 Fumed Silica Quart 1.5406334 Mia 63 Fumed Silica 2 Quart 0.23406336 Mia 63 Fumed Silica Gallon 7054077 Fumed Silica (Cab-O-Sil M-5) Bag 10412034 Fumed Silica (Aerosil 200) Bag 10

Wood FlourWood flour is mainly used to repair or bond wood. It thickens epoxy laminating resin to provide less sag and more bond strength. It is ideal for making fillets in sharp corners, filling gaps in wooden structures, and doing any type of wood bonding. The particles are free-flowing and easy to disperse in the resin.Catalog Number Description Availability

Net Wt.(Lbs.)

406322 Mia 62 Wood Flour Quart 0.5406324 Mia 62 Wood Flour 2 Quart 1406326 Mia 62 Wood Flour Gallon 2.75

Graphite PowderGraphite Powder is a black filler that may be added to epoxy, urethane, or polyester resins. This very hard product will add abrasion resistance and provide a low-friction surface to the finished part.Catalog Number Description Availability

Net Wt.(Ounces)

406392 Mia 84 Graphite Powder Quart 12

Dyes and Pigments

Freeman Color TintsA highly concentrated coloring tint for urethane and epoxy resin sys-tems. For urethanes mix thoroughly into the part B or Polyol side before combining with part A. For epoxies add to the resin side before combining with the hard-ener. 0.2% to 0.5% can produce deep colors. May be used with clear urethanes and epoxies to obtain a transparent color.

Be certain to wear hand and eye protection, as these dyes may permanently stain objects and temporarily stain skin.Catalog Number Description Color Availability055420 Freeman Color Tints Yellow 2 oz.055421 Freeman Color Tints Green 2 oz.055422 Freeman Color Tints Blue 2 oz.055423 Freeman Color Tints Red 2 oz.055424 Freeman Color Tints White 2 oz.055425 Freeman Color Tints Black 2 oz.055426 Freeman Color Tints Orange 2 oz.055427 Freeman Color Tints Violet 2 oz.055428 Freeman Color Tints Brown 2 oz.

Araldite DW Coloring PastesRen DW Coloring Pastes are concentrated pigments in an epoxy resin. The pigments are ideal for coloring all Ren epoxy compounds and most RenCast Polyurethane Elastomers. Additions of up to 3% by weight of color paste (based on the total weight of resin and hardener) can be made without significantly changing the cured properties of the material. The DW Pastes produce a rich, solid color and should be used in applications where the final part is designed to be opaque, not transparent.Catalog Number Description Color Availability056244 Araldite DW 0131 Paste White Gallon056245 Araldite DW 0132 Paste Yellow Gallon056246 Araldite DW 0133 Paste Red Gallon056247 Araldite DW 0134 Paste Green Gallon056248 Araldite DW 0135 Paste Blue Gallon056250 Araldite DW 0137 Paste Black Gallon

Polyester Coloring PastesWide variety of concentrated polyester pigments used to color polyester gelcoats, laminating resins, and repair materials. Maximum concentration of pigment should not exceed 3%. Used with polyester systems only, not compatible with epoxies or urethanes. Catalog Number Description Color Availability412240 Mia Color Paste White 100 mL412242 Mia Color Paste Blue 100 mL412246 Mia Color Paste Beige 100 mL412248 Mia Color Paste Brown 100 mL412250 Mia Color Paste Yellow 100 mL412252 Mia Color Paste Red 100 mL412256 Mia Color Paste Black 100 mL412258 Mia Color Paste Gray 100 mL412260 Mia Color Paste Green 100 mL412215 Bulk Color Paste Black 1 kg412225 Bulk Color Paste Gray 1 kg412230 Bulk Color Paste Beige 1 kg412217 Bulk Color Paste Blue 1 kg


50 1.800.321.8511

Mia Vacuum Bag and Release FilmMia Vacuum Bag and Release Film is a prod-uct that can be used both as the vacuum bag as well as an effective release film. Ideal for polyester, vinylester, epoxy, and phenolic res-ins, it has a temperature resistance to 285°F. Polyolefin film, green in color.Catalog Number Description Thickness Width400500 Mia Vacuum Bag and Release Film 0.002" 60"

Mia Perforated Release FilmMia Perforated Release Film is a polyolefin film that contains uniformly spaced perforations. These 0.015" holes, that are staggered on 1⁄4" centers, permit the excess resin from the laminate to flow through the film and be absorbed in the bleeder cloth. Most commonly used on wet lay-ups, where excess resin is typical.Catalog Number Description Thickness Width400502 Mia Perforated Release Film 0.002" 60"

Mia Stitch Peel Ply FabricThis nylon fabric is used in the laminating pro-cess and is placed directly against the back side of a laminated tool. This provides a rough surface that may be readily bonded to. Use of this product in the bagging process will save valuable time in sanding or abrading the surface. Mia Stitch Peel Ply also has “red tracers” to easily identify the peel ply after the part is cured, so the risk of forgetting to remove the peel ply is minimized.Catalog Number Description Thickness Width406800 Mia Stitch Peel Ply Fabric 0.006" 60"

Mia Breather / Bleeder FabricThis multi-purpose product may be used as a bleeder to absorb excess resin, as well as a breather to permit even air flow over the tool surface. Made from polyester, this product is ideal for the marine, automotive, and general composite industries. This product is white in color, weighs 4 oz. / sq. yd., and is suitable for a maximum temperature of 375°F.Catalog Number Description Width400505 Mia Breather / Bleeder Fabric 60"

Mia Flow Resin Infusion MediaThis red polyethylene flow media is designed to provide even resin flow through the entire part during the infusion process. Mia Flow is engi-neered with two distinct strand layers to provide consistent channels for resin flow. The product is 0.050" thick with 1⁄4" mesh size openings.Catalog Number Description Thickness Width406005 Mia Flow Resin Infusion Media 0.05" 60"

Mia Vacuum Bagging Supplies



Mia Sealant Tape Mia Sealant Tape is designed to secure the bagging film to the tool surface. This yellow colored, synthetic rubber provides an excel-lent sealing surface, while still being able to be removed cleanly from metal or composite surfaces. Good up to 400°F, this product is sold in rolls 1⁄8" thick x 1⁄2" wide x 25' long.Catalog Number Description Thickness Width Length406665 Mia Sealant Tape 1⁄8" 1⁄2" 25'

Mia Pressure Sensitive Tape Mia Pressure Sensitive Tape is a polyester, multi-purpose, pressure sensitive tape that uses a rubber based adhesive. This mate-rial is used for holding down vacuum bagging materials or masking off areas where excess resin flow or flash may occur. The tape is orange and temperature resistant to 350°F.Catalog Number Description Thickness Width Length406668 Mia Pressure Sensitive Tape 0.015" 1" 72 YD

Mia Bagging HardwareMia Vac Valve is a premium quality vacuum valve made from machined aluminum and comes complete with base, silicone seal, and pressure plate for quick and easy instal-lation. Male 1⁄4" NPT threads.

Mia Vac Gauge is a liquid filled gauge with a range of adjustment from 30" Hg to -5" Hg. Large 2.5" diameter face with male 1⁄4" NPT threads.

Mia Quick Disconnect is sold as two separate items and may be purchased individually. Both are made from plated steel to provide years of service. Temperature resistance to 500°F.

Mia Vac Hose is a 3⁄8" I.D. x 10' long vacuum hose that may be used for low temperature applications (275°F max) or room temperature use. 1⁄4" male NPT fittings on both ends.

Mia Venturi Vacuum Generator is a low cost alternative to a traditional vacuum pump. This unit, when connected to 80 psi of compressed air, is able to generate a vacuum up to 25.5" Hg. It has a 1⁄8" NPT female connection to compressed air and a 1⁄4" NPT male connection to attach the vacuum hose.Catalog Number Description406685 Mia Vac Valve 406670 Mia Vac Gauge 406661 Mia Male Quick Disconnect 406662 Mia Female Quick Disconnect 406680 Mia Vac Hose 406690 Mia Venturi Vacuum Generator

Mia Vacuum Bagging Supplies [CONTD.] Core Materials

Aluminum Honeycomb Sandwich PanelThis lightweight aluminum honeycomb core is laminated on both sides with epoxy and woven fiberglass 0.018" thick to produce a strong core materials for reinforcing a laminated part. It is manufactured with a 1⁄4" cell, 5.2 lbs/cu. ft. density, and in 1⁄2", 3⁄4", and 1" thicknesses.Catalog Number Description Thickness Width Length054185 Aluminum Honeycomb 1⁄2" 4' 8'054188 Aluminum Honeycomb 3⁄4" 4' 8'054186 Aluminum Honeycomb 1" 4' 8'

Aramid Fiber Honeycomb Sandwich Panel This lightweight Aramid Fiber Honeycomb Core is laminated on both sides with epoxy and woven fiberglass 0.018" thick to produce a strong core material for reinforcing a laminated part. It is manufactured using aerospace grade Aramid fiber with a 1⁄8" cell and 3.0 lb./cu. ft. density. It meets FAR 25.853 specification for flame retardency.Catalog Number Description Thickness Width Length403706 Aramid Honeycomb 1" 4' 8'

Spherecore Core MaterialsFlat material made of short polyester fibers and embedded thermo-plastic microspheres for light and economical laminating jobs. It is ideal for stiffening a laminate and preventing the “print through” of woven fabrics on the part surface. Exclusively for hand layup applica-tions similar to chopped strand mat and woven roving requirements. Sizes below are the thicknesses and full roll lengths—widths are 100cm. Catalog Number Description Thickness

Length(Yds.)

403405 Spherecore 2 mm 77

52

Special ty Waxes

1.800.321.8511

Original SizesCatalog Number Description Thickness Width Length108003 Wax Block 1½" 2" 3"108011 Wax Block 1½" 3" 7"108021 Wax Block 3" 3" 7"108031 Wax Block 3" 4½" 7"108051 Wax Block 3" 5" 10"

Standard Block Sizes

Width x Length

Thickness2" 3" 4" 5" 6" 7" 8"

6" x 6" 108250 108300 108350 108400 108450 108500 1085526" x 12" 108252 108071 108352 108402 108452 108502 1085546" x 18" 108254 108304 108354 108404 108454 108504 1085566" x 24" 108256 108306 108356 108406 108456 108506 1085586" x 30" 108258 108308 108358 108408 108458 108508 1085606" x 36" 108260 108310 108360 108410 108460 108510 1085626" x 42" 108262 108312 108362 108412 108462 108512 1085646" x 48" 108264 108314 108364 108414 108464 108514 10856612" x 12" 108266 108316 108366 108416 108466 108516 10856812" x 18" 108268 108318 108368 108418 108468 108518 10857012" x 24" 108270 108320 108370 108420 108470 108520 10857212" x 30" 108272 108322 108372 108422 108472 108522 10857412" x 36" 108274 108324 108374 108424 108474 108524 10857612" x 42" 108276 108326 108376 108426 108476 108526 10857812" x 48" 108278 108328 108378 108428 108478 108528 10858018" x 18" 108280 108330 108380 108430 108480 108530 10858218" x 24" 108282 108332 108382 108432 108482 108532 10858418" x 30" 108284 108334 108384 108434 108484 108534 10858618" x 36" 108286 108336 108386 108436 108486 108536 10858818" x 42" 108288 108338 108388 108438 108488 108538 10859018" x 48" 108290 108340 108390 108440 108490 108540 10859224" x 24" 108222 108342 108392 108442 108492 108542 10859424" x 30" 108292 108344 108394 108444 108494 108544 10859624" x 36" 108294 108346 108396 108446 108496 108546 10859824" x 42" 108296 108348 108398 108448 108498 108548 10860024" x 48" 108298 108243 108244 108245 108246 108550 108248

Standard Cylinder SizesCatalog Number Description

Diameter(Nominal) Length

108114 Wax Cylinder 1" 12"108115 Wax Cylinder 1½" 12"108125 Wax Cylinder 2" 12"108135 Wax Cylinder 3" 12"108145 Wax Cylinder 4" 14"108155 Wax Cylinder 5" 16"108165 Wax Cylinder 6" 18"108175 Wax Cylinder 7" 18"

Non-Standard Sizes and Bulk Machinable WaxIn addition to the above blocks and cylinders, machinable wax is also available in custom sized blocks and cylinders.Catalog Number Description108099 Non-Standard Size Block108199 Non-Standard Size Cylinder108001 Bulk Wax 1-5 lb. pieces

Freeman Machinable Wax

Formulated & manufactured by Freeman, this unique medium is an extremely hard synthetic wax that machines faster than polyurethane and epoxy tooling boards or metals without sacrificing quality of finish, surface detail, or dimensional accuracy.

Machinable Wax is: Non-Abrasive – unlike metal and tooling boards that can cause significant wear on cutting tools. User-Friendly – machining produces chips instead of dust, for a cleaner work environment. Self-Lubricating – enables all machining operations to be performed without the need for coolants or cutting fluids. Able To Be Glued – to produce large or irregularly-shaped pieces for machining with the use of 3M #90 Hi-Strength Spray Adhesive (pg. 67).Available in a Wide Variety of Sizes – eliminating the waste associ-ated with using large tooling boards for smaller projectsSelf-Releasing & Self-Sealing – liquid tooling plastics, including epoxy, urethane, and silicone rubber may be poured into Machinable Wax without requiring the use of sealers or release agents.

Machinable Wax is used for: •ProducingAccurateMoldsandPrototypes•EducationasaTrainingAidMaterial•CNCSystemsSet-upandDemonstrations•ProofingCNCMachiningPrograms

Machinable Wax SpecificationsHardness (Shore D) 50-55Specific Gravity 0.92Flash Point 575° FSoftening Point 226° FVolumetric Shrinkage @ Room Temp. 7%Coefficient of Thermal Expansion (in./in. °F) 9.5 x 10-5

Color Blue

Machinable Wax Machining GuidelinesSpindle Speed Feed Rate

Roughing 3,000 rpm 100 inches per minuteFinishing 8,000-10,000 rpm 40-100 inches

per minute*Dataobtainedusinga½"ballendmill

How to Calculate Machinable Wax WeightLength x Width x Thickness (inches)

= Weight (lbs)28.8

Specialty Waxes


Specialty Waxes

Freeman Sheet Wax is used pri-marily to simulate metal or part thickness when making metal forming dies or punches, resin transfermolds(RTM),orany two part molds where a uniform part thickness is desired.

Formulated and manufac-tured by Freeman, our Sheet Waxes are available in two formulations;No.266Thermo-StableandNo.165Regular.Both formulations are available in plain back or easy to apply adhesive-back styles. Freeman Sheet Waxes are manufactured to a uniformthicknessof±.001".

To order Freeman Sheet Wax: Specify Type: No.266Hi-Temp No.165Regular

Specify Backing: Plain=PL(NoAdhesive) PressureSensitive=PS(AdhesiveApplied)

Specify Thickness: Inches Millimeters

Custom thicknesses are available with a 10 box minimum.

165 Regular Sheet WaxThislightyellowcolorwaxisformulatedtoprovidedurabilityandtranslucency.

This wax features:•Uniformthicknessaccuracyof±.001".•Firmsurfacefordurabilityanddepressionresistance.•Translucencyofsheetsupto1⁄8"thickmakingitexcellentfor

visualizing layout lines and transcribing engineering information.•Meltingpointof177°F.

165 Regular Sheet Wax (12" x 24")Inches Millimeters

165 Plain*

165Adhesive

165 Plain*

165Adhesive

0.007 0.007 0.20 mm 0.20 mm0.010 0.010 0.25 mm0.015 0.015 0.30 mm0.020 0.020 0.50 mm0.025 0.025 0.60 mm

0.030 0.75 mm 0.75 mm0.031 0.031 0.80 mm0.040 0.040 1.00 mm 1.00 mm0.050 0.050 1.25 mm0.060 0.060 1.50 mm0.063 0.063 2.00 mm 2.00 mm0.070 0.070 2.50 mm0.072 3.00 mm 3.00 mm0.080 0.080 5.00 mm0.090 0.090 0.094 0.094 0.100 0.100 0.125 0.125 0.156 0.1560.160 0.160 0.188 0.188 0.250 0.250

*Adhesive can also be applied manually using our Sheet Wax Spray Adhesive pg. 67

266 Hi-Temp Thermo-Stable Sheet WaxOur most popular sheet wax, this medium brown wax was developed primarily for use with tooling plastics to prevent wax deformation under exothermic heat conditions.

This wax features:•Uniformthicknessaccuracyof±.001".•Maximumflexibilityforformingquicklyandaccuratelytoany contouredsurface(moreflexiblethen165RegularSheetWax).

•Naturaldrapingcharacteristicsatroomtemperatureandabsence of memory (spring-back) eliminate the need to warm or temper wax.

•Meltingpointof282°F.

266 Hi-Temp Thermo-Stable Sheet Wax (12" x 24")Inches Millimeters

266 Plain*

266Adhesive

266 Plain*

266Adhesive

0.007 0.20 mm 0.010 0.25 mm

0.015 0.015 0.30 mm 0.018 0.40 mm

0.020 0.020 0.50 mm 0.025 0.60 mm 0.028 0.70 mm 0.030 0.75 mm 0.031** 0.80 mm 0.035 0.85 mm 0.040 0.90 mm 0.045 1.00 mm 0.047 1.20 mm 0.050 1.25 mm 0.055 1.30 mm 0.060 1.40 mm 0.063** 1.50 mm 0.065** 1.60 mm 0.070 1.70 mm 0.075 1.75 mm 0.080 1.80 mm 0.085 1.90 mm 0.090 2.00 mm 2.00 mm 0.094** 2.20 mm

0.100 0.100** 2.25 mm0.110 2.30 mm

0.116 2.40 mm 0.118 2.50 mm 0.120 2.60 mm

0.125 0.125** 2.70 mm0.140 2.75 mm

0.156 2.80 mm 3.00 mm 3.00 mm** 0.170 3.20 mm

0.188 0.188** 3.50 mm0.200 4.00 mm

0.219 4.50 mm0.250 0.250** 5.00 mm0.375 0.375 6.00 mm

0.500 7.00 mm 8.00 mm

*Adhesive can also be applied manually using our Sheet Wax Spray Adhesive pg. 67.

**Alsoavailablein6"x6"/152mmx152mmsheets

Freeman Sheet Wax

54

Special ty Waxes

1.800.321.8511

Fillet AccessoriesFillet ToolsFreeman’s high quality chrome platedsteelFilletToolsareaccurate diameters used to correctly and easily install wax or leather fillet.Catalog Number Description Radii046380 # 1 Fillet Tool 1⁄16" & 1⁄8"046385 # 2 Fillet Tool 3⁄16" & ¼"046390 # 3 Fillet Tool 5⁄16" & 3⁄8"046395 # 4 Fillet Tool ½" & 5⁄8"

Alcohol LampThischromeplatedbrassAlcoholLamp comes complete with snuffer cap attached by chain and an adjustable cotton wick. The7"longcottonwickraisesandlowers by hand screw.Catalog Number Description046730 Metal Alcohol Lamp (5 oz.)046735 Replacement Alcohol Lamp Wicks

Freeman String WaxString Wax is a round wax product that, when melted, is used as an adhesive to secure investment casting wax patterns to the gating system or for general wax pattern repair.Catalog Number Description Diameter

Approx.Length

Net. Wt. (Lbs.)

085606 Di-Dup String Wax – Roll 1⁄8" 440' 2085433 Fillet String Wax – Roll 1⁄8" 880' 4085209 Fillet String Wax – Box ¼" 292' 2

Freeman Half Round WaxThisspecialtywaxisextrudedtoauniformhalfroundshapemakingthis material ideal for mold registration when applied to the parting line of a mold surface. Manufactured using our Fillet Wax formulation, this material will not inhibit the curing of silicones, urethanes, or plasters. Catalog Number Radius Width Length

Net Wt.(Lb.)

085114 1⁄8" ¼" 24" 2085113 1⁄16" 3⁄8" 24" 2085112 5⁄16" 5⁄8" 24" 2085111 3⁄8" ¾" 24" 2

Freeman Fillet Wax

Freeman Wax FilletsFreeman Wax Fillets are made of a performance-proven, high melting point wax formulation for meeting a wide variety of pattern shop applications.

Freeman Wax Fillets:•Areeasilyappliedtostraightorirregularlyshapedsurfaces

because of their flexibility.•CanbepaintedusingourFreemanPatternLacquers.•Produceandmaintainaccurateradiiregardlessofapplication

conditions.•Canbeappliedtobarewoodorcoatedsurfaceswithoutthe

use of an adhesive by using a heated fillet tool.•Areavailableinrollsandboxes.

CatalogNumber Availability

FilletNo.

Dia./Radius

Approx.Length

Net Wt. (Lbs.)

085104 Box – 24" straight pieces 1R 1⁄16" D 1640' 2085208 Box – 24" straight pieces 2 1⁄8" R 1152' 2085212 Box – 24" straight pieces 3 3⁄16" R 460' 2085216 Box – 24" straight pieces 4 ¼" R 292' 2085220 Box – 24" straight pieces 5 5⁄16" R 240' 2085224 Box – 24" straight pieces 6 3⁄8" R 190' 2085228 Box – 24" straight pieces 7 7⁄16" R 144' 2085232 Box – 24" straight pieces 8 ½" R 106' 2085240 Box – 24" straight pieces 10 5⁄8" R 72' 2085248 Box – 24" straight pieces 12 ¾" R 44' 2085264 Box – 24" straight pieces 16 1" R 24' 2085302 Roll 00R 1⁄32" D 1500' 0.5085303 Roll 0R 3⁄64" D 1500' 1085304 Roll 1R 1⁄16" D 750' 1085408 Roll 2 1⁄8" R 500' 1085412 Roll 3 3⁄16" R 400' 1085416 Roll 4 ¼" R 175' 1085420 Roll 5 5⁄16" R 125' 1085424 Roll 6 3⁄8" R 85' 1085428 Roll 7 7⁄16" R 40' 1085432 Roll 8 ½" R 40' 1

Freeman Di-Dup Wax FilletFreemanDi-DupWaxFilletsare softer than our standard wax fillets and also have a lower melting point.Thesetwofeaturesmake them ideal for creating inside radii on expanded polystyrene foam patterns. Thismaterialiscutinto24"lengthsand packaged in two pound boxes.Catalog Number Description

Fillet No.

Dia./Rad

Approx.Length

Net Wt.(Lbs.)

085504 Di-Dup Fillets 4 ¼" R 350' 2085506 Di-Dup Fillets 6 3⁄8" R 175' 2085508 Di-Dup Fillets 8 ½" R 80' 2085510 Di-Dup Fillets 10 5⁄8" R 75' 2085512 Di-Dup Fillets 12 ¾" R 35' 2085516 Di-Dup Fillets 16 1" R 20' 2


Specialty Waxes

Blind Gauging WaxFreeman Blind Gauging Wax is specifically formulated for the checking of clearances between the fan and casing during the repair and main-tenenceofaircraftjetengines.Producedtoprecisethicknesses,thisspecialty wax is color-coded for easy identification on the shop floor.

BlindGaugingWaxismanufacturedin½"x11⁄4"adhesive-backedstrips,andpackaged100stripsperbox.Catalog Number Color Thickness1106__ Olive .020, .030, .040, .050, .060, .070, .080, .090, .1001106__ Grey .021, .031, .041, .051, .061, .071, .081, .091, .1011106__ Brown .022, .032, .042, .052, .062, .072, .082, .092, .1021106__ Yellow .023, .033, .043, .053, .063, .073, .083, .093, .1031106__ Black .024, .034, .044, .054, .064, .074, .084, .094, .1041106__ Orange .015, .025, .035, .045, .055, .065, .075, .085, .095, .1051106__ Red .016, .026, .036, .046, .056, .066, .076, .086, .0961106__ Green .017, .027, .037, .047, .057, .067, .077, .087, .0971106__ Blue .018, .028, .038, .048, .058, .068, .078, .088, .0981106__ Amber .019, .029, .039, .049, .059, .069, .079, .089, .099

Ordering Information: Add the last two digits of the thickness to the end of the catalog number to create the six digit number used to order.

Example:.103=110603,.029=110629

Freeman Core Vent WaxFreemanBrownCoreVentWaxisusedtoventoilsandcoresofcurvedorirregularshape.Thewaxisplacedincriticallocationsinthesandasthecoreismolded.Thewaxisdissipatedwhenthecoreisbaked, leaving a clean vent of high permeability.

Available in full round and half round shapes.CatalogNumber Description Dia. Height

Approx.Length

Net Wt.(Lbs.)

086001 Solid Core Vent Wax 1⁄32" 2300' ½086002 Solid Core Vent Wax 1⁄16" 875' 1086003 Solid Core Vent Wax 1⁄32" 325' 1086004 Solid Core Vent Wax 1⁄8" 800' 4086006 Solid Core Vent Wax 3⁄16" 350' 4086008 Solid Core Vent Wax ¼" 195' 4086012 Solid Core Vent Wax 3⁄8" 85' 4086016 Solid Core Vent Wax ½" 50' 4086020 Solid Core Vent Wax 5⁄8" 30' 4086117 Solid Core Vent Wax – Half Round ¾" 3⁄8" 41' 4086118 Solid Core Vent Wax – Half Round 5⁄8" 5⁄16" 75' 4086119 Solid Core Vent Wax – Half Round 3⁄8" 3⁄16" 150' 4086120 Solid Core Vent Wax – Half Round ¼" 1⁄8" 340' 4086121 Solid Core Vent Wax – Half Round 3⁄16" 1⁄8" 600' 4

Optical Soluble WaxFreeman Optical Soluble Wax is a high-quality investment casting wax specificallyformulatedfortheopticalandjewelryindustry.Thisproductis completely soluble in warm water and is ideal for making any design where a hollow area in the finished pattern is desired. It is also used in the optical industry for the manufacturing of intraocular lenses.

Catalog Number

NetDescription Weight (Lb.)

118423 Optical Soluble Wax 50

Sol-U-CarvA carvable wax that is water soluble, making it ideal for use in lost wax casting, especially in the making of cores, hollow beads, or other pieces that feature hollow areas.

Catalog Number

NetDescription Weight (Lb.)

115090 Sol-U-Carv 1

Miscellaneous WaxesBeeswax – Light YellowOur pure filtered Beeswax is a firm, light colored wax commonly used for modeling, engraving, and finishing leather, textiles, and wood.

Catalog Number

ApproximateDescription Weight (Lb.)

027220 Beeswax 1

Refined Paraffin Wax – WhiteThispetroleum-basedwaxisavailableina140°Fand150°F melting temperature formulation. Both have a crystalline or semi-crystalline structure.Catalog Number Description

Slab Weight (Lb.)

117734 Paraffin Wax 140 F – 2" x 10" x 14" 10117735 Paraffin Wax 150 F – 2" x 10" x 14" 10

MicroCrystalline Wax – Light YellowThislightyellow,petroleum-basedwaxislowinodorandhasasoft,sticky feel.Catalog Number Description

Slab Weight (Lb.)

117713 MicroCrystalline Wax – 2" x 10" x 14" 10

Sculpture Wax – Yellow, BrownWeoffertwostylesofsculptingwax.Thefirst,brownincolor,isamicrocrystalline petroleum-based wax that remains flexible at low temperatures.

Thesecondisayellow,petroleum-basedsculpturewax.Thismaterial offers low odor, is soft, and easily carvable.Catalog Number Description

BilletWeight (Lb.)

110355 Sculpture Wax – Yellow – 4" dia. x 20" 6117717 Sculpture Wax – Brown – 4" dia. x 20" 6

Victory Brown Wax – BrownThiswaxislesscrystallinethanparaffinwaxandremainsflexible at low temperatures. It may be used as an adhesive, in investment castings,andblendedinforcandle-making.Easilymoldedbyhand, it may also be used as a sculpture wax.CatalogNumber Description

SlabWeight (Lb.)

117715 Victory Brown – 1¾" x 12" x 19" 10

Miscellaneous Wax Specifications

Flash Pt.(°F)

NeedlePenetration

(77°F)MeltingPt. (°F)

Ash Content (%)

Beeswax 475 17 147 –Paraffin Wax 140 445 13 141 .002Paraffin Wax 150 485 10 151 .002Micro Wax 580 16 178 .002Sculpture Wax 572 16 167 .002Victory Brown 500 26 174 .002

Adhesives & Repair Mater ia ls

56 1.800.321.8511

Freeman TUF® Repair and Build-Up Materials

TUF SpecificationsMix Ratio Resin to Hardener by wt.

Gel Time (minutes)

Hardness (Shore D @ 24 hrs)

Viscosity (cps@77ºF)

Density (g/cc) Available Colors

TUF-Fil 100:1.5 11 81 912,000 1.74 Mahogany, Pine, GrayTUF-Fil White 100:1.5 9 95 400,000 2.50 WhiteTUF-Carv 100:1.5 10 71 581,000 1.14 Mahogany, Pine, WhiteTUF-Fil Hi-Temp 100:2.0 9 82 830,000 1.68 Dark GrayQuik-Fil 100:1.5 11 70 208,000 0.89 Brown

Formulated and manufactured by Freeman, TUF is a complete line of quality polyester repair & build-up materials which features:

•Lowshrinkage•Fastsetting,sandablein15minutes•Goodwearresistance•Bondstomostanysurface• “No-sag”properties•Goodchemicalresistance

TUF-Fil®

FreemanTUF-Filcloselymatchesmahoganyandotherhardwoodsinhardness.Itissuitableforhighwearapplications,andwhenfullycured, TUF-Fil may be scraped, filed, tapped and sanded. While it is stillrubbery,itcanbecarvedusingwoodworkingtools.Tuf-filGray(Aluminum)makesagreatrepairmaterialforgrayfixtureboards.Catalog Number Description Availability

Net Wt.(Lbs.)

053405 TUF-Fil Mahogany Quart 2.8053410 TUF-Fil Pine Quart 2.8053415 TUF-Fil Gray (Aluminum) Quart 2.8053425 TUF-Fil Mahogany Gallon 11.5053430 TUF-Fil Pine Gallon 11.5053435 TUF-Fil Gray (Aluminum) Gallon 11.5053428 TUF-Fil Mahogany 3 Gallon Cartridge 31.5053433 TUF-Fil Pine 3 Gallon Cartridge 31.5053437 TUF-Fil Gray (Aluminum) 3 Gallon Cartridge 31.5

Adhesives & Repair Materials

TUF-Fil® WhiteTUF-Fil White is the hardest of the TUF line of products. It is used for repairingepoxylaminatetooling.Catalog Number Description Availability

Net Wt.(Lbs.)

053420 TUF-Fil White Quart 3.8053440 TUF-Fil White Gallon 12.5053438 TUF-Fil White 3 Gallon Cartridge 31.5


Adhesives & Repair M

aterials

Freeman TUF Repair and Build-Up Materials [CONTD.]

Quik-FilQuik-Filisamodelingboardrepairpastedesignedspecificallyfortherepair,build-upandformingoffilletsonmedium-densitymodelingboards. It is similar in hardness to most 30-40 lb density boards and coloredbrowntomatchthemostpopularclassofmodelingboards.Quik-Filalsofeaturesexcellentbondingpropertieswithverylittlesag.Catalog Number Description Availability

Net Wt.(Lbs.)

053441 Quik-Fil Brown Quart 1.1053442 Quik-Fil Brown Gallon 4.4

Cream HardenerA premium quality white catalystdesignedforusewithall of the TUF Products. This product may also be used to catalyze other manufacturers’ polyester filler products. The brightwhitecolordoesnotsignificantlychangethecolorofthebasicresin.Catalog Number Description Availability053445 Cream Hardener 1 oz. Tube053450 Cream Hardener 4 oz. Tube

TUF Pneumatic DispenserA heavy duty, cast aluminum dispenserdesignedspecificallyforusewith3-galcartridgesofTUF-Fil, TUF-Carv, Econo-Fil, and Dynalite Products.

With this dispenser you have the convenience and eco-nomicalmeansofdispensingonlythe amount of product needed for any job with little to no waste ormess.Itsdesignpermitsittobe mounted anywhere in your shop for easy accessibility.Catalog Number Description053470 3 Gal. Dispenser For TUF Line053471 Replacement Spout For TUF-Fil Dispenser053462 Replacement Gasket For 3 Gallon Dispenser

SEE ALSO: Product Page No.Abrasives 90-95Fillet Shapers 59

TUF-Carv® FreemanTUF-CarvRepair&Build-UpMaterialisalessdense materialthanTUF-Fil,closelymatchingthehardnessofpineand jelutong.Itisidealforanyjobthatrequiresadurable,yetcarvablefinish. TUF-Carv, when cured, can be carved, sawed, sanded, filed, tappedandmachinedeasilywithwoodworkingtools.Catalog Number Description Availability

Net Wt.(Lbs.)

053205 TUF-Carv Mahogany Quart 1.75053210 TUF-Carv Pine Quart 1.75053213 TUF-Carv White Quart 1.75053215 TUF-Carv Mahogany Gallon 7053220 TUF-Carv Pine Gallon 7053223 TUF-Carv White Gallon 7053225 TUF-Carv Mahogany 3 Gallon Cartridge 21053230 TUF-Carv Pine 3 Gallon Cartridge 21053228 TUF-Carv White 3 Gallon Cartridge 21

Hi-Temp TUF-Fil®

Hi-TempTUF-filisidealfortherepair,build-uporalterationoftoolingthatwillbesubjectedtooperatingtemperaturesrangingfrom150°Fto350°F.Itfeatureshighviscosity,verygoodadhesivepropertieswhenusedoncompositetooling,fiberglass,epoxy,polyester,metal,RenShape550,RenShape5008,andwoodmaterialsandadarkgraycolorationcompatiblewithmosthightemperaturetooling.Catalog Number Description Availability

Net Wt.(Lbs.)

053451 Hi-Temp TUF-Fil Dark Gray Quart 2.5053452 Hi-Temp TUF-Fil Dark Gray Gallon 10053453 Hi-Temp TUF-Fil Dark Gray 3 Gallon Cartridge 30


58 1.800.321.8511

General Purpose Repair Materials

Polyurethane-Based Repair Materials

Maxim Fast Urethane Adhesive & Repair MaterialThisisablack,twocomponenturethanethatquicklyrepairsorgluesurethanemolds,parts,andpatternequipment.Itfeaturesa5minutegeltimeandmaybesandedormachinedin25minutes.Maximispackagedinacaulktypetubeandusesastandardcaulkingguntodispensebothcomponentsthroughastaticmixnozzle,eliminatingmeasuringandmix-ing.Itissuppliedwith2mixingnozzles,butadditionalnozzlesmaybepurchasedinpacksof12.Catalog Number Description Availability054285 Maxim Fast Urethane Adhesive 8.45 fl. oz.054286 Maxim Mixing Nozzles 12-pack

Ren Patch 5169 Foundry Board Repair PasteA red polyurethane repair material that closely matches Ren Shape 5169andRenShape5179forcolor,hardness,machinability,and thermalstability.Repairedareasblendverywellwiththesurroundingtool surface and the paste bonds securely to the board.Catalog Number Description Availability

Net Wt.(Lbs.)

056622 Ren-Patch 5169 50 ml 0.2

Devcon Flexane® 80 Urethane PuttyThisputtyformulationofFlexane80isanextremelytoughrepairmaterialandmayalsobeusedforlininghighwearparts.Catalog Number Description

Net Wt.(Lbs.)

054641 Devcon Flexane 80 Urethane Putty 4

Epoxy-Based Repair Materials

Devcon DE087 Wear Resistant PuttyThisblendedaluminum-filledepoxyputtyisusedtorepairfatiguedmetalsurfaceswhereexceptionaldurabilityandruggednessisrequired.Thisproductisusedtorepairmoldsatthepartingline where metal has been lost or worn and is commonly used to fill voidsincastings.Catalog Number Description

Mfg. No.

Net Wt.(Lbs.)

054638 Devcon Aluminum Wear-Resitant Putty DE-087 20

Devcon Aluminum PuttyThisaluminum-filledepoxyputtybondstoaluminumandmanyothermetalsfordependablenon-rustingrepairstocastings,machinery and equipment. It is commonly used to fill porosity in aluminum cast-ings,anditcanbemachined,drilled,ortappedusingconventional metalworkingtools.Catalog Number Description

Mfg. No.

Net Wt.(Lbs.)

054585 Devcon Plastic Aluminum Putty F-1 10610 1054590 Devcon Plastic Aluminum Putty F-3 10620 3

Devcon Fasmetal™ PuttyThishigh-performance,alumina-filledepoxyisusedformakingfastanddependableemergencyrepairstoleaksinpipescarryingores,coal, cement,sand,andgravel.Ithardensin5minutesandiseconomicalandconvenient.Itcanbeappliedintemperaturesaslowas40°F.Catalog Number Description

Mfg. No.

Net Wt.(Lbs.)

054643 Devcon Fastmetal Putty 10780 0.75

Devcon Plastic Steel® PuttyTheoriginalmetal-filledepoxyputtyusedforhundredsofroutinemaintenance,production,andtoolingapplications,especiallyinareaswhereweldingorbrazingwouldbeundesirableorimpossible.Bondsto most metals, concrete, and some plastics. It cures at room tem-peratureandformsatough,durable,metallicmassthatcanbedrilled,tapped, machined, or painted. The 5-Minute Putty is a faster version of the standard Plastic Steel Putty.Catalog Number Description

Mfg. No.

Net Wt.(Lbs.)

054555 Devcon Plastic Steel Putty 10110 1054560 Devcon Plastic Steel Putty 10120 4054565 Devcon Plastic Steel Putty 10130 25054582 Devcon 5-Minute Putty 10240 1

Devcon Titanium PuttyTitanium-reinforcedepoxyformakingrepairstomachineryandequip-mentthatcanbeprecisionmachined.Itfeaturesexcellenttemperatureresistance(350°F),highcompressivestrength,andresistancetomanychemicalsandmostacids,bases,solvents,andalkalis.Catalog Number Description

Mfg. No.

Net Wt.(Lbs.)

054631 Devcon Titanium Putty 10760 1

Devcon Bronze PuttyBronze-filledepoxyputtyforrepairingbronzeandbrassbushings,shafts,castingsandequipmentparts.Itrepairsandrebuildsareaswherebrazingwouldbeundesirableorimpossibleandbondssecurelyto bronze alloys, brass, copper, and ferrous metals. Can be machined, drilled,tapped,orgrindedusingconventionalmetalworkingtools.Catalog Number Description

Mfg. No.

Net Wt.(Lbs.)

054632632 Devcon Plastic Bronze Putty 10260 1

Lab-Metal & SolventLab-Metalisadurableandresilient,air-hardeningmetalfillerideal forfillingsandholes,smoothingroughspotsoncastingsorsealingriveted seams. It can be applied directly from the can or thinned for brushorsprayapplications.Lab-Metalwillbondtometal,wood, plastic,glass,orplasterwithouttheuseofspecialtoolsandmay be milled, drilled, tapped, and sanded smooth.

ThestandardLab-Metalformulationwithstandstemperaturesupto350°F.TheHigh-Tempformulationwhichcanwithstandtemperaturesupto1000°F.LabSolventisablendofsolventsusedtothinlabmetalfor spray or brush applications. Catalog Number Description Availability

Net Wt.(Lbs.)

027335 Lab-Metal Quart 3027337 Hi-Temp Lab-Metal Pint 1.5027330 Lab Solvent Pint 1

59www.freemansupply.com


aterials

General Purpose Repair Materials [CONTD.]

Polyester-Based Repair Materials

Mia Plas-FilThisisanexcellentcompoundforrepairingdefectsinfiberglass,metal,andwood.Usingthe cream hardener (included) as the catalyst, thispastematerialwillsolidifyinapproximately15minutesandisabletobesandedtoasmooth, durable finish.Catalog Number Description Availability

Net Wt.(Lbs.)

412515 Plas-Fil Gallon Gallon 7.72412195 Cream Hardener for Mia Plas-Fil Tube 2.75 oz.

Mia Gelcoat Repair KitsThis product is a paste consistency polyestergelcoatthatisusedfordurable,highqualityrepairsofboatdecksorhulls.TheColorKitcontainsa 2 oz jar of resin, five 7 ml vials of color pastes, appropriate amount of MEKPcatalyst,3tonguedepressors,andinstructionsheet.Theunpigmentedresinpermitstheadditionofa variety of polyester color pastes to custom blend different colors. Colorpastesareyellow,white,black,blue,andred.Theseresinshaveexcellentwaterresistanceandprovideaqualityfinishandgoodglossretention.Catalog Number Description Availability405005 Mia Gelcoat Repair Kit – Colors 2 oz. Kit405010 Mia Gelcoat Repair Kit – White 2 oz. Kit

Dynatron Dynalite™

Lightweight,carvable,sandable, and economically-priced, this polyester repair material is a useful material for a widerangeoftoolingalterationsandrepair.Catalog Number Description Availability

Net Wt.(Lbs.)

053502 Dynatron Dynalite Gallon 7.5053503 Dynatron Dynalite 3 Gallon Cartridges (2) 26053507 Dynatron Dynalite Cream

Hardener Tube 4 oz.

Dynatron Dyna-Plus™

Dyna-Plusisagoldcoloredpolyester filleridealforrepairingmetal,plastic, andwood.Lightweightforeasy application to vertical surfaces.Catalog Number Description Availability

Net Wt.(Lbs.)

053504 Dynatron Dyna-Plus Gallon 10

3M™ Marson Platinum Body FillerMarsonPlatinumBodyFillerisahighqualitypolyesterfillercompoundthatislightweightandadheresaggressivelytosteel,galvanizedsteel,andaluminum.Itssmooth,creamytexturemakesiteasytoapply.Availableinfullcasequantitiesoftwo(2)3-Galloncartridges.


Net Wt.(Lbs.)

053508 3M Platinum Filler 3 Gallon Cartridges (2) 21.55

USC Base Coat/Clear Coat™

This polyester filler provides a very smooth, self-levelingsurfaceforhighqualityrepairprojects. Thisfillerprovidesextraadhesiontogalvanized,zinc treated, and aluminum surfaces. Includes raspberry cream hardener.Catalog Number Description

Mfg. No. Availability

Net Wt.(Lbs.)

053510 USC Base Coat/Clear Coat 16060B Gallon 7.75

USC Feather-Rite®

Feather-Riteisanexcellentcompoundforrepairsonfiberglass,metal,or wood. This product will not load sandpaper, features a smooth andcreamyconsistency,andhasexcellentfeather-edgingproperties.Includes red cream hardener.Catalog Number Description


Net Wt.(Lbs.)

053515 USC Feather-Rite 21330 Gallon 7.75

USC Duraglas® Fiberglass Reinforced Polyester FillerDuraglasisreinforcedwithfiberglassfiberstoincreasestrengthforlargerrepairs.Idealforrepairingholes,rustedoutareas,andcracksinmetal.Alsobondswelltowoodandfiberglass.Includeswhitecreamhardener.Catalog Number Description


Net Wt.(Lbs.)

053520 USC Duraglass 24030 Gallon 11.75

Fillet ShapersMadeofhighqualityspringsteel,thissetoffourfillettoolsisidealforcreatingfillets from TUF-Fil, TUF-Carv, or any epoxypastematerial.Eachtoolis5¾"longandisgroundtoasmoothradius.Radius sizes are 1/16",1/8",3/16",1/4",5/16",3/8",1/2".Catalog Number Description Availability046375 Fillet Shapers Set of 4


60 1.800.321.8511

Epoxy Adhesives

Epoxy Adhesives Specifications

Product

Mix Ratio Resin to Hardener

(Wt.)

Mix Ratio Resin to Hardener

(Vol.)Gel Time

(min.)

Light Handling

Time

Cure Time @ 73°F

(hr)

Mixed Viscosity

(cps.)Hardness (Shore D)

Lap Shear Strength

(psi)

Peel Strength

(pli)

Tensile Strength

(psi)

Servicable Temperature/

Max (°F) ColorFreeman Fast Set 505 1:1 1:1 5 15 min 4 10,400 85 – – 2,500 200 ClearFastweld 10 1:1 1:1 4 10 min 4 250,000 85 2,840 – 3,850 – Gray5-Minute Epoxy 1:1 1:1 3-6 15 min 1 10,000 85 – – 1,400 200 Lt. AmberAraldite 2010-1 1:1 1:1 10 30 min 3 80,000 78 3,300 46 – 175 Pale YellowAraldite 2011 100:80 1:1 105 7 hours 10 45,000 80 2,700 29 4,800 175 Pale YellowAraldite 2012 1:1 1:1 4 20 min 1.75 30,000 82 2,700 31 – 175 Pale YellowAralidte 2013 100:60 1:1 75 4 hours 10 Paste 80 2,600 23 5,000 160 GrayAraldite 2014 2:1 2:1 40 4 hours 5 90,000 84 2,600 17 5,500 285 GrayAraldite 2015 1:1 1:1 40 4 hours 10 Paste 75 2,400 29 3,400 212 BeigeASI MP 5405 1:1 1:1 3-5 – 24 12,500 80 – – 7,000 266 ClearASI MP 5430 1:1 1:1 20-30 – 24 12,500 80 – – 7,000 266 ClearASI MP 54110 1:1 1:1 8-12 30-60 min 24 15,000 80 – 35 2,300 266 ClearASI MP 54460 100:47 2:1 20 – 24 50,000 77 3,700 25 6,600 302 Off-WhiteASI MP 54750 100:85 1:1 60-90 – 24-48 15,000 80 – – 7,000 – ClearAY557/HY557 1:1 1:1 4 10 min 4 14,000 83 2,560 – 4,630 – ClearAW1253/HV1253 100:82 1:1 20 4 hours 6 Paste 73 1,990 – 2,130 – BrownAW1258/HV1258 1:1 1:1 23 4 hours 6 Paste 89 2,840 – 5,600 – GrayAV8503/HV8503 100:92 1:1 30 3 hours 24 250,000 78 3,380 – 3,400 250 Blue-GreenAW8594/HY994 100:40 100:55 75 – – 7,500 85 3,410 – 6,600 164 WhiteAW136/HY994 100:40 100:55 75 – – 7,500 85 3,410 – 6,660 212 BlackAraldite 8579 100:40 100:40 60 8 hours 8 125,000 – 2,500 – – 248 GrayTDR-1100-11 100:42 2:1 95 8 hours 24 13,000 85 4,100 – 9,000 195 Clear

Freeman Fast Set 505 Epoxy AdhesiveFreeman Fast Set 505 is a rapidcuring,twocompo-nentepoxyadhesive.Withageltimeof5minutes,partsgluedwiththisproductmaybehandledin15minutes.Designedwithacolorindi-cator to ensure complete mixing.Freeman505isexcellentforbondingmetal,wood,ceramic,fiberglass,and most RenShape mod-eling&stylingboards.

FreemanFastSet50550mlcartridgesincludeonestaticmixnozzle.FreemanFastSet505GallonwithDispensingPumps(055356)hasconvenienthandpumpsforeasydispensing.Onepumpofresinandonepumpofhardenergivestheexactratio.Catalog Number Description Availability

Net Wt.(Lbs.)

055352 Freeman Fast Set 505 50 ml 0.12055350 Freeman Fast Set 505 Pint 2055355 Freeman Fast Set 505 Gallon 16055356 Freeman Fast Set 505 with Pumps Gallon 16

Fastweld 10 Epoxy AdhesiveThisfast-settingepoxyadhesiveis idealforthebondingofsmallparts forrepairwork.Fastweld10will cure at temperatures as low as 5°C(41°F).Catalog Number Description Availability

Net Wt.(Lbs.)

056505 Fastweld 10 50 ml 0.12056512 Fastweld 10 Tube 9 oz. Tube 0.56056511 Fastweld 10 Tubes 24 pk of 9 oz. Tubes 13.5

Devcon 5-Minute EpoxyAwidelypopular,rapid-curing,lowviscosity,general-purposeadhesive/encapsulantwhicheasilydispenses,mixesinseconds,anddriesin15minuteswithfullstrengthin1hour.Itbondsrigiddurablesubstratessuchasmet-als,glass,ceramics,concrete,andwoodinallcombinations,formingaclearhardrigidbondthat self-levels in minutes.Catalog Number Description


Net Wt.(Lbs.)

054647 Devcon 5-Minute Epoxy 14270 50 ml 0.12054618 Devcon 5-Minute Epoxy 14210 2.5 oz Tube 2.5054620 Devcon 5-Minute Epoxy 14200 15 fl. oz. 1054634 Devcon 5-Minute Epoxy 14630 9 lb. 9

Freemanoffersabroadlineoftwo-componentepoxyadhesives forbondingawiderangeofmetalsandplastics.Epoxyadhesivesconsistofanepoxyresinplusahardener.Theyallowgreatversatilityin formulation since there are many resins and many different harden-ers.Theyformextremelystrongdurablebondswithmostmaterials,especially metals.

61www.freemansupply.com


aterials

Epoxy Adhesives [CONTD.]

Araldite 2000 Series Epoxy Adhesives

TheAralditelineofurethane,epoxy,andmethacrylateadhesivesisadiverseselectionengineeredtobondawidevarietyofmaterials,includingthemostchallengingmetals,composites,andthermoplas-tics.Withformulationsdesignedtobonddozensofmaterialsandgeltimesrangingfrom4minutesto1-1/2hours,Aralditeisthemost versatilelineofadhesivesforthewiderangeofbondingapplications.

Araldite 2010-1 Epoxy Adhesive Thisfastsettingepoxyadhesiveisidealforbondingmetal,ceramics,rubber,plastics,andglass.Araldite2010-1featuresa10minute geltime,ahandlingstrengthof30minutes,andathickviscosity for vertical applications.Catalog Number Description Availability

Net Wt.(Lbs.)

056400 Araldite 2010-1 Adhesive 50 ml 0.13

Araldite 2011 Epoxy Adhesive Thisepoxyadhesivefeatureshighshearstrengthandgoodresistancetodynamicloading.Roomtemperaturecureandlong120minuteworklife.Strongbondingtometals,ceramics,rubbersandrigidplastics.Catalog Number Description Availability

Net Wt. (Lbs.)

056451 Araldite 2011 Adhesive Cartridge 50 ml 0.12056449 Araldite 2011 Adhesive Cartridge 200 ml 0.46056447T Araldite 2011 (AW 106/HV 953) 3.6 oz Tubes (2) 0.46056480Q Araldite 2011 Adhesive Quart 4056480 Araldite 2011 Adhesive 6 Quarts 24056409 Araldite 2011 Adhesive (AW 106) Resin Only 2 Gallons 17.60056463 Araldite 20111 Adhesive (HV 953) Hardener Only 2 Gallons 14.08

Araldite 2012 Epoxy AdhesiveToughepoxyadhesivefeatureshighshearstrengthandfour minuteworklife.Roomtemperaturecure.Strongbondingtometals,ceramics and rubbers.Catalog Number Description Availability

Net Wt. (Lbs.)

056452 Araldite 2012 Adhesive 50 ml 0.13

Araldite 2013 Epoxy AdhesiveGap-fillingepoxyadhesivefeaturesgoodenvironmentalstabilityandchemical resistance. For use on metals, ceramics and rubbers.Catalog Number Description Availability

Net Wt.(Lbs.)

056453 Araldite 2013 Adhesive 50 ml 0.18056756 Araldite 2013 Adhesive 200 ml 0.71056467 Araldite 2013 (AV 144-2) Adhesive Resin Only 5 Gallon 50056468 Araldite 2013 (H 997) Adhesive Hardener Only 5 Gallon 30

Araldite 2014 Epoxy AdhesiveGap-filling,no-sagepoxyadhesivefeaturesexcellentresistancetowaterandchemicals.250°Fheatresistance.Roomtemperaturecure.For use on metals and electronic components.Catalog Number Description Availability

Net Wt.(Lbs.)


Araldite 2015 Epoxy AdhesiveSag-resistant,toughepoxyadhesivewithgoodshearstrength. Roomtemperaturecure.Idealformetals,sheetmoldingcompoundsandfiberglassreinforcedparts.Catalog Number Description Availability

Net Wt.(Lbs.)

056455 Araldite 2015 Adhesive 50 ml 0.16056430 Araldite 2015 Adhesive (XB 5308) Resin Only 5 Gallon 50056431 Araldite 2015 Adhesive (5309-1) Hardener Only 5 Gallon 50

Adhesive Systems, Inc. (ASI) Epoxy Adhesives

AdhesiveSystemsoffersaboardrangeofepoxyadhesives specificallydesignedforstructuralbonding,potting,andencapsulatingapplications. ASI offers a diverse selection of cure times, viscosities, and performance properties to meet the specific needs of almost any bondingapplication.

ASI MP 5405 Epoxy AdhesiveASIMP5405isatwopartunfilledepoxyadhesivedesignedforceramics,andmostplastics.Itcurestoatoughsemi-rigidmaterialandisfreeflowinginviscosity.Itfeaturesgoodresistancetowater,saltspray,inorganicacidsandbases,andmostorganicsolvents.Itwasspeciallyformulatedtoa1:1mixratioforuseineitherdispensingequipmentorside-by-sidedualcartridges.Catalog Number Description Availability

Net Wt.(Lbs.)

414850 MP 5405 Adhesive 50 ml 0.2

ASI MP 5430 Epoxy AdhesiveASIMP5430isatwocomponentepoxyadhesivedesignedforceramicsandmostplastics.Featuresincludea1:1mixratio,curestoaclearsemi-rigidbond,andishighlyresistanttowaterandmostorganicsolvents.Catalog Number Description Availability

Net Wt.(Lbs.)

414874 MP 5430 Adhesive 50 ml 0.2

ASI MP 54110 Epoxy AdhesiveASIMP54110isaclear,twopart,unfilledepoxyadhesive.Itisdesignedforbondingmetals,ceramics,andmostplastics.Thisprod-ucthasgoodwater,saltwater,andchemicalresistance.Itoffersa1:1mixratioforeaseofuse.Normalroomtemperaturehandlingstrengthcan be reached in 30-60 minutes.Catalog Number Description Availability

Net Wt.(Lbs.)

414880 MP 54110 Adhesive 50 ml 0.2

ASI MP 54460 Epoxy AdhesiveASIMP54460isamediumviscosityepoxy/copolymerresinformula-tionrecommendedforindustrialbonding,smallpottingandlaminatingapplicationswhereexcellentstructural,mechanicalandelectricalpropertiesarerequired.Thistwo-partadhesiveexhibitsgoodwetting,curesatroomtemperatureanddevelopsstrong,lowshrinkagebondstomostmaterialsincludingopticalfibers,glassceramics,mostmetalsandmanyrigidplastics.Ithasexcellentdimensionalstabilityoverawidetemperaturerange.Catalog Number Description Availability

Net Wt.(Lbs.)

414934 MP 54460 Adhesive 50 ml 0.2

ASI MP 54750 Epoxy AdhesiveASIMP54750isaversatiletwocomponentepoxyadhesiveusedforbondingbondingandpottingapplicationsinelectroniccomponents.Flowswellandcurestoatoughsemi-rigidpolymer.Goodresistancetowaterandorganicsolvents.Catalog Number Description Availability

Net Wt.(Lbs.)

414952 MP 54750 Adhesive 50 ml 0.2


62 1.800.321.8511

Epoxy Adhesives [CONTD.]

Other Araldite Epoxy Adhesives

Araldite AY 557 / HY 557 Epoxy AdhesiveThisepoxyadhesiveisfastsettingforquickrepairstosmallparts.Suggestedformetalbonding,thismaterialisalsogreatforgluingmosttoolingboardsandsomeplastics.Onetoonemixratioand10minutehandlingstrengthmakesthisadhesiveeasytouseforfastgluing.Catalog Number Description Availability

Net Wt.(Lbs.)

056483 Araldite AY 557 Resin Only 5 Gallon 45056484 Araldite HY 557 Hardener Only 5 Gallon 45

Araldite AV 1253 / HV 1253 Epoxy AdhesiveAmahogany-colored,carvablepaste.You can easily sand it, carve it and tool itusingtypicalwoodworkingtools.Itisrecommended for the repair and bond-ingofwoodproducts.Catalog Number Description Availability

Net Wt.(Lbs.)

056513Q Araldite AV 1253 Resin Only Quart 1.5056515Q Araldite HV 1253 Hardener Only Quart 1.2056513 Araldite AV 1253 Resin Only 6 Quarts 9056515 Araldite HV 1253 Hardener Only 6 Quarts 7.4

Araldite AV 1258 / HV 1258 Epoxy AdhesiveAnaluminum-filled,general-pur-pose paste that is recommended forgeneralbondingrepairandgapfilling.Itmachineseasily.Catalog Number Description Availability

Net Wt.(Lbs.)

056641 Araldite AV 1258 / HV 1258 Tube 0.7056507 Araldite AV 1258 / HV 1258 Case of 24 Tubes 16.5056499 Araldite AV 1258 Resin Only 6 Quarts 18056501 Araldite HV 1258 Hardener Only 6 Quarts 18056407 Araldite AV 1258 Resin Only Gallon (2) 22056427 Araldite HV 1258 Hardener Only Gallon (2) 22

Araldite AV 8503 / HV 8503 Epoxy AdhesiveAralditeAV8503/HV8503isahighviscosity,twocomponent,epoxyadhesivethatisspecificallydesignedforbondingsheetmoldingcom-pound(SMC).Thisproductcanbeheatacceleratedforfastercuringandhasamaximumservicetemperatureof250°F.Catalog Number Description Availability

Net Wt.(Lbs.)

056758 Araldite AV 8503 Resin Only 6 Quarts 14.5056759 Araldite HV 8503 Hardener Only 6 Quarts 13.4

Araldite AW 8594 / HY 994 Epoxy AdhesiveAralditeAW8594/HY994isatwo-partlaminatingsystemfor fabricatingsnowskis,snowboards,andothercompositeparts. A heat cure is recommended for optimal results.Catalog Number Description Availability

Net Wt.(Lbs.)

056438 Araldite AW 8594 Resin Only 5 Gallon 52056414 AralditeHY 994 Hardener Only 5 Gallon 34.5

Araldite AW 136 / HY 994 Epoxy AdhesiveThisproductisablack,highstrengthepoxyadhesiveusedtobondavarietyofsubstrates.Featuresincludealonggeltimeandservicetemperaturesto212°F.Catalog Number Description Availability

Net Wt.(Lbs.)

056423 Araldite AW-136 Resin Only 6 Quarts 15.3056425 Araldite HY 994 Hardener Only 6 Quarts 10.9

Araldite 8579 Epoxy AdhesiveAraldite8579EpoxyAdhesiveisathixotropic,roomtemperaturecur-ingpastethatspreadseasilyandhasgoodgapfillingcharacteristics.Itisheatresistantto248°Fandoffersgoodchemicalresistance.Catalog Number Description Availability

Net Wt.(Lbs.)

056479 Araldite 8579 Resin Only 6 Quarts 13.2056478 Araldite 8579 Hardener Only 6 Pints 5.3

Araldite TDR 1100-11 Epoxy AdhesiveToughepoxyadhesiveforbondingfiberglass,plastics,andwood.Excellentresultswhenheatcuringabove160°F.Catalog Number Description Availability

Net Wt.(Lbs.)

056419 Araldite TDR 1100-11 Resin Only 5 Gallon 35056420 Araldite TDR 1100-11 Hardener Only 5 Gallon 35

Basics of Adhesive ChemistriesEpoxies:Epoxyadhesivesconsistofanepoxyresinplusahard-ener.Theyallowgreatversatilityinformulationsincetherearemanyresinsandmanydifferenthardeners.Theyformextremelystrongdurablebondswithmostmaterials,especiallymetals.

Methacrylates:Amodifiedtypeofacrylic,thesetoughenedadhesivesarefast-curingandofferhighstrengthandtoughness.Supplied as two parts (resin and catalyst), they tolerate minimal surfacepreparationandbondwelltothewidestrangeofmaterials.Theproductsareavailableinawiderangeofcurespeedsandasliquidsorpasteswhichwillgap-fillupto5mm.

Polyurethanes: Polyurethane adhesives are commonly one part moisturecuringortwo-part.Theyprovidestrongresilientjoints,whichareresistanttoimpact.TheyareusefulforbondingGRP(glassfiber-reinforcedplastics)andmanythermoplasticmaterials.

Cyanoacrylates: A special type of acrylic, cyanoacrylate adhe-sivescurethroughreactionwithmoistureheldonthesurfacestobebonded.Theyneedclose-fittingjoints.Usually,theysolidifyinseconds and are suited to small plastic parts and to rubber.

Hot Melts: Relatedtooneoftheoldestformsofadhesive,sealingwax,today’sindustrialhotmeltsarebasedonmodernpolymers.Hotmeltsareusedforthefastassemblyofstructuresdesignedtobeonlylightlyloaded.



aterials

Araldite 2021 Methacrylate AdhesiveMulti-purposeadhesivethatfeaturesa3minutegeltimeandan8minutehandlingstrengthforfast,effectivebondingofABS,PVC,acrylic, polycarbonate, as well as most metals.Catalog Number Description Availability

Net Wt.(Lbs.)


Araldite 2022 Methacrylate AdhesiveThisisatoughenedadhesivethatfeaturesa10minutegeltimeandan18minutehandlingstrengthforfastbondingofthermosetcompos-ites,ABS,PVC,acrylic,polycarbonate,andmetal.Thismaterialisalsooffersexcellentresistancetogasolineandoils.Catalog Number Description Availability

Net Wt.(Lbs.)


ASI MP 55300 Methacrylate AdhesiveMP55300formsatough,durablebondstomanysubstratesincluding,plastic,compositesandmetal.Surfacecleaningorpreparationisnotrequired in most cases or the use of primers or chemical wipes. This isfastcuringproductandfixturein10-12minutes.Catalog Number Description Availability

Net Wt.(Lbs.)

415150 MP 55300 Adhesive Natural 50 ml 0.25415152 MP 55300 Adhesive Natural 400ml 1.30415154 MP 55300 Adhesive White-HV 400ml 1.30415151 MP 55300 Adhesive Natural 10 Gal Unit 90.0

ASI MP 55305 Methacrylate AdhesiveMP55305isa1:1mixratioadhesivedesignedforbondingawiderangeofthermoplastics,composites,andmetals.MP55305hasexcellentimpactresistanceandisthixotropicforapplicationson verticalsurfaces.Thisproductisfastcuringwitha3-5minuteworkingtimeandpartsmaybehandledin6-10minutes.Catalog Number Description Availability

Net Wt.(Lbs.)

415156 MP 55305 Natural Adhesive 50 ml 0.20415158 MP 55305 Natural Adhesive 400 ml 1.30415157 MP 55305 Natural Adhesive 10 Gal Unit 90.0

Methacrylate Adhesives

Product

Mix Ratio Resin to

Hardener (Wt.)

Mix Ratio Resin to

Hardener (Vol.)

Gel Time (min.)

Light Handling

Time (min.)

Cure Time @ 73°F

Mixed Viscosity

(cps.)Hardness (Shore D)

Lap Shear Strength (psi)

Peel Strength

(pli)Tensile

Strength (psi)

Max Servicable Temperature

(°F) ColorAraldite 2021 10:9 1:1 3 8 20 min 45,000 78 3,200 63 – 230 BeigeAraldite 2022 100:94 1:1 10 18 30 min 60,000 75 3,600 23 – 212 Pale YellowMP 55300 1:1 1:1 4-6 10-15 – 50,000 – 3,000-3,500 – 3,000-3,500 250 Off WhiteMP 55305 1:1 1:1 3-5 6-10 – 50,000 – 3,000-3,500 – 3,000-3,500 250 Off WhiteMP 55310 1:1 1:1 10-18 20-35 – 50,000 – 3,000-3,500 – 3,000-3,500 250 Off WhiteMP 55320 10:1 10:1 8-12 25-30 – 90,000 – 3,000-3,500 – 3,000-3,500 180 Off WhiteMP 55420 10:1 10:1 4-6 15-20 – 90,000 – 1,750-2,800 – 2,500-3,500 250 Off WhitePlastic Welder – 1:1 10-15 45-60 24 hrs 50,000 78 – 35-40 3,500 250 Black

ASI MP 55310 Methacrylate AdhesiveMP55310isa1:1mixratioadhesivethatfeaturesalongworktimeof10-18minutesforbondinglargerparts.Excellentforgluingcomposites,thermoplastics,andmetals.Thisproductalsohasgoodchemicalandimpact resistance.Catalog Number Description Availability

Net Wt.(Lbs.)

415162 MP 55310 Adhesive 50 ml 0.20415164 MP 55310 Adhesive 400 ml 1.30415166 MP 55310 Adhesive 10 Gal Unit 80.6

ASI MP 55320 Methacrylate AdhesiveMP55320isa10:1mixratioadhesivespecificallydesignedforbond-ingplastics,metals,andcomposites.Thisproductfeaturesan8-12minuteworkingtimeandpartsmaybehandledin25-30minutes.MP55320alsofeaturesexcellentchemicalandenvironmentalresistance.Catalog Number Description Availability

Net Wt.(Lbs.)

415168 MP 55320 Adhesive 380 ml 1.25

ASI MP 55420 Methacrylate AdhesiveMP55420isa10:1mixratioadhesivethatfeaturesa4-6minuteworkingtimeforfastassemblyofplastic,metal,orcompositeparts.Partsmaybehandledin15-20minutes.FullycuredpartsbondedwithMP55420haveexcellentresistancetothermalcyclingandresistancetoawiderangeofchemicals.Catalog Number Description Availability

Net Wt.(Lbs.)

415199 MP 55420 Adhesive 380 ml 1.25

Devcon Plastic Welder Methacrylate AdhesiveToughenedstructuraladhesiveformulatedforbondingdifficult-to-bondsubstratessuchasnyloncontainingalloys,modifiedpolyesters, epoxycompositesandstandardplastics.Thisonetoonemixratio methacrylatefeaturessuperiorbondstrength,durability,andimpactresistance.PlasticWelderhasacreamyconsistencywithexcellent gapfillingcapabilitiesandgoodpeelstrengthinallenvironments.

Catalog Number Description Mfg. No. Availability054646 Devcon Plastic Welder Black DA290 47 ml

Freeman offers a broad line of Araldite, ASI, and Devcon two-component methacrylateadhesives.Allareformulatedforeasyhandlingand aregenerallyexcellentforbondingthermoplastics,composites,andsomemetals.Methacrylatesareusuallythebestchoiceforbondingdissimilar substrates.


64 1.800.321.8511

Cyanoacrylate Adhesives

A complete line of cyanoacrylate adhesives and accessories for vari-ousbondingapplications.Thesefastsettingmaterialsaredesignedformetal,wood,plastic,andtoolingboardadhesiverequirements.

Freeman F-Bond Instant CA AdhesivesF-Bond Thin –Generalpurposeandextremelyfastsetting.F-Bond Medium –Rapidsettingmedium viscosity adhesive.F-Bond Thick –Rapidsettinghighvis-cosity,idealforgapfillingapplications.F-Bond Gel –Thixothropicformulationwhichallowsforuseon vertical applications.F-Bond Flex Black –Formulatedwithaflexiblerubberfillerwhichallowsforhighvibrationandshockapplications.Catalog Number Description

Viscosity(cps) Availability

055300 Freeman F-Bond Thin 3 2 oz055307 Freeman F-Bond Thin 3 8 oz055301 Freeman F-Bond Medium 250 2 oz055308 Freeman F-Bond Medium 250 8 oz055302 Freeman F-Bond Thick 1500 2 oz 055309 Freeman F-Bond Thick 1500 8 oz055303 Freeman F-Bond Gel Thixotropic 20 grams055311 Freeman F-Bond Flex Black Thick 1500 2 oz

Freeman F-Bond AccessoriesF-Bond Accelerator – Use to accelerate cure time and increase gap-fillingcapabilities.F-Bond Dosing Tips –High-quality precision application replacement tips for our 2 oz. bottles.F-Bond Piercing Cap – A needle point captopreventdispenserclogging.Catalog Number Description Availability055304 Freeman F-Bond Accelerator (with pump) 2 oz055324 Freeman F-Bond Accelerator Aerosol 10 oz055305 Freeman F-Bond Accelerator 8 oz055315 Freeman F-Bond 8 oz Cap055314 Freeman F-Bond Dosing Tips for 2 oz Bottles055316 Freeman F-Bond Piercing Cap

Devcon ZipGrip® AdhesiveAlowviscosity(20cps),single-component cyanoacrylateadhesiveforclose-fittingparts.ZipGripbondsinsecondstorubber,fixturing rubbergaskets,splicingo-rings,repairingplasticsandmetals.Itisalsohighlyresistanttoaging andweathering.Catalog Number Description


054629 ZipGrip GPE 3 70144 14 grams

Polyurethane Adhesives

Araldite two-component polyurethane adhesives are formulated for easyhandlingandaregenerallyexcellentforbondingawidevarietyofplasticmaterialsandaregoodforsomemetalapplications.

Araldite 2018 Polyurethane AdhesiveThistwocomponentpolyurethaneadhesiveisspecificallydesignedforbondingthermoplasticmaterials.Araldite2018remainsflexibleandfeaturesgoodUVstabilityandlowshrinkage.Catalog Number Description Availability

Net Wt.(Lbs.)


Araldite 2040 Polyurethane Flexible AdhesiveGeneral-purposegrayadhesivewitha15min.worktimeand alighthandlingtimeof10hours(thatcanbeacceleratedwithheat).Forbondingplastic,polycarbonateandnylon.Curesto a 30 Shore D hardnessCatalog Number Description Availability

Net Wt.(Lbs.)


Araldite 2042 Polyurethane AdhesiveEnvironmentally stable and impact-resistant. It offers a 2.5 minute worktimeandalighthandlingtimeofonehour(thatcanbeacceler-atedwithheat).ItissuitableforbondingpolycarbonateABS,FRP,SMC and nylon and materials with different coefficients of thermal expansion.Curestoan85ShoreAhardness.Catalog Number Description Availability

Net Wt. (Lbs.)


Araldite AY 8683/HY 8683 Polyurethane AdhesiveAraldite AY 8683 / HY 8683 polyurea elastomeric adhesive is a two-componentsystemformulatedforfilter-bondingapplications.Thispolyureaelastomerhasa100:60mixratio,aquicksettime15min-utes.Becauseofitslowviscosity,itcanbeconvenientlymixedbyhandorviameter-mixequipment.Itcuresatroomtemperaturetoa 95ShoreAhardness.Catalog Number Description Availability

Net Wt.(Lbs.)

056439 Araldite AY 8683 5 Gallon 40056441 Hardener HY 8683 5 Gallon 24



aterials

Adhesive Dispensing Guns and Static Mix Nozzles

50 ml Cartridge Dispensing Gun ThisdispensinggunisdesignedtobeusedwithHuntsman, Araldite, Devcon, RenPatch, and ASI 50 ml adhesivecartridges.Thegunincludestwoinserts,onefordispensing1:1mixratiomaterialsandtheotherfordispensing2:1mixratiomaterials.Catalog Number Description056460 50 ml Dispensing Gun (Manual)

Caulking Gun and 50 ml Conversion KitThe50mlconversionkitis a plastic adaptor unit that is used in conjunction withastandard9"caulkinggun.Thisproductisalowcost alternative to the 50 mlDispensingGun(part#056460)whenthenumberof50mlcartridgesuseddoesn’tjustifythecostofadedicateddispensinggun.

ItissuggestedforusewithourHeavyDutyCaulkingGun(057120),butwillfitallstandard9"models.CaulkingGunand50mlConversionKitsoldseparately.Catalog Number Description057120 Caulking Gun (Heavy Duty)415480 Caulking Gun Conversion Kit

50 ml Static Mix Nozzle – RoundThese50mlstaticmixnozzlesare of the conventional round designandarethemostwidelyusedthroughtheindustry.Witha.250insidediameterand21 elements,theyareusedforeffectiveandcompletemixingofmostall50mladhesivecartridges.Theyaresixinchesinoveralllength.Catalog Number Description056488 50 ml Round Static Mix Nozzles

50 ml Static Mix Nozzle – SquareThese50mlstaticmixnozzlesarethesuggestedmixnozzleforall Adhesive System, Inc. (ASI) and Huntsman 50 ml adhesive cartridges.Itspatentedsquaredesign,with20elementspernozzleandanelementwidthof.203inches,providessuperiormixingperfor-mance,whilebeingabouttwo-thirdsthelengthofroundspiralmixers.Thisdesignresultsinlessadhesivewaste,whileensuringconsistent,highqualitymixing.

Thisnozzlefitsnearlyall50mladhesivecartridgesduetothebelldesign.Theyare4.03inchesinoveralllength.Catalog Number Description415802 50 ml Square Static Mix Nozzles

50 ml Static Mix Nozzle – MiniThese small 50 ml Mini Nozzlesareusedtominimizeadhesive waste to the greatestdegreewhenusing50mlcartridges.Thisnozzleisonlysuitableforlowerviscosityadhesivesandtestingshouldbeconductedtoensurethoroughmixingandproperdispensing.Witha.125"insidediameterand17elements,theyareroundindesignandfeaturea2.5inchoveralllength.Catalog Number Description056510 50 ml Mini Nozzles

200 ml Cartridge Dispensing GunThisdispensinggunisdesignedtobeusedwith200mladhesivecartridges.Available in both pneumatic and manual models.Catalog Number Description056462 200 ml Dispensing Gun (Pneumatic)056598 200 ml Dispensing Gun (Manual)

380 ml Cartridge Dispensing GunThisdispensinggunisdesignedtobeusedwithcoaxial380mlcartridges.Thisistherec-ommendedgunfor10:1mixratio materials from Adhesives Systems Inc. Available in both pneumatic (call for availability) and manual models.Catalog Number Description415476 380 ml Dispensing Gun (Manual)

400 ml Cartridge Dispensing GunThisdispensinggunisdesignedtobeusedwithHuntsman, Araldite, and ASI400mlcartridges.Catalog Number Description056443 400 ml Dispensing Gun

200/380/400 ml Static Mix NozzleThesestaticmixnozzlesareused for effective and com-pletemixingofadhesivesthatarepackagedineither200,380,or400mlcartridges.Thesemixersaremadewithanintegralnut,eliminatingtheneedforanindividualretainingnut.

Theyfeatureasquaredesignforsuperiormixing,24elements,staticmixinglengthof5inches,andoveralllengthof6.8inches.Catalog Number Description415800 200/380/400 ml Static Mix Nozzle


66 1.800.321.8511

Hot Melt Foundry Adhesives Wood Glue

ManufacturedbyPowerAdhesivesLTD.andspecificallyformulated forinstantbondingoffoundrycores,thesehotmeltadhesivesarecomprisedof100%solids,containingnosolventsorwater.

Tecbond® 501 Foundry Adhesive This material has a low viscosity for easy flow and can tolerate temperaturesto145–150°F.Eachrigidstickis1¾"indiameterand15⁄8"longformaximumglueflow.Eachstickhastheproductnumberand batch number clearly printed for quality control purposes. The Tec3200IndustrialDutyDispensingGunmustbeusedtodispensethisglue.Thismaterialissoldin22lb.boxes.Catalog Number Description Diameter Length

Net Wt.(Lbs.)

176071 Hot Melt Adhesive Techbond 501 1.75" 1.625" 22

Tecbond® 601 Foundry AdhesiveTecbond601FoundryAdhesiveishigherinviscosity&fastersettingthanTechbond501andcantoleratetemperaturesto185°F.Eachrigidstickis1¾"indiameterand15⁄8"longformaximumglueflow.Eachstickhastheproductnumberandbatchnumberclearlyprintedfor quality control purposes. Catalog Number Description Diameter Length

Net Wt.(Lbs.)

176072 Hot Melt Adhesive Tecbond 601 1.75" 1.625" 22

Tec® 3200 Industrial Duty Dispensing Gun ThisgunisspecificallydesignedtodispenseTecbondadhesives. TheTec3200HighOutputApplicatorisdesignedforcontinuousindustrialhotmeltglueapplications.LoadedwithtwoTecbondgluesticks(1¾"diameter),thisgunwilldispense8lbs.ofglueperhourandoperatesonastandard110voltage.

Features Include:•400wattstainlesssteelheatercartridge•4minutewarmup•Solidstatetemperaturecontrol•Automatic“stand-by”modetopreventoverheatingofglue•Oneyearwarranty

Catalog Number Description176070 Tec 3200 Hot Melt Glue Applicator

Freeman Medium Viscosity White Wood Glue Freeman Medium Viscosity White WoodGlueisapolyvinylacetateadhesivethathasagreatbalanceofsettime,viscosity,andholdingstrength.Itisextremelyeffectiveforgluingmostallspeciesofhardwoodand softwood.Catalog Number Description Availability

Net Wt.(Lbs.)

022128 White Wood Glue – Medium Viscosity Gallon 9022640 White Wood Glue – Medium Viscosity 5 Gallon 45

Freeman High Viscosity White Wood GlueFreemanHighViscosityWhiteWoodGlueisathickerversionofourMediumWhiteWoodGlueforverticalapplicationsorwhereahigherviscosityadhesiveispreferred.Itisextremelyeffectiveforgluingmostalltypesofwoodandisexcellentforinstallingleatherfilletsduetotheincreased viscosity.Catalog Number Description Availability

Net Wt.(Lbs.)

023639 White Wood Glue – High Viscosity Gallon 9023640 White Wood Glue – High Viscosity 5 Gallon 45

Freeman Fast Set White Wood GlueFreemanFastSetWhiteWoodGlueisthefastestsettingwoodglueweoffer.Itisprimarilyusedforassemblyworkwhererapidhardeningisrequired.Workswellwithalltypesofhardwoodandsoftwood.Catalog Number Description Availability

Net Wt.(Lbs.)

022663 White Wood Glue – Fast Set Gallon 9022664 White Wood Glue – Fast Set 5 Gallon 45

Gold Wood GlueFreemanGoldWoodGlue islightyellowincolorandfeaturesahighviscosityandfastsettime,makingitidealforassemblyandfilletwork.Catalog Number Description Availability

Net Wt.(Lbs.)

023635 Gold Wood Glue – High Viscosity Gallon 9023636 Gold Wood Glue – High Viscosity 5 Gallon 45

Wood Glue Applicator BottlesNon-stick,plasticgluebottlesinpopularandconvenientsizesareavailable (empty) for pattern shop use. Screw-on plastic spout which canbecuttodesiredopeningsizegetstheglueintothetightplaceswhere you need it.Catalog Number Description Availability023658 Glue Bottle with Spout 2 oz023660 Glue Bottle with Spout 8 oz023665 Glue Bottle with Spout 16 oz023670 Glue Bottle with Spout Quart023673 Additional Spout for Glue Bottle 2 oz023662 Additional Spout for Glue Bottle 8 oz023672 Additional Spout for Glue Bottle 16 & 32 oz



aterials

Ren Tooling Board Adhesives Other Specialty Adhesives

Ren-Weld 103Thislightyellowepoxyadhesiveisformulatedfortheeffective bondingofRenShapeFoam,Modeling,Styling,andToolingBoards.Ren-Weld103hasa2,100cpsviscosityforeaseofapplicationyet containsflowcontrolagentstopreventexcessiveresinrun-out.Otherfeaturesincludea20minutegeltimeanda10hourhandlingstrength.Catalog Number Description Availability

Net Wt.(Lbs.)

056506 Ren-Weld 103 Gallon 10

Ren-Weld 5008A medium-speed adhesive which is hardness and color matched for usewithRenShape5008.Thematerialhasa75minutegeltimeandreachesfullstrengthafter24hours.Thecuremaybeacceleratedbyheatingthematerialto200°Ffor4hours.Catalog Number Description Availability

Net Wt.(Lbs.)

056108 Ren-Weld 5008 Gallon 6

Ren-Weld 5169ThisredurethaneadhesiveisspecificallydesignedforgluingRenShape5169and5179FoundryBoards.Ren-Weld5169hasa1:1mixratiobyvolume,8-13minutegeltime,80DShorehardness,andan8-10hourhandlingstrength.Catalog Number Description Availability

Net Wt.(Lbs.)

056620 Ren-Weld 5169 Quart 4

SEE ALSO Product Page No.Repro Ultra Light for foam boards 16Repro Light for medium density boards 15RenLam 1700-1 for medium density boards 34Maxim Fast for foundry boards 58Freeman 690 for fixture boards 34

Sheet Wax Spray AdhesiveSpraywayNumber66istheeasiestwaytocoatplain sheetwaxforfabrication.Canalsobeusedonpaper, plastics,leather,metalorglass.Catalog Number Description Availability054510 Sprayway Number 66 Spray Adhesive 15.6 fl.oz.

3M™ Super 77™ Multipurpose AdhesiveSuper77SprayAdhesiveisafastdryinggeneral purposeadhesivedesignedforpermanentlyattaching fabric,paper,plastics,andlight-weightfoamstorigid base materials.Catalog Number Description


054516 3M #77 Super Spray Adhesive 21210-9 24 fl. oz.

3M™ Polystyrene Foam Insulation 78 Spray AdhesiveCreatesahightemperatureresistantbondwhileprovid-ingalongopentimeidealforpolystyrenepanelbonding,roofingmembraneattachments,andfoambaords.Catalog Number Description


054514 Polystyrene Foam Insulation 78 Spray Adhesive

41593-7 24 fl. oz.

3M™ Hi-Strength 90 Spray AdhesiveHighStrength90Adhesiveproducesasecurebond for heavier items such as laminates, particle board, wood, metal, and many plastics. This product is the recommendedadhesiveforFreemanMachinableWax.Catalog Number Description


054515 3M #90 High Strength Spray Adhesive

30023-3 24 fl. oz.

Styro GlueThis brush-on adhesive product should be used onpolystyrenepatterns.StyroGluewillnotattackpolystyreneanditwillburnoffwithoutash residue.Catalog Number Description Availability

Net Wt.(Lbs.)

022030 Styro Glue – Green Gallon 7.8

Foundry Tools & Suppl ies

68 1.800.321.8511

Freeman-Palmer Pattern PlatesOur pattern plates are available in aluminum or magnesium (Dowmetal) for automatic molding machines, non-automatic molding machines, and insert plate applications. The dowmetal plates are about 1⁄3 lighter in weight than aluminum.

Cast Aluminum Chainlock Plates for Automatic MachinesProduced using permanent mold casting methods for maximum hardness, minimum deflection, maximum wear resistance and longer life, these plates feature:

•Onlycertifiedaluminumusedonallplates.•Flat,parallelanduniformthickness.•Uniformdensityformaximummachinability.•Chainlocksegmentsare5⁄8" wide at the base and located ¼" insidetheflaskline,providingmaximumusableareawhilestillmaintaining good anti-shift properties.

Cast Aluminum Chainlock Plates for Hunter MachinesCatalog Number Description Thickness

Flask Width

Flask Length

Overall Width

Overall Length

257102 Hunter 10 ½" 14" 19" 17½" 26"257102H Hunter 10 – Drilled ½" 14" 19" 17½" 26"257102S Hunter 10 – Short ½" 14" 19" 16½" 22"257102SH Hunter 10 – Short, Drilled ½" 14" 19" 16½" 22"257102B Hunter 10 – Ends Only ½" 14" 19" 17½" 26"257102EH Hunter 10 – No Chainlock,

Drilled½" 14" 19" 17½" 26"

258103 Hunter 10 5⁄8" 14" 19" 17½" 26"258103H Hunter 10 – Drilled 5⁄8" 14" 19" 17½" 26"258103A Hunter 10 – Sides Only 5⁄8" 14" 19" 17½" 26"259105 Hunter 10 ¾" 14" 19" 17½" 26"259105H Hunter 10 – Drilled ¾" 14" 19" 17½" 26"257118 Hunter 18 (HMP18) ½” 18" 20" 21¼" 23¼"258107 Hunter 20 5⁄8" 20" 24" 231⁄8" 271⁄8"258107H Hunter 20 – Drilled 5⁄8" 20" 24" 231⁄8" 271⁄8"258107E Hunter 20 – No Chainlock 5⁄8" 20" 24" 231⁄8" 271⁄8"258107A Hunter 20 – Sides Only 5⁄8" 20" 24" 231⁄8" 271⁄8"259108 Hunter 20 ¾" 20" 24" 231⁄8" 271⁄8"259108H Hunter 20 – Drilled ¾" 20" 24" 231⁄8" 271⁄8"260109 Hunter 32 1" 30" 32" 341⁄8" 361⁄8"260109H Hunter 32 – Drilled 1" 30" 32" 341⁄8" 361⁄8"

Cast Aluminum Chainlock Plates for Beardsley & Piper MachinesCatalog Number Description Thickness

Flask Width

Flask Length

Overall Width

Overall Length

257110 B&P 2016 ½" 16" 20" 18½" 223⁄8"257110H B&P 2016 – Drilled ½" 16" 20" 18½" 223⁄8"258111 B&P 2016 5⁄8" 16" 20" 18½" 223⁄8"258111H B&P 2016 – Drilled 5⁄8" 16" 20" 18½" 223⁄8"259112 B&P 2016 5⁄8" 16" 20" 18½" 223⁄8"259115 B&P 2620 ¾" 20" 26" 22¾" 30"259115H B&P 2620 – Drilled ¾" 20" 26" 22¾" 30"

Cast Aluminum Chainlock Plates for Roberts Sinto MachinesCatalog Number Description Thickness

Flask Width

Flask Length

Overall Width

Overall Length

257150 Roberts Sinto FBM-I ½" 14" 19" 17" 22"258151 Roberts Sinto FBM-I 5⁄8" 14" 19" 17" 22"258152 Roberts Sinto FBN-2S 5⁄8" 20" 24" 23¼" 27¼"259153 Roberts Sinto FBM-2T ¾" 20" 24" 23¼" 27¼"257154 Roberts Sinto FBO-II ½" 14" 19" 17¾" 27½"258155 Roberts Sinto FBO-II 5⁄8" 14" 19" 17¾" 27½"258156 Roberts Sinto FBO-II 5⁄8" 16" 20" 1911⁄16" 27½"258157 Roberts Sinto FBO-III 5⁄8" 20" 24" 23" 26"259158 Roberts Sinto FBO-III ¾" 20" 24" 23" 26"

H=Drilled A=ChainLock-SidesOnly S=Short B=ChainLock-EndsOnly E=NoChainLock

Platescanbespecialorderedwithanyoftheabovecharacteristics.Minimumsapply.Contactcustomerservicefordetails.

FoundryTools&Supplies


Foundry Tools & Supplies

Freeman-Palmer Pattern Plates [CONTD.]

Cast Aluminum Chainlock Plates for Non-Automatic MachinesDesignedtofitmostjoltandjoltsqueezemachines, these plates are also cast in permanent molds to assure flatness, uniformthickness,anddurability.Otherthicknessesandsizesareavailableonrequestfrom3⁄8" to ¾"thicknessandfrom12" x 12" to 20" x 26". Please call customer serviceforpricingandavailability.CatalogNumber Description Thickness

FlaskWidth

FlaskLength

OverallWidth

OverallLength

257501 Flask Size Chainlock ½" 12" 12" 14" 19"257503 Flask Size Chainlock ½" 12" 14" 14" 21"257505 Flask Size Chainlock ½" 12" 16" 14" 23"257507 Flask Size Chainlock ½" 12" 18" 14" 25"257527 Flask Size Chainlock ½" 14" 14" 16" 21"257529 Flask Size Chainlock ½" 14" 16" 16" 23"257531 Flask Size Chainlock ½" 14" 18" 16" 25"257533 Flask Size Chainlock ½" 14" 20" 16" 27"257550 Flask Size Chainlock ½" 16" 16" 18" 23"257551 Flask Size Chainlock ½" 16" 18" 18" 25"257553 Flask Size Chainlock ½" 16" 20" 18" 27"257568 Flask Size Chainlock ½" 18" 18" 20" 25"257594 Flask Size Chainlock ½" 20" 20" 22" 27"258447 Flask Size Chainlock 5⁄8" 16" 20" 18" 27"258505 Flask Size Chainlock 5⁄8" 12" 16" 14" 23"259594 Flask Size Chainlock ¾" 18" 20" 22" 27"

Cast Aluminum Offset PlatesProduced using permanent mold casting methods for maximum hardness, minimum deflection, maximum wear resistance, and longer life. The Offset design provides a large area of sand registration for proper mold alignment.

CatalogNumber Description Thickness

FlaskWidth

FlaskLength

OverallWidth

OverallLength Offset

247120 BP 2016 – Drilled ½" 16" 20" 18½" 223⁄8" ½"247120H BP 2016 ½" 16" 20" 18½" 223⁄8" ½"249122 Hunter 20 ¾" 20" 24" 231⁄8" 271⁄8" 1"249122H Hunter 20 – Drilled ¾" 20" 24" 231⁄8" 271⁄8" 1"259109* Hunter 20 ¾" 20" 24" 231⁄8" 271⁄8" 2"249152C Roberts Sinto ¾" 20" 24" 23¼" 27¼" 1"*Catalognumber259109–allsurfacesarecompletelymachinedfor superioraccuracy.

Flat Aluminum PlatesFreeman-PalmerFlatAluminumPatternPlates are available in 3⁄8", ½", 5⁄8", and ¾" thicknessesinpopularflasksizes.Theseplates are available for automatic and non-automaticmoldingmachinesormaybecutintorectangularshapesforCope&Drag plates or Insert plates.

Call for availability.

Match-Lok Magnesium (Dowmetal) PlatesAFreemanexclusive,Freeman-PalmerMatch-LokPatternPlatesaremanufac-tured from magnesium for light handling weightandunsurpassedaccuracy.Theseplates also feature integrated urethane moldlocksforpositivemoldregistration.CatalogNumber Description Thickness

FlaskWidth

FlaskLength

OverallWidth

OverallLength

297700 Hunter 10 ½" 14" 19" 16½" 22"297702 Hunter 10 ½" 14" 19" 17½" 26"298703 Hunter 20 5⁄8" 20" 24" 231⁄8" 271⁄8"299703 Hunter 20 ¾" 20" 24" 231⁄8" 271⁄8"300704 Hunter 32 1" 30" 32" 341⁄8" 361⁄8"

Flat Magnesium (Dowmetal) PlatesFreeman-PalmerFlatMagnesiumPlatesare available in 3⁄8", ½", 5⁄8", ¾" and 1" thicknessesinpopularflasksizes.TheseplatesaremanufacturedfromAZ31Bmagnesium that is 1⁄3 lighter in weight than aluminum. These plates are avail-able for automatic and non-automatic moldingmachinesormaybecutintorectangular shapesforCope&DragplatesorInsertplates.

Call for availability.

Otherstylesofpatternplatesareavailableuponrequest. Ifyoudonotseethetypeorsizeofplatelistedpleasecallour customer service at 800-321-8511 for more details.


70 1.800.321.8511

Freeman Concentric Mold-Lock ButtonsFreemanConcentricMold-LockButtons willprovideyouwiththeeasiestand most economical means of reducing scrap rate of castings due to mold shift. These buttons feature:

•One-piececonstructionfor easyinstallation– (1) drill hole in plate (2) glue button in place.

•Exceptionalheatandwearresistance.•Concentricdesigntopreventbuttonmisalignment.

CatalogNumber Description

PlateThickness

HoleDiameter

165200 Small Mold-Lock Buttons ½" 1½"165202 Small Mold-Lock Buttons 5⁄8" 1½"165204 Small Mold-Lock Buttons ¾" 1½"165206 Small Mold-Lock Buttons 1" 1½"165208 Large Mold-Lock Buttons ½" 2"165210 Large Mold-Lock Buttons 5⁄8" 2"165212 Large Mold-Lock Buttons ¾" 2"165214 Large Mold-Lock Buttons 1" 2"

Freeman Match-Lok ButtonsFreemanMatch-LokButtonsareasimpleandeconomicalwayforelimi-nating mold shift on flat metal pattern plates.Theyareprecisionmachinedfrom aluminum, which assures accu-rate and positive matching between cope and drag halves.

Installation Instructions: •Drilltheholethroughtheplate.•Reamthehole.•Counterboretheholeusingthecorrectdiametercutter.•Selecttheproperrivetlengthforthethicknessoftheplate.•Placetherivetthroughthebuttonandthereamedhole,with

the head of the rivet on top of the button.•Usingthestakingtool,peentheportionoftherivetthatextends

into the counterbored area to secure it in place.Catalog Number Description Diameter Height Qty/Bx165005 Match-Lok Buttons 1" 0.254" 100165010 Match-Lok Buttons 1½" 0.254" 50165013 Match-Lok Buttons 2" 0.254" 1

RivetsCatalog Number Description

Plate Thickness Diameter Qty/Bx

165015 Rivets 3⁄8" 13⁄32" 100165020 Rivets 1⁄2" 17⁄32" 100165025 Rivets 5⁄8" 21⁄32" 100165030 Rivets 3⁄4" 25⁄32" 100165035 Rivets 1" 11⁄32" 100

Installation Tools Catalog Number Description165040 Drill – 19⁄64"165045 Reamer – 5⁄16"165050 Staking Tool165055 Counterbore for 1" Buttons165060 Counterbore for 1½" Buttons165065 Counterbore for 2" Buttons165070 Pilot for Counterbores (Replacement)

Adolf Cope and Drag InsertsStyle “A”Adolfstyle“A”copeanddraginsertsprovideaquickandsimplemethodto ensure accurate alignment of mold halves.Thisstyleconsistsoftwoparts, one drag and one cope half. Theymaybeinstalledonmatchboardsone above the other or separated on copeanddragplatesormoldingboxes.ConstructedfromABS plastic,theyareavailableindiametersfrom1½" to 3½".

CatalogNumber Diameter

Dimensions (inches)Mfg. No.A B C D

165150 1.5 0.50 0.50 0.437 0.375 1.5A165151 2 0.75 0.625 0.531 0.50 2A165152 2.5 1.25 0.625 0.531 0.50 2.5AA165153 2.5 1.25 1 0.906 0.50 2.5A 165154 3.5 1.25 1 0.906 0.50 3.5A

Style “B”Adolfstyle“B”insertsarespecificallydesigned to provide accurate align-ment for matchplates and matchboards, including automatic molding machines. Constructedfromanon-sticking,acidresistant plastic, the two halves tele-scopetogetherandinterlockatthepartinglinesoftheplate.Becauseofthetelescopingdesign,theyareabletobeinstalledinplatesofvariousthicknesses.Availableinfourdifferentdiametersfrom11⁄8" to 2½".


Dimensions (inches)Mfg. No.A B C

165156 1.50" 0.875 0.5-1.125 0.75 1.5B165157 1.75" 1.125 0.625-1.125 1 1.75B165158 2.50" 1.125 0.75-1.125 1 2.5B

Style “B” Inserts Zero ToleranceAdolfstyle“B”zerotolerancecopeanddraginsertsarespecificallydesigned for accurate alignment of matchplates that are used with greensandonly.Thesebuttonsfeaturezeroclearanceonthediametertoensureperfectcopeanddragalignment.Easilyidentifiedbytheirgraycolor,thesebuttonsareavailableindiametersfrom1½" to 2½".


Dimensions (inches)Mfg. No.A B C

165159 1.50" 0.875 0.5-1.125 0.75 1.5BOT165160 1.75" 1.125 0.625-1.125 1 1.75BOT165161 2.50" 1.125 0.75-1.125 1 2.5BOT

Installation Tools for Adolf Cope and Drag InsertsAdolfinstallationtoolsfortheStyle“A”and“B”copeanddrag insertsarespeciallydesignedforquick,easyandprecisecutting oftherequiredholesnecessarytoinstallthesebuttons.Available in diameters from 1½" to 3½".Catalog Number Description Diameter Mfg. No.165162 Cutter for use w/standard 3⁄8" Drill 1½" 1.5CU165163 Cutter Holder with ½" Pilot & ¾" Shank

(Blade Not Included)¾" 0.75CH

165164 Blade 1½" 1.5CB165165 Blade 1¾" 1.75CB165166 Blade 2" 2CB165167 Blade 2½" 2.5CB165168 Blade 3½" 3.5CB

Mold Alignment Hardware

Cope

Drag

Dia.Dia.

D

A

D

B C

A

D

B C

Dia.Dia.

Cope

DragAA

BB

BB CC



Husky Dowels Installation ToolsInstallation tools –specialitemsaredesignedspecificallyfor installingFreemanHuskyDowels:

164525 (A) Drill 3⁄4" diameter164530 (B) Reamer 49⁄64" diameter164515 (C) Counterbore**164520 (D) Tap with pilot 13⁄16" - 20**

A

B

D

C

Freeman Husky DowelsThisextraheavydutysteeldowelsystemisspecificallydesignedforthefoundryindustrytoproperlyaligncoreboxhalvesmadeofmetal.ExclusivetoFreeman,theHuskydowelandbushingis:

•Threadedforeasyinstallationandremoval.•Preciselymachinedforaccuracy.•Hardenedforlonglife.•Blackoxidetreatedtopreventrust.

164545 (E) 1" socket 1⁄2" drive164510 (F) Pin wrench with cross pin**164560 Cross Pin For Wrench164540 (G) Socket 5⁄8" X 12-Point Socket, 1⁄2" Drive164535 (H) Square Drive Bit**164550 Socket Wrench Handle - 105⁄8" Long, 1⁄2" Drive (not shown)**ItemsspecificallydesignedandmanufacturedexclusivelyfortheinstallationofFreemanHuskyDowels.

Freeman Alignment Dowels

D

D

AC

G

B F

J C

E F

H.156

I.D.Thread

.156

Dowel Installation Guide (all types)Step One: Drilling –Usingtheappropriatesizeddrillbit,drilla

hole deep enough to allow the pin and pilot of the tap (step four)toreachitsproperdepth(theexactdepthwillvarydependingonwhichsizedowelyouareinstalling).

Step Two: Reaming –Usetheappropriatereamertomakethepreviouslydrilledholesmoothandpreciseindimension.

Step Three: Counterboring –Nextyoumustcounterborethehole.Thistoolisdesignedwithapilotendtoperfectlyalignitself in the center of the reamed hole before boring a perfect concentric bevel or shoulder. In order to prevent boring too deep,thecounterborehasacamontheside,allowingyou tomanuallysetthedepthofyourcounterbore.

NOTE:Eachstyleofdowelhasitsowncounterboretoacco-modate the differences in how the dowel sets underneath thesurface.BothHuskydowelsandTrue-LinedowelshavesquareshoulderswhiletheSquare-Headdowelshavebeveledshoulders.IfyouareusingaCNCmachine,thecamshouldbeunnecessary.

Step Four: Tapping – This tap is also designed with a pilot end topreciselycutthethreadsinthehole.Withatapwrenchattached,youcanmanuallyturnthetaptocreatethethreads.

Step Five: Install Pin and Bushing – You now have an accurate, preciseholereadyforinstallationofthedowelpinorbushing.Eachstyleofdowelrequiresitsownspeciallydesignedsetofwrenchesorsocketsforeasyinstallation.

F H

GE


Dowel Dimensions (In Inches)A B C D E F G H J Threads I.D. Threads O.D.

164020 Male Pin Standard 13⁄4 13⁄16 5⁄16 5⁄8 – 15⁄16 3⁄16 3⁄16 – 1⁄2"-13 13⁄16"-20164025 Male Pin Long 21⁄4 15⁄16 5⁄16 5⁄8 – 15⁄16 3⁄16 3⁄16 – 1⁄2"-13 13⁄16"-20164030 Male Pin Extra Long 3 21⁄16 5⁄16 5⁄8 – 15⁄16 3⁄16 3⁄16 – 1⁄2"-13 13⁄16"-20164035 Female Bushing – – 5⁄16 5⁄8 13⁄16 15⁄16 – – 1⁄2 – 13⁄16"-20


72 1.800.321.8511

EE F

G CB

D

A3/16"Freeman Square-Head Steel Dowels

Thisheavydutysteeldowelsystemisspecificallydesignedforthefoundryindustrytoproperlyaligncoreboxhalvesmadeofmetal.Availableinfoursizesfrom¼" to ½" pin diameters, these dowels are ideal for small to mediumsizejobs.FreemanSquareHeadSteelDowelsare:

•Threadedforeasyinstallationandremoval.•Preciselymachinedforaccuracy.•Hardenedforlonglife.•Blackoxidetreatedtopreventrust.•Squareheaddesignforeasyinstallationandremoval.

Square Head Steel Dowels Installation ToolsSquareHeadsteeldowelwrencheshavebeenmadetofitsnugly over the male pin and into the female bushing for proper installation. Ourdrills,reamers,counterbores,andtapsaretopqualitytools made of high-grade tool steel for long lasting performance and proper dowel installation.

DescriptionCatalog No./Dowel Size

#1 #2 #3 #4Drill Bit (A) 163620 163625 163630 163635Reamer (B) 163560 163565 163570 163575Counterbore (C) 163580 163585 163590 163595Tap (D) 163600 163605 163610 163615Wrench (E) 163540 163545 163550 163555

A

B

C DE

Catalog Number

Size

Dowel Dimensions (In Inches)

Drill TapDowel

CompleteMalePin

FemaleBushing A B C D E F G

Regular 161005 (50/box) 161025 161045 1 1¼ 17⁄32 23⁄32 ¼ 3⁄8 ½ 23⁄32 19⁄64" 3⁄8"-24161010 (50/box) 161030 161050 2 111⁄32 5⁄8 23⁄32 5⁄16 7⁄16 9⁄16 23⁄32 11⁄32" 7⁄16"-20161015 (50/box) 161035 161055 3 1½ 11⁄16 13⁄16 3⁄8 ½ 5⁄8 13⁄16 13⁄32" ½"-20161020 (50/box) 161040 161060 4 119⁄32 25⁄32 13⁄16 ½ 5⁄8 ¾ 13⁄16 17⁄32" 5⁄8"-18

Long 161065 161085 1 2¼ 1¼ 1 ¼ 3⁄8 ½ 31⁄32 19⁄64" 3⁄8"-24161070 161090 2 2¼ 1¼ 1 5⁄16 7⁄16 9⁄16 1 11⁄32" 7⁄16"-20161075 161095 3 2¼ 1¼ 1 3⁄8 ½ 5⁄8 1 13⁄32" ½"-20161080 161100 4 2¼ 1¼ 1 ½ 5⁄8 ¾ 1 17⁄32" 5⁄8"-18

*Extra Long 161110 * 3 3 2 1 3⁄8 ½ 13⁄32" ½"-20161115 * 4 3 2 1 ½ 5⁄8 17⁄32" 5⁄8"-18

*Standardorlongbushingscanbeused.

Pins and bushings sold individually; or together in box quantities (number of sets per box noted above).

Freeman Square-Head Brass DowelsThisdowelsystemismachinedfromsolidbrassandisspecificallydesignedforthepatternandfoundryindustrytoproperlyaligncore box halves, split patterns, and loose pieces made from wood. Availablein7sizesfrom11⁄64" to 13⁄16" pin diameters, these dowels areidealforsmalltomediumsizejobs.FreemanSquareHeadBrassDowels feature:

•Coarse,sharpthreadsforeasyandsecureinstallation.•Preciselymachinedforaccuracy.•Solidbrasstopreventrust.•Squareheaddesignforeasyinstallationandremoval.

Catalog Number

Size

Dowel Dimensions (In Inches)Drill Bit

SizeDowel CompleteMale Pin

Female Bushing

Wrench Used A B C D E F

162005 (100/box) 162040 162075 163505 1 11⁄16 5⁄8 9⁄32 11⁄64 11⁄32 9⁄32 3⁄16"162010 (100/box) 162045 162080 163510 2 27⁄32 49⁄64 11⁄32 3⁄16 27⁄64 23⁄64 1⁄4"162015 (100/box) 162050 162085 163515 3 11⁄32 15⁄16 27⁄64 7⁄32 33⁄64 27⁄64 5⁄16"162020 (50/box) 162055 162090 163520 4 17⁄32 19⁄64 17⁄32 19⁄64 39⁄64 39⁄64 7⁄16"162025 (50/box) 162060 162095 163525 5 17⁄16 13⁄8 21⁄32 13⁄32 23⁄32 47⁄64 9⁄16"162030 (50/box) 162065 162100 163530 6 17⁄8 147⁄64 51⁄64 35⁄64 15⁄16 1 3⁄4"162035 (20/box) 162070 162105 * 7 23⁄8 21⁄8 15⁄16 13⁄16 13⁄16 15⁄16 1"*ToinstalltheSize7Pinuseastandard5⁄16"hexwrench.ToinstalltheSize7BushingusePCN163536.Thisisa9⁄16"squaredrivebit requiringa9⁄16"12pointsocketforinstallation(notincluded). Pins and bushings sold individually; or together in box quantities (number of sets per box noted above).

Freeman Alignment Dowels [CONTD.]

E

F

C

A

B

D



Freeman Alignment Dowels [CONTD.]

Malleable Iron DowelsThese dowels are most com-monlyusedtoproperlyalignverylargecoreboxhalves,splitpatterns and loose pieces made from wood. Available in three sizesfrom½" to 1" in diameter.Catalog Number Description

Pin Diameter

Base Diameter

026210 Malleable Iron Dowel Pin 1⁄2" 2"026220 Malleable Iron Dowel Pin 3⁄4" 21⁄2"026230 Malleable Iron Dowel Pin 1" 27⁄8"026205 Malleable Iron Dowel Bushing 1⁄2" 2"026215 Malleable Iron Dowel Bushing 3⁄4" 21⁄2"026225 Malleable Iron Dowel Bushing 1" 27⁄8"

Wood DowelsFreemanWoodDowelsaremadeofthehighestgradebirchandfinishedroundandsmoothfromstraightgrainedwood.Manufacturedtoexactingdiameters,thesehighqualitydowelshaveastandardlengthof36".Catalog Number Description Diameter033805P Wood Dowel 1⁄8"033810P Wood Dowel 3⁄16"033815P Wood Dowel 1⁄4"033820P Wood Dowel 5⁄16"033825P Wood Dowel 3⁄8"033830P Wood Dowel 7⁄16"033835P Wood Dowel 1⁄2"033845P Wood Dowel 5⁄8"033850P Wood Dowel 3⁄4"033855P Wood Dowel 7⁄8"033860P Wood Dowel 1"033865P Wood Dowel 11⁄8"033870P Wood Dowel 11⁄4"033875P Wood Dowel 11⁄2"033880P Wood Dowel 13⁄4"033885P Wood Dowel 2"

E F

D

AB

D

G

5/32"5/32"

1/16"

C

Freeman True-Line Steel Dowels Thisheavydutysteeldowelsystemisspecificallydesignedforthefoundryindustrytoproperlyaligncoreboxhalvesmadeofmetal.Availableinfoursizesfrom¼"to½"pindiameters,thesedowelsareidealforsmalltomediumsizejobs.Designedwithtwomethodsofinstallationandremoval,thebodyofthedowelmaybeextractedevenifthepinitselfisbroken.FreemanTrueLineDowelsfeature:

•Threadedforeasyinstallationandremoval.•Preciselymachinedforaccuracy.•Hardenedforlonglife.•Blackoxidetreatedtopreventrust.

True-Line Steel Dowels Installation ToolsTrue-LineSteelDowelsarebroachedandflange-slotted,whichmeansthat the bushing and pin can be removed with wrenches that are either flange-slottedorbroachedevenifthepinisbroken.Ourdrills,reamers,counterbores,andtapsaretopqualitytoolsmadeofhigh-gradetoolsteel for long lasting performance and proper dowel installation.

Description Catalog No./Dowel Size

#1 #2 #3 #4Drill Bit (A) 163620 163625 163630 163635Reamer (B) 163560 163565 163570 163575Counterbore (C) 163761 163766 163771 163776Tap (D) 163600 163605 163610 163615Slotted Wrench (E) 163740 163745 163750 163755Milled Wrench (F) 163720 163725 163730 163735

Catalog Number

Size

Dowel Dimensions (In Inches)Dowel

CompleteMalePin

FemaleBushing A B C D E F G Threads

161120 (50/box) 161140 161160 1 11⁄4 17⁄ 32 9⁄ 16 1⁄4 23⁄ 32 9⁄ 16 3⁄8 3⁄8"-24161125 (50/box) 161145 161165 2 111⁄ 32 5⁄8 9⁄ 16 5⁄16 23⁄ 32 5⁄8 7⁄ 16 17⁄ 16"-20161130 (50/box) 161150 161170 3 11⁄2 11⁄ 16 21⁄ 32 3⁄8 13⁄16 11⁄ 16 1⁄ 2 1⁄ 2"-20161135 (50/box) 161155 161175 4 119⁄ 32 21⁄ 32 25⁄ 32 1⁄ 2 13⁄16 13⁄ 16 5⁄8 5⁄8"-18

Pins and bushings sold individually; or together in box quantities (number of sets per box noted above).

A

B

CD

E

F

Other Alignment Dowels


74 1.800.321.8511

Ventistamp Core Vents

VentistampCoreVentsareveryhigh-qualityinvestmentcastcoreventsdesignedformaximumdurabilityandperformance.Theseventswere developed to be used in high-production applications where standardslottedventswouldtraditionallybeused.

Features and benefits:• Onepiececonstruction–Noscreensorfoilstobreak

• Extremelyflatheadsurface–Lessimperfectioninthecore

• Taperedslots–Lesslikeytoclogwithsandandbinders.

• Outsidediameteris.005"oversizedinthemiddleofthevent– Provides tight installation to prevent movement.

• Outsidediameteratthetopoftheventis.003"undersized– Prevents deformation of the slots.

Zanatta Vents Zanatta Vents are manufactured with a 0.012" (0.3mm) slot that is tapered 20 degreesonthebacksidetopreventsand clogging. These vents are made fromabrassalloy(SAE430-B)forhighwear resistance and are designed to be usedwithsandthathasanAFSfinenessof70to90.Catalog Number Description Diameter

Total Height

SlotWidth

034576 Ventistamp Zanatta Vents 3⁄16" 5⁄16" 0.012034577 Ventistamp Zanatta Vents ¼" 5⁄16" 0.012034578 Ventistamp Zanatta Vents 5⁄16" 5⁄16" 0.012034579 Ventistamp Zanatta Vents 3⁄8" 5⁄16" 0.012034580 Ventistamp Zanatta Vents 7⁄16" 5⁄16" 0.012034581 Ventistamp Zanatta Vents ½" 5⁄16" 0.012034582 Ventistamp Zanatta Vents 9⁄16" 5⁄16" 0.012034583 Ventistamp Zanatta Vents 5⁄8" 5⁄16" 0.012034584 Ventistamp Zanatta Vents ¾" 5⁄16" 0.012034585 Ventistamp Zanatta Vents 7⁄8" 5⁄16" 0.012034586 Ventistamp Zanatta Vents 1" 5⁄16" 0.012

Maxvents Maxventsaremanufacturedwitha0.012" (0.3mm) slot that is tapered 30 degreesonthebacksidetopreventsand clogging. These vents are made fromabrassalloy(SAE430-B)forhighwear resistance and are designed to beusedwithsandthathasanAFSfinenessof60to80.Catalog Number Description Diameter

Total Height

SlotWidth

034526 Maxvents 6mm 8mm 0.012034528 Maxvents 8mm 8mm 0.012034530 Maxvents 10mm 8mm 0.012034531 Maxvents 12mm 8mm 0.012034533 Maxvents 14mm 8mm 0.012034535 Maxvents 16mm 8mm 0.012034536 Maxvents 18mm 8mm 0.012034537 Maxvents 20mm 8mm 0.012034541 Maxvents 30mm 8mm 0.012

Premium Core Box Air Release Vents

Meltvents FSMeltventFSventsaremanufacturedwith35°taperedslots.Madefromstainlesssteel,theseventsareveryresistanttowearfromfoundrysandandcanbeusedwithalltypesofbindersystemssuchasColdBox,HotBox,andtheShellMoldingSystem.Catalog Number Description Diameter

Total Height

SlotWidth

034706 Ventistamp Meltvent FS 6 mm 8 mm 0.45034707 Ventistamp Meltvent FS 8 mm 8 mm 0.45034708 Ventistamp Meltvent FS 10 mm 8 mm 0.45034409 Ventistamp Meltvent FS 12 mm 8 mm 0.45

Ventistamp vents are also available in other fractional or metric diameters, additional slot widths, and curved or inclined head designs. Please call customer service at 800-321-8511 for more details.

Shalco Core Vents

Shalco Super Vents Core VentsShalcoSuperVentsareself-cleaningandfeatureanopeningrateofmorethen43%.Usingthesevents will solve the problem of clogging which can affect the continuous operation of a core molding machine duringno-bakemolding.The43%openingrate(com-pared to an average of 13% for slotted vents and 30% for screen vents) results in more effective and efficient venting.Soldinbagsof100vents.Catalog Number Description Diameter

Total Height

SlotWidth

033700 Shalco Super Vents ¼" ¼" 0.010033708 Shalco Super Vents ¼" 5⁄16" 0.010033701 Shalco Super Vents 5⁄16" ¼" 0.010033709 Shalco Super Vents 5⁄16" 5⁄16" 0.010033702 Shalco Super Vents 3⁄8" ¼" 0.010033710 Shalco Super Vents 3⁄8" 5⁄16" 0.010033703 Shalco Super Vents 7⁄16" ¼" 0.010033711 Shalco Super Vents 7⁄16" 5⁄16" 0.010033704 Shalco Super Vents ½" 5⁄16" 0.010033712* Shalco Super Vents ½" 5⁄16" 0.010033705 Shalco Super Vents 9⁄16" 5⁄16" 0.010033706 Shalco Super Vents 5⁄8" 5⁄16" 0.010033713* Shalco Super Vents 5⁄8" 5⁄16" 0.010033707 Shalco Super Vents ¾" 5⁄16" 0.010033714* Shalco Super Vents ¾" 5⁄16" 0.010033906 Shalco Super Vents 1" 5⁄16" 0.010033722 Shalco Super Vents 5mm 6mm 0.010*Withsupportbar.



Type K, Screen – Brass Body Core VentsThisbrassbodyventoffersahighventing area with a monel (corrosion resistant,nickel-copperalloy)screen.Sizes½" diameter and larger have supporting bars. Available in 24, 35,40and50mesh.Otherlengthsareavailableuponrequest.Soldinbags of 100 vents.CatalogNumber Diameter

TotalHeight Mesh

033037 3⁄16" ¼" 35033768 3⁄16" ½" 35033203 ¼" ¼" 24033038 ¼" ¼" 35033746 ¼" 5⁄16" 50033769 ¼" ½" 35033204 5⁄16" ¼" 24033039 5⁄16" ¼" 35033193 5⁄16" ¼" 50033770 5⁄16" ½" 35033205 3⁄8" ¼" 24033040 3⁄8" ¼" 35033229 3⁄8" ¼" 40033194 3⁄8" ¼" 50033733 3⁄8" 5⁄16" 24033771 3⁄8" ½" 35033041 7⁄16" ¼" 35033207 ½" ¼" 24033042 ½" ¼" 35033208 5⁄8" 5⁄16" 24033044 5⁄8" 5⁄16" 35033209 ¾" 5⁄16" 24033045* ¾" 5⁄16" 35033046 7⁄8" 5⁄16" 35033047 1" 5⁄16" 35*With2-barsupport. Steelbodiesandadditionalsizesavailablebyspecialorder.

Type G, Screen – Brass Body Core VentsThisventismadewithafine60x70meshscreen.Sizes½"andoveralsofeaturea14meshscreenandsupportingbarsunderneath.Soldinbagsof100 vents.CatalogNumber Diameter

TotalHeight Mesh

033014 ¼" ¼" 60 x 70033015 5⁄16" ¼" 60 x 70033016 3⁄8" ¼" 60 x 70033018 ½" ¼" 60 x 70033021 ¾" 5⁄16" 60 x 70033023 1" 5⁄16" 60 x 70Additionalsizesavailablebyspecialorder.

Type 150 L, Lectromesh – Brass Body Core VentsExtremelyfine(150mesh)screenisplacedover25meshTypeLM(Lectromesh).Excellentventforflatsurfacesandfinersands.Sizes½"andoverhavesupportingbars.Soldinbagsof100vents.CatalogNumber Diameter

TotalHeight Mesh

033028 3⁄8" ¼" 150033030 ½" ¼" 150Additionalsizesavailablebyspecialorder.

Standard Core Box Air Release Vents

Standard Screen Core Vents

Type LM, Lectromesh – Brass Body Core VentsThis vent is constructed using a thin, flat screen to prevent clogging. Available in 25 and 40 mesh. Sizes½" diameter and larger have supportingbars.Soldinbagsof100vents.CatalogNumber Diameter

TotalHeight Mesh

033001 3⁄16" ¼" 25033236 3⁄16" ¼" 40033002 ¼" ¼" 25033003 5⁄16" ¼" 25033004 3⁄8" ¼" 25033006 ½" ¼" 25Additionalsizesavailablebyspecialorder.

Standard Core Vent Selection Guidelines#1 – Type of Metal/Material:

• Brassisasoftermetalwhichmakesiteasiertocontour,removefromthe core box, and clean.

• Steel vents offer greater wear and temperature resistance, and provide uniform heating and cooling with steel core boxes.

• AluminumventsarepopularforStyrofoammoldingapplications.

#2 – Style of Vent:• SlottedVentsoffertheabilitytobemachinedtocontourwiththesur-

face of the core box. The “opening rate” (amount of space provided) for these vents average about 13%

• ScreenVentsareprimarilyusedintheflatareasofcoreboxconstruc-tion. The “opening rate” for these vents average about 30%.

#3 – Slot Width/Screen Mesh: When choosing a standard slotted or screen vent, the width of the slot

or the size of the mesh required is determined by the size of the sand (mesh) being used in your core making process. The slot width or mesh opening of your vent must not be greater than the sand mesh in order to hold the sand in the core box while permitting the air to escape.

#4 – Dimensions:• Diameter–isdeterminedbythesizeofthearearequiringventingand

the number of vents preferred in the particular location on the core box.• Height–isbasedonthedepthoftheshouldercreatedbythestepdrill

(insert drill).• HeadThickness–affectstheabilitytocontourtheventtothetool

surface. The thicker the head the more contouring can be done and the thinner the head the less likely it is to clog with binders.

These guidelines do not include Shalco Super Vents or Ventistamp vents, both of which offer unique advantages superior to most standard brass and steel vents.


76 1.800.321.8511

Standard Slotted Core Vents

Type D, Slotted – Brass Body Core VentsThisslotted-styleventismachinedfrom solid brass and is available with a .093" headthicknessforflatandcontoursurfaces. Soldinbagsof100vents.CatalogNumber Diameter

TotalHeight

Slot Width

HeadThickness

033048 1⁄8" ¼" 0.014 0.093033253 3⁄16" ¼" 0.010 0.093033049 3⁄16" ¼" 0.014 0.093033254 ¼" 5⁄16" 0.010 0.093033050 ¼" 5⁄16" 0.014 0.093033051 5⁄16" 5⁄16" 0.014 0.093033256 3⁄8" 5⁄16" 0.010 0.093033052 3⁄8" 5⁄16" 0.014 0.093033053 7⁄16" 5⁄16" 0.014 0.093033258 ½" 5⁄16" 0.010 0.093033054 ½" 5⁄16" 0.014 0.093033055 5⁄8" 5⁄16" 0.014 0.093033260 ¾" 5⁄16" 0.010 0.093033056 ¾" 5⁄16" 0.014 0.093033058 1" 5⁄16" 0.014 0.093Additionalsizesavailablebyspecialorder.

Type C, Slotted – Steel Body Core VentsThisslotted-styleventismachinedfromsteel and is used in flat and contour surfaces. Soldinbagsof100vents.CatalogNumber Diameter

TotalHeight

Slot Width

HeadThickness

033098 1⁄8" ¼" 0.014 0.093033099 3⁄16" 5⁄16" 0.014 0.093033100 ¼" 5⁄16" 0.014 0.093033285 5⁄16" 5⁄16" 0.010 0.093033101 5⁄16" 5⁄16" 0.014 0.093033102 3⁄8" 5⁄16" 0.014 0.093033103 7⁄16" 5⁄16" 0.014 0.093033287 ½" 5⁄16" 0.010 0.093033104 ½" 5⁄16" 0.014 0.093033105 5⁄8" 5⁄16" 0.014 0.093033106 ¾" 5⁄16" 0.014 0.093033108 1" 5⁄16" 0.014 0.093Additionalsizesavailablebyspecialorder.

Type T, Taper Slot – Brass Body Core VentsThisslotted-styleventfeaturesaself-cleaningtaperedslotdesign.Slotsonthesurfaceofthese vents are 0.012" wide, diverging towards the underfaceeffectivelypreventingsandclogging. Soldinbagsof100vents.CatalogNumber Diameter

TotalHeight

Slot Width

HeadThickness

033122 1⁄8" 5⁄16" 0.012 0.080033123 3⁄16" 5⁄16" 0.012 0.080033124 ¼" 5⁄16" 0.012 0.080033125 5⁄16" 5⁄16" 0.012 0.080033126 3⁄8" 5⁄16" 0.012 0.080033128 ½" 5⁄16" 0.012 0.080033130 5⁄8" 5⁄16" 0.012 0.080033131 ¾" 5⁄16" 0.012 0.080033127 7⁄16" 5⁄16" 0.012 0.080033133 1" 5⁄16" 0.012 0.080

Type XD, Slotted – Brass & Steel Body Core VentsThisslotted-styleventfeaturesa.156"headthickness andisdesignedespeciallyformountingonvery irregular surfaces where much of the vent head mustbemachinedtofittheboxcontour. Soldinbagsof100vents.CatalogNumber Metal Diameter

TotalHeight

Slot Width

HeadThickness

033059 Brass 1⁄8" 5⁄16" 0.014 0.156033245 Brass 1⁄8" 3⁄8" 0.010 0.156033249 Brass 3⁄16" 5⁄16" 0.010 0.156033060 Brass 3⁄16" 5⁄16" 0.014 0.156033159 Brass ¼" 5⁄16" 0.010 0.156033250 Brass ¼" 3⁄8" 0.010 0.156033061 Brass ¼" 3⁄8" 0.014 0.156033160 Brass 5⁄16" 3⁄8" 0.010 0.156033062 Brass 5⁄16" 3⁄8" 0.014 0.156033251 Brass 3⁄8" 3⁄8" 0.010 0.156033063 Brass 3⁄8" 3⁄8" 0.014 0.156033065 Brass ½" 3⁄8" 0.014 0.156033066 Brass 5⁄8" 3⁄8" 0.014 0.156033067 Brass ¾" 3⁄8" 0.014 0.156033247 Steel ½" 3⁄8" 0.014 0.156Additionalsizesavailablebyspecialorder.

Type AD, Slotted – Aluminum Core V entsThisslotted-style,aluminumventisparticularlywell-suitedforuseinaluminummoldsusedinmakingpatternsandstyrofoampackaging.Alsoavailablewithanon-stickcoating.Pleasecallusfordetails.Soldinbagsof100vents.CatalogNumber Diameter

TotalHeight

Slot Width

HeadThickness

033084 1⁄8" ¼" 0.014 0.093033767 ¼" ¼" 0.010 0.093033086 ¼" ¼" 0.014 0.093033083 ¼" 3⁄8" 0.010 0.156033762 ¼" 3⁄8" 0.014 0.156033089 ½" ¼" 0.014 0.093Additionalsizesavailablebyspecialorder.

Standard Core Box Air Release Vents [CONTD.]



Brass Vent PlugsThese vent plugs are designed to plug holes fromrelocatedcorevents.Soldinbagsof100.CatalogNumber Metal Diameter

Total Height

033294 Brass ¼" 5⁄16"033289 Brass 5⁄16" 5⁄16"033295 Brass 3⁄8" 5⁄16"033297 Brass ½" 5⁄16"033296 Brass 5⁄8" 5⁄16"033718 Brass ¾" 5⁄16"AluminumandSteelbodies,aswellasadditionalBrassbodysizes,availablebyspecial order.

Freeman Vent CleanersFreemanSlottedVentCleanersaremadewithataperedspringsteelbladeandadurableinjectionmolded plastic handle. These tools are ideal for clean-ing sand and binder from slotted core vents used in the foundryprocess.Availableintwostyles:¾" long blade and a 7⁄16" shorter blade.

TheFreemanScreenVentCleanerhassteelwirebristles at each end and measures ¼"indiameterby 8" long and contains 7⁄8" long steel wire bristles.CatalogNumber Description

Overall Length

033325 Slotted Vent Cleaner – ¼" Blade Only 3¾"032997 Slotted Vent Cleaner with Plastic Handle – ¾" Blade 6½"032996 Slotted Vent Cleaner with Plastic Handle – 7⁄16" Blade 6¼"033330 Screen Vent Cleaner with Handle 8"

Insert Drills for Core Box Air-Release VentsPerforms the operations necessaryforquickventinstal-lation. This tool rough drills, relief drills, and reams to correct depth withconcentricity.Completedrillconsists of drill bit and collar.CatalogNumber Description

Shank Diameter

Drill Diameter

033301 Insert Drill 1⁄8" 1⁄8"033302 Insert Drill 3⁄16" 3⁄16"033303 Insert Drill ¼" ¼"033304 Insert Drill 5⁄16" 5⁄16"033305 Insert Drill 3⁄8" 3⁄8"033306 Insert Drill 7⁄16" 7⁄16"033307 Insert Drill ½" ½"033308 Insert Drill ½" 9⁄16"033309 Insert Drill ½" 5⁄8"033310 Insert Drill ½" ¾"033311 Insert Drill ½" 7⁄8"033312 Insert Drill ½" 1"

Dike-O-Seal Preform StripDike-O-SealPreformSealsprovideaneffectivesealinfoundrycoreboxes and gassing plates. It can be installed and secured without use ofanadhesiveinmostcases.Cornerscanbemachinedat45°totheintersectinggroovesandthiswillallowtheDike-O-SealPreformSealto be set in the groove without cutting and bonding ends together. Availableintwohardnessesof20and40ShoreA.

FreemanF-BondAdhesivesaredesignedforbondingDike-O-Sealpreformsealsintocoreboxchannels.Theseareveryfastsetting cyanoacrylateadhesiveswhichallowthecoreboxtobequicklyputinto production (pg. 64).


Hardness(Shore A) Mfg No. Length

177105 Preform Strip 20 GMC-1 50'177115 Preform Strip 20 AUS-0 50'177125 Preform Strip 20 GMS-3 50'177140 Preform Strip 20 CT-1 50'177110 Preform Strip 40 GMC-1 50'177120 Preform Strip 40 AUS-0 50'177130 Preform Strip 40 GMS-3 50'177146 Preform Strip 40 CT-1 50'177103 Preform Strip 40 GR-1 50'177142 Preform Strip – 1⁄8" Round 20 1⁄8" R 50'177143 Preform Strip – ¼" Round 20 ¼" R 50'177148 Cutter For GMS-3 Preform Strip

Shalco Blowplate GasketThesehighheatresistantsiliconerubbergasketsaredesignedtobeusedforsealingshell-coreandhot-boxcoremakingequipment.Theseseals, which are reinforced with 26 gauge perforated steel, provide a positive seal between the core box and the blowplate thus eliminating the escape of curing gases, air, and sand.CatalogNumber Description Thickness177205 Blowplate Gasket – 24" x 24" 3⁄16"

StriptubeStriptubeisaround,60Aneoprenerubbergasketmaterialusedas aneffectivesealinfoundrycoreboxesandgassingplates.Striptube ishollowtoeasilycompressandisnotaffectedbygasoline,naptha, orkerosene.CatalogNumber Description Diameter Length033475 Round Striptube Seal 1⁄8" 10'033482 Round Striptube Seal 3⁄16" 10'033484 Round Striptube Seal ¼" 10'033486 Round Striptube Seal 5⁄16" 10'

Core Vent Accessories Core Box Seals & Gaskets


78 1.800.321.8511

Freeman Core Vent WaxFreemanBrownCoreVentWaxisusedtoventoilsandcores of curved or irregular shape. The wax is placed in critical locations in the sand as the core is molded. The wax is dissipated when the coreisbaked,leavingacleanventofhighpermeability.

Available in full round and half round shapes.

Dike-O-Lastic Ejector ButtonsTheseEjectorButtonsareidealforcontributingtocleandrawsondeeppocketsorcavitiesonmatch-platesorcoreboxes.

Leather Fillet & Accessories FreemanLeatherFilletsare manufactured with the highest grade leather and have mul-tiple slits along the underside of the larger radius material for greaterflexibility.Thisdesignalso allows for faster fabrication and increased wear resistance. FreemanFilletCementorWhiteorGoldWoodGluemaybeusedwhenapplyingleatherfillets.Soldinfullbundlesonly.

FreemanFilletCementisawaterproofcementforattachingleatherfilletonwoodormetal patterns.Anysurpluscanbereadilyremovedwithalcoholorfilletcement thinner.

CatalogNumber Description Dia. Height

Approx.Length

Net Wt.(Lbs.)

086001 Solid Core Vent Wax 1⁄32" 2300' ½086002 Solid Core Vent Wax 1⁄16" 875' 1086003 Solid Core Vent Wax 1⁄32" 325' 1086004 Solid Core Vent Wax 1⁄8" 800' 4086006 Solid Core Vent Wax 3⁄16" 350' 4086008 Solid Core Vent Wax ¼" 195' 4086012 Solid Core Vent Wax 3⁄8" 85' 4086016 Solid Core Vent Wax ½" 50' 4086020 Solid Core Vent Wax 5⁄8" 30' 4086117 Solid Core Vent Wax – Half Round ¾" 3⁄8" 41' 4086118 Solid Core Vent Wax – Half Round 5⁄8" 5⁄16" 75' 4086119 Solid Core Vent Wax – Half Round 3⁄8" 3⁄16" 150' 4086120 Solid Core Vent Wax – Half Round ¼" 1⁄8" 340' 4086121 Solid Core Vent Wax – Half Round 3⁄16" 1⁄8" 600' 4

Catalog Number Description Diameter177150 Dike-O-Lastic Ejector Button ¼"177151 Dike-O-Lastic Ejector Button 3⁄8"177152 Dike-O-Lastic Ejector Button ½"177153 Dike-O-Lastic Ejector Button 5⁄8"177154 Dike-O-Lastic Ejector Button ¾"177155 Dike-O-Lastic Ejector Button 1"177156 Dike-O-Lastic Ejector Button 1¼"177157 Dike-O-Lastic Ejector Button 1½"177158 Dike-O-Lastic Ejector Button 1¾"177159 Dike-O-Lastic Ejector Button 2"177160 Dike-O-Lastic Ejector Button 2¾"

CatalogNumber Description Availability

Fillet No. Radius

Feet PerBundle

023105 Leather Fillets ½ 1⁄32" 100 ft023110 Leather Fillets 1 1⁄16" 100 ft023115 Leather Fillets 1½ 3⁄32" 100 ft023120 Leather Fillets 2 1⁄8" 100 ft023125 Leather Fillets 2½ 5⁄32" 100 ft023130 Leather Fillets 3 3⁄16" 100 ft023135 Leather Fillets 4 ¼" 100 ft023140 Leather Fillets 5 5⁄16" 100 ft023145 Leather Fillets 6 3⁄8" 100 ft023150 Leather Fillets 7 7⁄16" 100 ft023155 Leather Fillets 8 ½" 100 ft023160 Leather Fillets 10 5⁄8" 100 ft023165 Leather Fillets 12 ¾" 100 ft023170 Leather Fillets 14 7⁄8" 50 ft023175 Leather Fillets 16 1" 50 ft023205 Fillet Cement Quart



Slicksandtrowelsarehand-constructedofqualitysteelanddesignedfor hand custom molding operations.CatalogNumber Description Style No. Width

BladeLength

176102 Square Trowel 10 1¼" 5"176104 Square Trowel 10 1½" 6"176106 Square Trowel 10 2" 7"176118 Slick & Oval Spoon 12 ¾" 176120 Slick & Oval Spoon 12 1" 176122 Slick & Oval Spoon 12 1¼" 176124 Slick & Oval Spoon 12 1½" 176126 Slick & Taper 13 1" 176128 Slick & Square Spoon 18 ¾" 176108 Finishing Trowel 20 1¼" 5"176110 Finishing Trowel 20 1¼" 6"176112 Finishing Trowel 20 1½" 6"176114 Finishing Trowel 20 1½" 7"176116 Finishing Trowel 20 2" 7"176144 Spoon & Gate Cutter 24 1" 176146 Spoon & Gate Cutter 24 1¼" 176148 Spoon & Gate Cutter 24 1½" 176150 Taper & Spoon 32 1" 176152 Taper & Leaf 36 1" 176156 Taper & Square 39 1" 176158 Heart & Spoon 72 1" 176160 Heart & Taper 73 1"

Slicks & Trowels

Core Box Clamps

#10

#12

#13

#18

#20

#24

#32

#36

#39

#72

#73

Peerless Core Box ClampsThis 3-piece core box clamping systemissimpleanddurableforeffective clamping of wood or metalcoreboxes.Constructedfromheavygagesteelforalonglife,PeerlessCoreBoxClampsarecomposed of left and right halves that are mounted to each side of the core box with two screws each (not included). A tapered and dovetailedcentersectionisfirmlyplaced over the two halves to bring the core box parting line together andholditsecurelyduringthemoldingprocess.Allpiecesaresoldindividually;oneleft,oneright,andonecenterarerequiredtomakeone complete set.CatalogNumber Description Mfg. No.177500 Peerless Left Bracket 2" CC2L177502 Peerless Right Bracket 2" CC2R177504 Peerless Centerpiece 2" CC2C

Link-Lock FastenersIdeal for securing core box halves during molding operations. These fasten-ersfeaturepositivelocking,springless latching and heavy-dutyconstruction.Bothstylesaredesigned to be compact and will close flat.Catalog Number Description Mfg No.408255 Link Lock Fasteners (Light Duty) 3408256 Link Lock Fasteners (Medium Duty) 2


80 1.800.321.8511

Mouth Spray CanMouthSprayCansareusedto sprayliquidpartings,lightwashesorsimilarmaterials.Anyairnozzlecanbeusedwiththesespraycans.Thecanismadeofheavybrassandisavailableinpintandquartsizes.Catalog Number Description Availability176880 Mouth Spray Can Pint176885 Mouth Spray Can Quart

Hand RiddlesFreemanHandRiddlesareusedforthefinesiftingoffoundrysandonto the mold surface. This ensures uniform coverage to prevent cast-ing defects. These riddles are made fromgalvanizedwirescreenandheavygaugeplasticrimsforlonglife.Eachriddleis18"indiameter.Pleasespecifymesh.Catalog Number Description Mesh

Wire Diameter

SizeOpening

176849 Hand Riddles #1 0.063 0.937176820 Hand Riddles #4 0.047 0.203176838 Hand Riddles #5 0.035 0.165176839 Hand Riddles #6 0.035 0.132176830 Hand Riddles #8 0.032 0.093176831 Hand Riddles #10 0.017 0.083176832 Hand Riddles #12 0.018 0.066176833 Hand Riddles #14 0.063 0.437176834 Hand Riddles #16 0.018 0.045

Sprue CuttersConstructedofheavyformed, tapered steel tubing with a well-rounded top. This product is excellent for cutting pouring sprues in green sand molds.Catalog Number Description Length Diameter176745 Steel Sprue Cutter 81⁄4" 7⁄8"176746 Steel Sprue Cutter 121⁄4" 1"176747 Steel Sprue Cutter 121⁄4" 11⁄4"

Paste BulbDurable container used to dispense glue in core bonding applications.

Catalog Number Description Size176860 Paste Bulb (Complete) 14 oz.

Lance PyrometerThisLancePyrometerisdesignedtoaccuratelymeasure the temperatures of non-ferrous molten met-als to within 2%. It features aneasilyreplaceablemeter, 36" long immer-sion thermocouple, 8" ProtectedMarshallTipandFahrenheit-Centigradeanalog meter read-out. The temperature range for thispyrometeris0°Fto2,350°F.Catalog Number Description Mfg. No176721 Lance Pyrometer MT 400176723 Replacement Thermocouple with Tip for MT 400

Bench RammerThisBenchRammeris made of hard maple withanoilfinishanddesigned with one end wedge shaped and the othercylindrical.Catalog Number Description Length Diameter176754 Bench Rammer 14" 3½"

Foundry Specialty Tools



Other Foundry Supplies

Freeman Malleable-Iron Rapping PlatesFreemanRappingPlatesarecast malleable inserts that enable a foundrymantoeasilyremovewoodenpatterns or loose pieces from the molding sand. Designed to be installed flush on the parting line, each plate hasathreadedholeforinsertinganeye boltoradrawrod.Availableinavarietyofsizesandshapes.Catalog Number Description Size Dia. Thickness Width Length026005 Rapping Plates 1 5⁄8" 1½"026010 Rapping Plates 5 ¾" 15⁄8"026015 Rapping Plates 6 ¾" 2¼"026020 Rapping Plates 8 7⁄8" 2¼"026025 Rapping Plates 9 1" 3"026030 Rapping Plates 10 1" 3½"026035 Rapping Plates 11 2¼" 2¼"026040 Rapping Plates 12 1¼" 3¾"026045 Rapping Plates 14 1¼" 4½"026050 Rapping Plates 16 2¾" 2¾"026055 Rapping Plates 17 3" 5½"026072 Round Rapping Plates 0 1" 5⁄16"026074 Round Rapping Plates 1 1¼" 3⁄8"026076 Round Rapping Plates 2 1¾" ½"026078 Round Rapping Plates 3 23⁄8" 9⁄16"026080 Round Rapping Plates 4 3" 5⁄8"026082 Round Rapping Plates 5 4" 11⁄16"026084 Round Rapping Plates 6 5" ¾"

Cleveland VibratorsLinearshockactionvibrationmakestheSAEPthemostpowerfulcontinuous-dutyvibratoravailableforitssize.Ideal for use on matchplates injolt-squeezeoperations.

Features include:•Continuous-dutydesign•Lowairconsumption•Variablefrequency


Piston Diameter Mfg. No.

Vibrations Per

Min. @ 60psi176900 Cleveland Vibrator ½" SAEP-½ 16,000176901 Cleveland Vibrator 5⁄8" SAEP-5⁄8 14,100176902 Cleveland Vibrator ¾" SAEP-¾ 12,700176903 Cleveland Vibrator 1" SAEP-1 11,000176904 Cleveland Vibrator 1¼" SAEP-1¼ 7,600

Sprayon Blue Layout FluidThisisafast-drying,non-flaking,non-etching,layout fluidthatwillnotcrackorpeel.Smooth,non-glare flnish allows for clear, precise scribe lines.Catalog Number Description Availability038082 Sprayon Blue Layout Fluid – Aerosol 16 oz.

Brass RodBrassRodmanufacturedinaccuratefractionalsizesforfast convenientpatternshopuse.Soldin36"lengths.Catalog Number Description Diameter Length027645 Brass Rod 1⁄16" 36"027650 Brass Rod 3⁄32" 36"027655 Brass Rod 1⁄8" 36"027665 Brass Rod 3⁄16" 36"027675 Brass Rod ¼" 36"027680 Brass Rod 5⁄16" 36"027685 Brass Rod 3⁄8" 36"027695 Brass Rod ½" 36"027700 Brass Rod 5⁄8" 36"027705 Brass Rod ¾" 36"027710 Brass Rod 1" 36"

Cast Urethane Gating ComponentsMadebyDike-O-Seal,theseabrasion-resistanturethaneproducts provide economical, long-lasting solutions for gating Hunter Automatic MoldingMachines.

Thisproductlinefeaturesawidevarietyofpouringbasins,spruepins,basinliners,ventpins,andrunnerbars.MadeusingDike-O-Seal’s exclusiveABRA-SHUN®polyurethanetoresistabrasion,lastlonger,prevent downtime, and extend service life to produce better sand molds.

Duetothewidevarietyofgatingcomponentsavailable, FreemanmakestheseitemsavailablebySpecialOrderOnly. Please call us at 800-321-8511 for more information.

Dux-Bak Non-Silica Dry Parting and Parting BagsOurPartingBagismadeofaspecialclothfordustingDux-BakNon-SilicaDryPartingpowderontoapattern.Thebagmeasures6"x11"insize.Dux-BakNon-SilicaDryPartingisavailableinquantitiesofonepoundupthroughandincludinga500pounddrumsize.Catalog Number Description Availability054400 Non-Silica Dry Parting Pound176870 Parting Bag Each

Disamatic Urethane Wipers & Brass KeepersReplacementurethanewipersandbrasskeepersthatare pre-drilledfortheMarkIVDisamatic.Catalog Number Description177211 Disa Urethane Wiper Blade – Mark IV177212 Brass Keeper – Mark IV

Plywood & Sheet Mater ia ls

1.800.321.851182

Freeman Pattern Plywood

Freeman Pattern Plywoods are manufactured from 1" to 2" in thick-ness for use in making large core box bottom boards and sides, large cope & drag plates, or general heavy duty applications. Available in solid pine or maple-faced pine, these plywoods feature “almost void free” construction throughout.

Freeman Maple-Faced Pattern PlywoodSmooth maple facing on both faces with a solid pine interior combines quality with economy in a thick plywood panel.Catalog Number

Nominal Thickness Width Length Grade

No. Plys

075373 11⁄8" 48" 96" D3 11075374 1¼" 48" 96" D3 11075375 1½" 48" 96" D3 13075376 1¾" 48" 96" D3 15

Please see plywood grading scale on page 85.

Plywood & Sheet Materials

Freeman Pine Pattern PlywoodSolid Pine construction combines a smooth surface with durability for a thick plywood panel.Catalog Number


No. Plys

075364 1¼" 48" 96" AB 9075365 1½" 48" 96" AB 11075366 1¾" 48" 96" AB 13075367 2" 48" 96" AB 13


Plywood &

Sheet Materials

Premium Plywood

Eurobirch PlywoodEurobirch is the highest quality plywood in our line. It is suitable for pattern plates, core box construction, or any heavy duty application. All sizes are equivalent to A-B grade and feature:

•SolidBirchconstruction•Virtuallyvoid-freelaminates•Phenolicresinadhesivethatiswaterproof&boilproof•Thinveneersformaximumstrength&durability

Catalog Number

Nominal Thickness Width Length

No. Plys

075382 ¾" 48" 96" 14075383 1" 48" 96" 18

Euroform PlywoodEuroform is made with the same high quality construction as Eurobirch with the addition of thermally fused phenolic facings for durability and moisture resistance. It is excellent for pattern plates or core box construction.Euroform features:

•SolidBirchconstruction•Virtuallyvoidfreelaminates•Phenolicresinadhesivethatiswaterproof&boilproof•Thicknessesfrom1⁄4" to 1"•Thinveneersformaximumstrength&durability

Catalog Number


No. Plys

075392 ¾" 48" 96" 14075393 1" 48" 96" 18

Russian Birch PlywoodRussian Birch plywood is constructed with thin veneers of solid Birch and is assembled using phenolic adhesive which provides awaterproofbondline.Thismaterialisaneconomicalalternative to Eurobirch.Catalog Number


No. Plys

075391 24 mm 48" 96" 17

Plywood & Sheet Mater ia ls

1.800.321.851184

Standard Plywood

Birch-Faced PlywoodAn extensive selection of smooth surface birch faced plywoods for a varietyofwoodworkingapplications.Thicknessesareavailablefrom 1⁄2" to 1" and all contain a veneer core.Catalog Number


No. Plys

Pc/Unit*

075326 ¾" 48" 96" A2 7 40075324 ½" 48" 96" C3 5 60075333 5⁄8" 48" 96" C3 7 60075321 ¾" 48" 96" C3 7 40075322 1" 48" 96" C3 9 30075325 ¾" 48" 96" D3 (shop) 7 40075372 1" 48" 96" D3 (shop) 9 30 *Pieces per unit listed for shipping reference purposes. Sheets are sold individually.

HDO (High Density Overlay) Fir PlywoodHDO Plywood is manufactured with a thermosetting resin-impregnated fiber surface bonded to both outer plys under heat and pressure.

It provides a smooth, uniform surface which is resistant to abrasion, moisture penetration and deterioration from many common chemicals and solvents.

HDO Plywood is bonded with 100% waterproof glue with face veneers grade B or better with a semi-opaque thermosetting resin-impregnatedsurface.Theresinoverlayresistsabrasion, moisture penetration and deterioration from many common chemicals and solvents.Catalog Number


No. Plys

Pc/Unit*

075343 ¾" 48" 96" AB 7 44075344 1" 48" 96" AB 9 30 *Pieces per unit listed for shipping reference purposes. Sheets are sold individually.

MDO (Medium Density Overlay) Fir PlywoodMDO Plywood is produced with a resin-treated fiber overlay on both sidesthatisgenerallysmoothandopaque.Thisallowsforrapid,evenpaint and coating applications.

MDO Plywood is manufactured with 100% waterproof adhesives and has an inner ply construction of C grade veneers and B grade or better face and back veneers.Catalog Number


No. Plys

Pc/Unit*

075341 ¾" 48" 96" AB 7 44075342 1" 48" 96" AB 9 30 *Pieces per unit listed for shipping reference purposes. Sheets are sold individually.

Fir PlywoodSuitable for general construction requirements, this plywood is manufactured of solid fir laminations. Catalog Number


No. Plys

Pc/Unit*

075331 ¾" 48" 96" AC 7 44075332 1" 48" 96" AC 9 33 *Pieces per unit listed for shipping reference purposes. Sheets are sold individually.

Pine PlywoodThisgeneralpurposeconstructiongradeplywoodisconstructedofpinelaminationsgluedwithexterioradhesive.Thisproductwillhavelarger internal voids and surface defects.Catalog Number


No. Plys

Pc/Unit*

075351 ¾" 48" 96" CDX 5 48 *Pieces per unit listed for shipping reference purposes. Sheets are sold individually.


Plywood &

Sheet Materials

Masonite SheetsFully tempered Masonite Sheets are hard, smooth, and most com-monlyusedforpatternlayout.Theyareavailableplainorpaintedwitha white latex primer on one side.Catalog Number Description


075310 Primed Tempered Masonite 1⁄8" 48" 96"075311 Primed Tempered Masonite ¼" 48" 96"075309 Plain Tempered Masonite 1⁄8" 48" 96"075319 Plain Tempered Masonite ¼" 48" 96"

Acetate SheetA clear economy cellulose acetate sheet which can be used for template and layout work. Packaged flat in 20" x 50" sheets.Catalog Number Description Thickness Width Length027520 Acetate Sheet .020 20" 50"027525 Acetate Sheet .030 20" 50"027530 Acetate Sheet .040 20" 50"027535 Acetate Sheet .060 20" 50"

Aluminum SheetIdeal for layouts, templates and build-ups. Sold by the sheet and shipped flat in 24" x 72" sheets.Catalog Number Description Thickness Width Length027540 Aluminum Sheet 0.032" 24" 72"027545 Aluminum Sheet 0.050" 24" 72"027550 Aluminum Sheet 0.063" 24" 72"027555 Aluminum Sheet 0.090" 24" 72"027560 Aluminum Sheet 0.125" 24" 72"027565 Aluminum Sheet 0.190" 24" 72"027570 Aluminum Sheet 0.250" 24" 72"

Brass SheetStocked in various thicknesses for accurate build-up dimensions. Sold in 12" x 48" sheet sizes.Catalog Number Description Thickness Width Length027580 Brass Sheet 0.016" 12" 48"027585 Brass Sheet 0.032" 12" 48"027590 Brass Sheet 0.050" 12" 48"027595 Brass Sheet 0.063" 12" 48"027605 Brass Sheet 0.093" 12" 48"027610 Brass Sheet 0.125" 12" 48"027620 Brass Sheet 0.188" 12" 48"027625 Brass Sheet 0.250" 12" 48"

ArmorboardArmorboard is an exterior plywood panel with 1⁄8" standard hardboard on both faces.Catalog Number Description


075370 Armorboard ¾" 48" 96"

Particle BoardIdeally suited for mold-box and master pattern bottom board construc-tion, this is a smooth-finish particle board.Catalog Number Description


075304 Particle Board ½" 48" 96"075101 Particle Board ¾" 48" 96"

MelaboardMelaboard is a white particle board panel with 130 gram melamine film thermally fused to both faces.Catalog Number Description


075350 Melaboard ¾" 49" 97"

Other Sheet Materials

Hardwood Plywood GradesHardwood plywood uses two alphanumeric characters to designatethegradeofthepanel.Thefaceisnormallygradedusing a letter, the back is normally graded using a number.

Face Grades A.Theveneerissmoothandfreeoflargeknots.Small

pin knots, burls, or slight mineral streaks are permitted. Thisisthebestgradeforaplywoodface.

B.Thisgradeissimilartothe“A”face,butsomesoundknotsor repaired knots are permitted. Slightly rougher grain and mineral streaks are typical of this grade.

C.Thisveneerwillcontainsoundknotsandrepairedknotsas well as unlimited pin knots and small burls. Mineral streaks are readily evident.

D.Thisgradeissimilartothe“C”gradefacebutwillpermitmore repaired knots, sound knots, and rough cut veneer.

Back Grades 1.Thisveneerwillhavesound,tightknotsupto3⁄8" in diame-

ter. Areas of rough grain and small splits may be permitted.

2.Thisbackfacewillhavesound,tightknotsupto3⁄4" in diameter. Repaired knots, rough cut veneer, and mineral streaks are common with this grade.

3.Thisgradepermits1⁄2" to 11⁄2" diameter knots on this face. Repaired knots, unlimited small defects, and streaks are also permitted.

Soft Wood Plywood GradesSoft wood plywood uses two letter characters to designate the gradeofthepanel.Thefaceisnormallygradedusingaletterandthe back is also graded using a letter.

A.Thisveneerissmoothandfreeofpitchpockets,knots, and open splits. Repaired splits or wood patches may be permitted.

B.Thisgradeissmoothandfreefromopendefects,butsoundknots up to 1" in diameter are evident. Wood repairs or repaired knots or splits are common in the veneer.

C. Unlimited tight knots up to 11⁄2" in diameter are character-istic to the grade. Open knots, splits, wood patches, and repairs are permitted.

D.Thisgradehasnolimittothenumberofdefectsorrepairs.Knotholes are permissible to 21⁄2" in diameter and open splits are common.

Plywood Grading Scales

Hardware & Equipment

1.800.321.851186

Freeman Lok-In Pattern Letters Freeman Lok-In Pattern Letters are widely used in the foundry industry for the fast changing of letters and numbers used for date code, serial number, and alloy identification. The holder and letters are made with a dovetail design to secure the characters firmly in place while permitting their easy removal and replacement. They are made of high quality investment cast steel.

Freeman Lok-In Pattern Letters

LetterCatalog Numbers

1⁄4" 3⁄8" 1⁄2" 3⁄4" 1⁄4" RecessedA 124410A 124430A 124450A 124470A 124490AB 124410B 124430B 124450B 124470B 124490BC 124410C 124430C 124450C 124470C 124490CD 124410D 124430D 124450D 124470D 124490DE 124410E 124430E 124450E 124470E 124490EF 124410F 124430F 124450F 124470F 124490FG 124410G 124430G 124450G 124470G 124490GH 124410H 124430H 124450H 124470H 124490HI 124410I 124430I 124450I 124470I 124490IJ 124410J 124430J 124450J 124470J 124490JK 124410K 124430K 124450K 124470K 124490KL 124410L 124430L 124450L 124470L 124490LM 124410M 124430M 124450M 124470M 124490MO* 124400 124420 124440 124460 124480N 124410N 124430N 124450N 124470N 124490NP 124410P 124430P 124450P 124470P 124490PQ 124410Q 124430Q 124450Q 124470Q 124490QR 124410R 124430R 124450R 124470R 124490RS 124410S 124430S 124450S 124470S 124490ST 124410T 124430T 124450T 124470T 124490TU 124410U 124430U 124450U 124470U 124490UV 124410V 124430V 124450V 124470V 124490VW 124410W 124430W 124450W 124470W 124490WX 124410X 124430X 124450X 124470X 124490XY 124410Y 124430Y 124450Y 124470Y 124490YZ 124410Z 124430Z 124450Z 124470Z 124490Z

Please note that the number nine is ordered as a six and the letter O is ordered as a zero.

Freeman Lok-In Pattern Numbers

NumberCatalog Numbers

¼" 3⁄8" ½" ¾" ¼" Recessed0 124400 124420 124440 124460 1244801 124401 124421 124441 124461 1244812 124402 124422 124442 124462 1244823 124403 124423 124443 124463 1244834 124404 124424 124444 124464 1244845 124405 124425 124445 124465 1244856 124406 124426 124446 124466 1244867 124407 124427 124447 124467 1244878 124408 124428 124448 124468 1244889* 124406 124426 124446 124466 124486

Blank 124411 124431 124451 124471Dash 124412 124432 124452 124472 124491

Please note that the number nine is ordered as a six and the letter O is ordered as a zero.

End Plates/Holders/Screws

DescriptionCatalog Number

¼" 3⁄8" ½" ¾"Lok-In End Plates (incl. screw) 124285 124295 124300 1243053 Letter Holder 124045 124125 124165 1242054 Letter Holder 124050 124130 124170 1242105 Letter Holder 124055 124135 124175 1242156 Letter Holder 124060 124140 124180 1242207 Letter Holder 124065 124145 124185 1242258 Letter Holder 124070 124150 124190 1242309 Letter Holder 124075 124155 124195 124235Replacement Screws 124320

NOTE: Lok-In End Plates are sold separately from Letter Holders.

A

E

DB

C

Letter Holder Size

3 Letter 4 Letter 5 Letter 6 Letter 7 Letter 8 Letter 9 LetterA C E B D B D B D B D B D B D B D

¼" ½ ¼ 3⁄16 111⁄16 13⁄16 131⁄32 115⁄32 2¼ 1¾ 217⁄32 21⁄32 213⁄16 25⁄16 33⁄32 219⁄32 313⁄32 229⁄323⁄8" ¾ 3⁄8 3⁄16 211⁄32 119⁄32 213⁄16 21⁄16 3¼ 2½ 311⁄16 215⁄16 43⁄16 37⁄16 419⁄32 327⁄32 51⁄16 49⁄32

½" 15⁄16 15⁄32 3⁄16 31⁄16 21⁄8 321⁄32 223⁄32 49⁄32 311⁄32 431⁄32 41⁄32 59⁄16 45⁄8 67⁄32 59⁄32 67⁄8 515⁄16

¾" 11⁄8 9⁄16 3⁄16 319⁄32 215⁄32 411⁄32 37⁄32 51⁄8 4 527⁄32 423⁄32 623⁄32 519⁄32 73⁄8 6¼ 81⁄8 7



Hardware &

Equipment

Flat-Face Gothic – White MetalCatalog Number Height Thickness Width

Drilling Availability

121194 3⁄16" 1⁄32" 0.200 No121196 ¼" 1⁄16" 0.331 No121198 5⁄16" 1⁄16" 0.400 Yes121200 3⁄8" 1⁄16" 0.450 Yes121202 ½" 1⁄16" 0.575 Yes121204 5⁄8" 1⁄64" 0.675 Yes121206 ¾" 3⁄32" 0.775 Yes121208 7⁄8" 3⁄32" 0.900 Yes121210 1" 1⁄8" 1.000 Yes121212 1¼" 9⁄64" 1.200 Yes121214 1½" 5⁄32" 1.450 Yes121216 2" 3⁄16" 1.900 Yes121218 2½" 3⁄16" 2.350 Yes

Heavy Hairline – White MetalCatalog Number Height Thickness Width


121124 1⁄8" 1⁄32" 0.143 No121126 3⁄16" 1⁄32" 0.200 No121128 ¼" 1⁄32" 0.250 No121130 5⁄16" 1⁄16" 0.300 No121132 3⁄8" 1⁄16" 0.350 No121134 ½" 1⁄16" 0.462 No121136 5⁄8" 1⁄16" 0.537 No121138 ¾" 1⁄16" 0.637 No121140 1" 1⁄8" 0.875 No

Light Hairline – White MetalCatalog Number Height Thickness Width


121156 1⁄8" 1⁄32" 0.125 No121158 3⁄16" 1⁄32" 0.175 No121160 ¼" 1⁄32" 0.231 No121162 5⁄16" 1⁄32" 0.275 No121164 3⁄8" 1⁄32" 0.318 No121166 ½" 1⁄16" 0.437 No121168 ¾" 1⁄16" 0.625 No

SEE ALSO: Product Page No.F-Bond CA Adhesives for affixing 64

Freeman Standard Pattern Letters

Freeman Pattern Letters and Figures are utilized for a wide range of applications throughout the pattern and foundry industries. Generally applied to the pattern or corebox, these letters enable identifications such as company name, part number, and date code to be permanently cast into the finished product.

Measurements are outside-to-outside of face or center-to-center of face, depending on style. Overall height greater because of draft.

Most styles available drilled for mounting purposes (additional charges apply). Please see product description for availability.

Ordering Information

When placing an order, please locate the catalog number from the lists provided for the desired style and size you would like. When providing this part number, add the number, symbol or letter you wish to order to the end of the catalog number and include the quantities you desire. Please note that the number nine is ordered as a six and the letter O is ordered as a zero.

Example: ¾" Sharp-Face Gothic White Metal ‘#6’ would be 121048#6 ¾" Sharp-Face Gothic White Metal ‘A’ would be 121048A

Sharp-Face Gothic – White MetalCatalog Number Height Thickness Width


121032 1⁄8" 1⁄16" 0.162 No121034 3⁄16" 1⁄16" 0.200 No121036 ¼" 1⁄16" 0.262 No121038 5⁄16" 1⁄16" 0.325 Yes121040 3⁄8" 1⁄16" 0.375 Yes121042 7⁄16" 1⁄16" 0.500 Yes121044 ½" 1⁄16" 0.555 Yes121046 5⁄8" 1⁄8" 0.700 Yes121048 ¾" 1⁄8" 0.725 Yes121050 7⁄8" 5⁄32" 0.850 Yes121052 1" 5⁄32" 0.950 Yes121054 1¼" 3⁄16" 1.150 Yes121056 1½" ¼" 1.400 Yes121060 2" ¼" 1.850 Yes121602 2½" 5⁄16" 2.300 Yes121604 3" 3⁄8" 2.750 Yes

Sharp-Face Gothic Reverse – White MetalCatalog Number Height Thickness Width


121084 3⁄16" 1⁄16" 0.200 No121086 ¼" 1⁄16" 0.262 No121088 5⁄16" 1⁄16" 0.325 Yes121090 3⁄8" 1⁄16" 0.375 Yes121092 ½" 3⁄32" 0.555 Yes121094 5⁄8" 1⁄8" 0.700 Yes121096 ¾" 1⁄8" 0.725 Yes121098 1" 5⁄32" 0.950 Yes121100 1¼" 13⁄64" 1.150 Yes121102 1½" 15⁄64" 1.400 Yes121104 2" 13⁄64" 1.850 Yes


1.800.321.851188

Freeman Standard Pattern Letters [CONTD.] Customized Logos

Round-Face Gothic – White MetalCatalog Number Height Thickness Width


121340 3⁄8" 3⁄32" 0.400 Yes121342 ½" 3⁄32" 0.537 Yes121344 5⁄8" 1⁄8" 0.637 Yes121346 ¾" 1⁄8" 0.725 Yes121348 1" 3⁄16" 0.950 Yes121350 1¼" 3⁄16" 1.175 Yes121352 1½" 3⁄16" 1.425 Yes

Deep Block – White MetalCatalog Number Height Thickness Width


121238 ¼" 1⁄8" 0.375 No121240 3⁄8" 1⁄8" 0.475 Yes121242 ½" 1⁄8" 0.575 Yes121244 5⁄8" 1⁄8" 0.662 Yes121246 ¾" 1⁄8" 0.762 Yes121248 7⁄8" 3⁄16" 0.862 Yes121250 1" 3⁄16" 0.950 Yes121252 1¼" 3⁄16" 1.175 Yes121254 1½" ¼" 1.350 Yes121256 2" ¼" 1.825 Yes

Tablet – White MetalCatalog Number Height Thickness Width


121522 ¼" 3⁄32" 0.350 No121526 3⁄8" 3⁄32" 0.425 Yes121528 ½" 3⁄32" 0.525 Yes121530 5⁄8" 3⁄32" 0.625 Yes121532 ¾" 3⁄32" 0.700 Yes121534 1" 3⁄32" 0.900 Yes121536 1¼" 1⁄8" 1.062 Yes121538 1½" 1⁄8" 1.250 Yes121542 2" 1⁄8" 1.700 Yes

SEE ALSO: Product Page No.F-Bond Instant CA Adhesives for affixing 64

Special letters, figures, monograms, and logos can be made either from existing patterns or a drawing.

Customized Logos are available for order in White Metal. There is a 100 piece minimum for each order.

Please provide the following for a quote:1. Dimensions (Length x Width x Thickness)2. To-Scale Drawing of Logo

We will respond with a price for the logos and the amount of the one-time set up charge for the mold. A mold will then be created and a sample will be sent for approval.

Fax all diagrams to: Freeman Manufacturing & Supply Co. Inside Sales Department (440) 934-7200

[email protected]

Freeman Pattern Letter CabinetOur Pattern Letter Cabinet is an ideal metal cabinet for pattern letter storage. Each drawer has a curved bottom so that letters can be easily removed and the dividers fit tightly to the drawer bottom so letters cannot slide from one compartment to the next. Enough drawer dividers are included to convert each drawer to 12 compartments. The cabinet is made up of two drawers and any number of two drawer units may be stacked one on top of the other. Interlocking tabs on the cabinet units hold stacked units firmly in place.

Specifications:•Standardunitsize–31⁄4" height x 11" length x 11" width•Drawersize–15⁄8" height x 11" length x 11" width•Numberofcompartments–12•Averagenumberoflettersperdrawer(SFGWhiteMetal)–

300 (½"); 90 (¾"); 40 (1")Catalog Number Description027435 Pattern Letter Cabinet027436 Additional Cabinet Dividers


Hardware &

Equipment

Tapes and Embossers

Roovers Embossing PressPrimarily used in the pattern and foundry industries for numbering patterns and core boxes. Other applications include numbering bins, parts, machines, storage areas, lockers, etc.

Known for their rugged construction and simple operation, these embossing presses are furnished with deep strike type characters. Reverse styles of characters are available; information upon request.Catalog Number Description Mfg. No.019370 Roovers Embossing Press – ¼" Letter Size, ½" Wide Tape T-10A019372 Roovers Embossing Press – 3⁄8" Letter Size, 7⁄8" Wide Tape T-20

Parts available upon request.

Embossing TapesWe offer Zinc, Aluminum, Brass, and Steel Embossing Tapes for use with Roovers or any other embossing presses.

Please note that Brass and Steel Tapes must be purchased in box quantities and have extended lead times. All other tapes are sold individually.Catalog Number Description

Letter Size Thickness

Roll Width

Roll Length

Rolls/Box

035075 Aluminum Embossing Tape ¼" .015 ½" 85' 10035070 Aluminum Embossing Tape ¼" .012 ½" 120' 10035090 Aluminum Embossing Tape 5⁄16" .018 ¾" 80' 7035100 Aluminum Embossing Tape 3⁄8" .018 7⁄8" 80' 6035110 Aluminum Embossing Tape ¾" .022 1¼" 65' 4035120 Aluminum Embossing Tape ¾" .022 1½" 65' 4035015 Zinc Embossing Tape ¼" .015 ½" 120' 10035025 Zinc Embossing Tape 5⁄16" .018 ¾" 80' 7035030 Zinc Embossing Tape 3⁄8" .020 7⁄8" 105' 6035035 Zinc Embossing Tape ½" .022 11⁄8" 95' 5035045 Zinc Embossing Tape ¾" .022 1½" 65' 4035124 Brass Embossing Tape ¼" .005 ½" 85' 10035125 Brass Embossing Tape 3⁄8" .020 7⁄8" 125' 6035076 Cold Roll Steel Embossing Tape ¼" .015 ½" 85' 10035078 Cold Roll Steel Embossing Tape 3⁄8" .015 7⁄8" 85' 6

Dymo TapewriterA portable tapewriter to use for almost any type of identification work. Will emboss letters and numbers on colored pressure sensitive vinyl tape or on metal tape without adhesive. Letters will mold in fine sand.

The Embosser includes one (1) standard wheel and one (1) reverse wheel.Catalog Number Description

Tape Width

019374 Dymo-Mite Hand Embosser – 3⁄16" Letter Size ½"035195 Aluminum Metal Tape without Adhesive ½"

Image above is at actual size.

7⁄8" Tape

½" Tape


1.800.321.851190

Abrasive Sheets (9" x 11")An extensive selection of garnet, aluminum oxide, and silicon car-bide abrasive sheets with paper or cloth backing. These sheets are sold in full package quantities.

Garnet Paper SheetsThese 3M™ abrasives are open coat—where the abrasive granules cover 50-70% of the backing and are set at a pre-determined spacing to reduce loading or clogging.Catalog Number Weight Grit Style No. Shts/Pkg132005 A 80 110N 50132010 A 100 110N 100132015 A 120 110N 100132020 A 150 110N 100132025 A 180 110N 100132030 A 220 110N 100132071 C 100 130N 100132076 C 120 130N 100132081 C 150 130N 100132052* D 40 – 50132056 D 50 140N 50132061 D 60 140N 50132066 D 80 140N 50 *Not manufactured by 3M

Aluminum-Oxide Cloth SheetsThese 3M abrasive products are made with aluminum oxide uniformly applied to light, J weight cloth sheets. They are primarily used for metalworking but may also be used for woodworking.Catalog Number Weight Grit Style No. Shts/Pkg132095 J 80 211K 50132100 J 100 211K 50132105 J 120 211K 50

Silicon Carbide Wetordry™ Paper SheetsThese sheet are made by coating a waterproof paper backing with silicon carbide.

The flexible A weight paper is designed primarily for automotive applications where wet sanding is required. The sturdy C weight paper is designed for general industrial applications where greater backing strength is required. Good for metal, wood or glass.Catalog Number Weight Grit Style No. Shts/Pkg132130 A 180 431Q 50132150 A 220 413Q 50132165 A 600 413Q 50132145 C 80 431Q 50132135 C 100 431Q 50132142 C 150 431Q 50132155 C 320 431Q 50132160 C 400 431Q 50

Silicon Carbide Coated Abrasive Mesh Commonly referred to as “drywall sandpaper” or “sanding screen”, this abrasive is made with a silicon carbide mineral that is coated on a dura-ble screen cloth mesh with waterproof bond. Ideal for plaster and other substrates that would load conventional abrasives. Catalog Number Grit Style No. Shts/Pkg132170 80 483W 25132175 100 483W 25

Abrasives

Types of Abrasives Offered:Garnet – A reddish brown, natural mineral, that features a medium hardness and good cutting edges that have a tendency to break or fracture when used, thus creating new cutting edges. Garnet is used primarily for fine finishing of wood.Aluminum Oxide – A synthetic, gray-brown mineral that is tough and durable. This widely used abrasive is ideal for both woodworking and metalworking.Silicon Carbide – A very hard, shiny, synthetic, black colored mineral that has a brittle quality permitting it to fracture into sharp, sliver-like wedges as it works. Silicon carbide is used for sanding a wide range of metals, plastics, or glass.

Types of Backings Offered:Paper – Used mainly with garnet abrasive. Paper sheets are available in weights A, C, and D (A being the lightest).Cloth – Produces a durable and flexible backing, and is mainly used with aluminum oxide abrasive.Waterproof Paper – Used mainly with silicon carbide abrasive.

Other weights & grits are available by special order. Please contact Customer Service for complete details.


Hardware &

Equipment

Disc Sanders Abrasives12" to 36" diameter abrasive discs for State, Master and other large disc sanders. Available in aluminum-oxide resin bond cloth and garnet paper.

3M™ Aluminum-Oxide PSA Cloth Discs These 3M discs are the premium in our line, featuring aluminum-oxide abrasive resin-bonded to a durable X weight cloth backing. These discs feature factory-applied adhesive on the backing to enable quick and easy installation to the machine. Primarily used for sanding metal.Catalog Number Diameter Grit Disc/Unit**131455 12" 40 10131465 15" 36 10131460 15" 40 10131457 15" 60 10131475 16" 36 10131470 16" 40 10131468 16" 60 10131480 18" 40 10131495 20" 36 10131490 20" 40 10131488 20" 50 10131487 20" 60 10131486 20" 80 10131515 24” 36 10131505 24” 40 10131510 24” 50 10131511 24” 60 10131530 30” 36 10131525 30” 40 10

**These discs are sold individually. Unit quantities are listed for pricing and packaging reference only.

3M Aluminum-Oxide Plain-Back Cloth Discs This product features aluminum oxide abrasive resin-bonded to a cloth backing for superior life when sanding metal. Freeman Latex Disc Cement must be used to apply these discs to the machine.Catalog Number Diameter Grit Disc/Pkg.**131590 20" 40 25131610 24" 36 10131605 24" 40 10131615 30" 40 10

**These discs are sold individually. Unit quantities are listed for pricing and packaging reference only.

Garnet Resin Bond Paper Discs Garnet is a natural mineral that, when used as an abrasive, provides excellent results for the sanding of wood. This sharp abrasive covers 100% of the disc (closed coat) for smooth stock removal and is resin-bonded for a long service life. Freeman Latex Disc Cement must be used to apply these discs to the machine.Catalog Number Diameter Grit Disc/Pkg.**131115 12" 40 100131135 15" 40 100131155 16" 40 100131165 18" 40 100131175 20" 40 25131195* 24" 40 20131201 24" 40 20131215 30" 40 20131223 36" 40 20*These discs are manufactured with a 1" diameter center hole. **These discs are sold individually. Unit quantities are listed for pricing and packaging reference only.

Freeman Latex Disc CementSpecifically formulated for securing paper and cloth-backed abrasives to any disc sanding machine. Freeman Latex Disc Cement is fast drying and easy to use.

6 Easy Steps For Application:1. Clean both surfaces to be bonded and

make sure steel disc is free of grease.2. Brush Freeman Latex Disc Cement onto both the abrasive

backing and steel disc.3. Allow Freeman Latex Disc Cement to dry (10-30 min.) before

applying abrasive.4. Align edges of abrasive disc to steel disc and apply carefully.5. Roll down abrasive disc from the center outward.6. Trim the excess abrasive from the outside diameter of the disc.

Catalog Number Description Availability025505 Freeman Latex Disc Cement Quart

Freeman Abrasive Cleaner Bar The Abrasive Cleaner Bariseasytouse–justhold the bar securely and carefully push against the rotatingabrasivediscuntilthemajorityofloadedparticlesareremoved.

By using the abrasive cleaner bar you will realize 3 to 4 times more abrasive disc and belt life. You will also prevent burning, chatter marks and machine vibration caused by loaded abrasives.Catalog Number Description Availability136850 Abrasive Cleaner Bar 15⁄8" x 15⁄8" x 8¼"

Abrasives [CONTD.]


1.800.321.851192

Abrasives [CONTD.]

Spindle Sanders AbrasivesOur abrasive sleeves and expand-ing rubber drums are designed for oscillating spindle sanders including State, Master, and other makes and models. These abra-sive sleeves are constructed to give dependable service and excellent surface finishes.

Garnet Sleeves Garnet is a natural mineral that, when used as an abrasive, provides excellent results for the sanding of wood.

For State Spindle Sanders*Catalog Number Diameter Length Grit133004 ¼" 5" 60133009 ¼" 6" 60133014 3⁄8" 6" 60133019 ½" 6" 60133027 ½" 9" 60133029 5⁄8" 6" 60133034 5⁄8" 9" 60133039 ¾" 9" 60133048 1" 9" 60133054 1" 11" 60133060 1¼" 9" 40133070 1½" 9" 40133080 2" 9" 40133090 2½" 9" 40133095 3" 9" 40133105 4" 9" 40

For Master Spindle Sanders*Catalog Number Diameter Length Grit133065 1¼" 11" 40133075 1½" 11" 40133085 2" 11" 40133100 3" 11" 40133110 4" 11" 40 *State and Master brands are listed for reference purposes. For other sander models please refer to diameter and length dimensions when choosing appropriate sleeves.

Aluminum-Oxide Sleeves Made with Aluminum-Oxide, a synthetic, grey-brown colored mineral that is tough and durable, these resin-bonded, cloth-backed abrasive sleeves are used primarily in metalworking and plastic applications.

For State Spindle Sanders*Catalog Number Diameter Length Grit133115 ¼" 5" 60133116 ¼" 5" 80133125 3⁄8" 6" 50133126 3⁄8" 6" 60133127 3⁄8" 6" 80133130 ½" 6" 50133131 ½" 6" 60133132 ½" 6" 80133140 5⁄8" 6" 50133141 5⁄8" 6" 60133142 5⁄8" 6" 80133150 ¾" 9" 50133151 ¾" 9" 60133155 1" 9" 50133156 1" 9" 60133165 1¼" 9" 40133170 1½" 9" 40133171 1½" 9" 60133172 1½" 9" 80133185 2" 9" 40133186 2" 9" 60133187 2" 9" 80133195 3" 9" 40133196 3" 9" 60133197 3" 9" 80133205 4" 9" 36133206 4" 9" 60133207 4" 9" 80

For Master Spindle Sanders*Catalog Number Diameter Length Grit133120 ¼" 6" 60133135 ½" 9" 50133145 5⁄8" 9" 50133160 1" 11" 50133175 1¼" 11" 40133180 1½" 11" 40133190 2" 11" 40133200 3" 11" 40133210 4" 11" 36 *State and Master brands are listed for reference purposes. For other sander models please refer to diameter and length dimensions when choosing appropriate sleeves.

Expandable Rubber Drums These Expandable Rubber Drums are made of a rubber compounded for proper resil-iency. For uniform compression and expansion, each drum is supplied with two steel washers appropriately sized to each drum. Each drum is 9" long and is sized to fit a ¾" diameter spindle.Catalog Number Description

Drum OutsideDiameter

133220 Expandable Rubber Drum 1"133225 Expandable Rubber Drum 1¼"133230 Expandable Rubber Drum 1½"133235 Expandable Rubber Drum 2"133242 Expandable Rubber Drum 2½"133245 Expandable Rubber Drum 3"133250 Expandable Rubber Drum 4"


Hardware &

Equipment

Abrasives [CONTD.]

3M™ Roloc™ Discs and HoldersUsed with grinders or electric drills, these abrasive discs are designed for grinding and polishing wood, metal, or plastic.

The exclusive 3M Roloc system locksthediscsecurelyinplacewithjustahalftwistandunlocksjustaseasily. Available with aluminum-oxide or Scotch-Brite abrasive.

3M Roloc Scotch-Brite Discs These 3M Roloc discs are made with a premium Scotch-Brite surface conditioning non-woven web to provide a burr-free finish. Removes grind marks, rust, and coatings. They are sold in full packages as listed and disc holders are sold separately.Catalog Number

Pad Diameter Color Grit Discs/Pkg

136871 1½" Brown coarse 50136872 1½" Maroon medium 50136873 1½" Blue very fine 50136874 2" Brown coarse 50136875 2" Maroon medium 50136876 2" Blue very fine 50136877 3" Brown coarse 25136878 3" Maroon medium 25136879 3" Blue very fine 25

3M Roloc Disc Holders These 3M Roloc Disc Holders are used exclusively with 3M Roloc Discs. Uniquely designed for fast and easy changing of the abrasive. Threaded in the center of the holder, a ½ twist installs or removes the disc. This holder is used with aluminum oxide or Scotch Brite discs. Shaftisthreaded¼"–20".Thepadhardnessisratedasmedium.These disc holders are sold individually. Catalog Number Description

Pad Diameter

135440 Disc Pad & Shaft Complete 1"135445 Disc Pad & Shaft Complete 1½"135450 Disc Pad & Shaft Complete 2"135455 Disc Pad & Shaft Complete 3"135460 Disc Pad & Shaft Complete 4"135477 ¼" – 20 UNC Threaded Shaft Only

Roloc Disc Pad

Thread Shaft

Roloc Disc Pad

Roloc Disc

3M Roloc Aluminum Oxide Discs 3M Roloc style TR (plastic button) discs are resin-bonded, aluminum oxide discs that are offered in a variety of pad hardnesses. They provide an extremely effective means of deburring and finishing wood or metal surfaces. The discs are sold in full packages as listed and the disc holders are sold separately and individually.Catalog Number

Pad Diameter Color Grit Discs/Pkg

135265 1" Brown 36 50135255 1" Green 50 50135250 1" Orange 60 50135245 1" Yellow 80 50135240 1" Blue 100 50135235 1" White 120 50135300 1½" Brown 36 50135290 1½" Green 50 50135285 1½" Orange 60 50135280 1½" Yellow 80 50135275 1½" Blue 100 50135273 1½" White 120 50135345 2" Black 24 50135340 2" Brown 36 50135330 2" Green 50 50135325 2" Orange 60 50135320 2" Yellow 80 50135315 2" Blue 100 50135310 2" White 120 50135375 3" Black 24 50135371 3" Brown 36 50135365 3" Green 50 50135360 3" Orange 60 50135355 3" Yellow 80 50135350 3" Blue 100 50135348 3" White 120 50135405 4" Brown 36 25135390 4" Orange 60 25135385 4" Yellow 80 25


1.800.321.851194

Abrasives [CONTD.]

Adhesive Backed (PSA) Discs and HoldersUsed with grinders or electric drills, these abrasive discs are designed for grinding and polishing wood, metal, or plastic.

Adhesive Backed (PSA) Resin-Bond Cloth DiscsThese aluminum-oxide discs are excellent for grinding and finishing applications. They are resin-bonded for added durability and adhesive-backed for quick and easy disc change. The flexible rubber holder (sold separately) assures pad contact with most contours.Catalog Number Diameter Grit135480 ½" 50135481 ½" 60135482 ½" 80135483 ½" 100135486 ¾" 40135487 ¾" 50135488 ¾" 60135489 ¾" 80135490 ¾" 100135493 1" 40135494 1" 50135495 1" 60135496 1" 80135497 1" 100135501 1½" 40135502 1½" 50135503 1½" 60135504 1½" 80135508 2" 36135509 2" 40135510 2" 50135512 2" 80135513 2" 100135514 2" 120135515 3" 36135516 3" 40135517 3" 50135518 3" 60135519 3" 80135523 4" 36135524 4" 40135525 4" 60135526 4" 80135527 4" 100135528 5" 36135529 5" 50

Disc Holders for Adhesive Backed DiscsA durable rubber pad that is stiff enough to hold its shape but flexible enough to prevent gouging, this product is great for use with the adhesive backed discs. All holders have a 1⁄4" shank to fit most hand grinders.Catalog Number

Disc Diameter

135200 ½"135205 ¾"135210 1"135215 1½"135220 2"135225 3"135230 4"

Scotch Brite® Industrial Hand Pads (6" x 9") Scotch-Brite Heavy Duty Hand Pad—Most

durable and aggressive pad for quick stock removal.

Scotch Brite Blending Pads—Slightly finer abrasive than the heavy duty pad. Excellent for removing scratches on metal, wood, or synthetic surfaces.

Scotch-Brite General Purpose Hand Pad—This is the most popular Scotch Brite abrasive because it is coarse enough for cleaning and finishing but fine enough to produce good surface finishes.

Scotch-Brite Ultra-Fine Hand Pad—Fine textured for ultra-fine finishing or metal, wood, plastics, and composites.

Scotch-Brite Light Duty Hand Pad—A very mild abrasive for gentle, yet through cleaning. Commonly used with liquid detergent.

Catalog Number Description Color Pads/Box Mfg. No.136800 Heavy Duty Tan 10 7440136802 Blending Gray 10 7446136805 General Purpose Maroon 20 7447136810 Ultra Fine Light Gray 20 7448136801 Light Duty White 20 7445


Hardware &

Equipment

Abrasives [CONTD.]

Cartridge Rolls These products are designed for finish sanding of concave surfaces of metal, wood, or plastics. Made from resin bonded aluminum oxide cloth for long life, these products work well with air or electric grind-ers. A steel mandrel must be used to secure the abrasive to the tool.Catalog Number

OutsideDiameter Length

Pilot Diameter Grit

Matched Mandrel(1⁄8" Shank / ¼" Shank)

134436 1⁄8" 1" 5⁄64" 100 801 / 134437 1⁄8" 1" 5⁄64" 120 801 / 134441 1⁄8" 1" 5⁄64" 80 801 / 134435 3⁄16" 1" 3⁄32" 80 / 805134440 3⁄16" 1" 5⁄64" 100 / 805134445 3⁄16" 1" 5⁄64" 140 / 805 134447 3⁄16" 1" 3⁄32" 240 / 805134454 ¼" 1" 1⁄8" 50 809 / 810134455 ¼" 1" 1⁄8" 60 809 / 810134460 ¼" 1" 1⁄8" 80 809 / 810134465 ¼" 1" 1⁄8" 100 809 / 810134470 ¼" 1" 1⁄8" 120 809 / 810134475 ¼" 1" 1⁄8" 240 809 / 810134480 ¼" 1½" 1⁄8" 50 803 / 820134485 ¼" 1½" 1⁄8" 60 803 / 820134490 ¼" 1½" 1⁄8" 80 803 / 820134495 ¼" 1½" 1⁄8" 100 803 / 820134500 ¼" 1½" 1⁄8" 120 803 / 820134505 ¼" 2" 1⁄8" 60 804 / 825134510 ¼" 2" 1⁄8" 80 804 / 825134511 5⁄16" 1½" 1⁄8" 60 803 / 820134515 5⁄16" 1½" 1⁄8" 80 803 / 820134520 5⁄16" 1½" 1⁄8" 100 803 / 820134525 5⁄16" 1½" 1⁄8" 120 803 / 820134526 5⁄16" 1½" 1⁄8" 150 803 / 820134530 3⁄8" 1" 1⁄8" 60 809 / 810134535 3⁄8" 1" 1⁄8" 80 809 / 810134540 3⁄8" 1" 1⁄8" 100 809 / 810134545 3⁄8" 1" 1⁄8" 120 809 / 810134550 3⁄8" 1½" 1⁄8" 50 803 / 820134555 3⁄8" 1½" 1⁄8" 60 803 / 820134560 3⁄8" 1½" 1⁄8" 80 803 / 820134565 3⁄8" 1½" 1⁄8" 100 803 / 820134570 3⁄8" 1½" 1⁄8" 120 803 / 820134575 3⁄8" 1½" 1⁄8" 150 803 / 820134579 3⁄8" 2" 1⁄8" 50 804 / 825134580 3⁄8" 2" 1⁄8" 60 804 / 825134585 3⁄8" 2" 1⁄8" 80 804 / 825134590 3⁄8" 2" 1⁄8" 100 804 / 825134586 3⁄8" 2" 1⁄8" 120 804 / 825

Cartridge Rolls [Contd.]Catalog Number

OutsideDiameter Length

Pilot Diameter Grit

Matched Mandrel(1⁄8" Shank / ¼" Shank)

134589 ½" 1" 1⁄8" 50 809 / 810134591 ½" 1" 1⁄8" 60 809 / 810134592 ½" 1" 1⁄8" 80 809 / 810134594 ½" 1" 1⁄8" 120 809 / 810134588 ½" 1" 1⁄8" 240 809 / 810134595 ½" 1½" 1⁄8" 40 803 / 820134600 ½" 1½" 1⁄8" 50 803 / 820134605 ½" 1½" 1⁄8" 60 803 / 820134610 ½" 1½" 1⁄8" 80 803 / 820134615 ½" 1½" 1⁄8" 100 803 / 820134620 ½" 1½" 1⁄8" 120 803 / 820134621 ½" 1½" 1⁄8" 150 803 / 820134630 ½" 2" 1⁄8" 40 804 / 825134640 ½" 2" 1⁄8" 60 804 / 825134645 ½" 2" 1⁄8" 80 804 / 825134650 ½" 2" 1⁄8" 100 804 / 825134710 5⁄8" 1½" 3⁄16" 50 804 / 825134715 5⁄8" 1½" 3⁄16" 60 / 831134720 5⁄8" 1½" 3⁄16" 80 / 831134721 5⁄8" 1½" 3⁄16" 100 / 831134775 1" 1½" ¼" 40 / 835134785 1" 2" ¼" 60 / 840134790 1" 2" ¼" 80 / 840Other sizes are available by special order. Minimums will apply. Contact customer service for details.

Mandrels for Cartridge Rolls This steel adaptor is used to secure and hold both tapered and parallel sided cartridge rolls to air grinders or electric drills. This holder is used by sliding the cartridge roll onto the mandrel pilot until the bottom of the abrasive touches the threaded steel area. Simply screw the cartridge roll onto the threads to secure.

Your mandrel should be at least ¼" shorter than your cartridge roll.

Mandrels with 1⁄8" Shank DiameterPilot Diameter

Pilot Length½" ¾" 1" 1½"

5⁄64" 1348013⁄32" 1348021⁄8" 134809 134803 134804

Mandrels with ¼" Shank DiameterPilot Diameter

Pilot Length½" ¾" 1" 1½" 2"

3⁄32" 134807 134805 1348061⁄8" 134808 134810 134820 134825 1348263⁄16" 134830 134831 134832¼" 134834 134835 134840 134841


1.800.321.851196

Fasteners

Wood ScrewsProfessional quality, zinc-plated wood screws from Freeman are made from high grade wire steel. They are available in phillips head (industrial pack only) and slotted head styles and are manufac-tured to provide “sure grip” turning torque while resisting the stripping of theslots–aproblemtypicalofthelesserqualitywoodscrews.

Industrial Pack Wood Screws

LengthQty

per BoxGage

8 10 12 141" 1000 034210P 034235P 034265

034210 0342351¼" 1000 034215P 034240P 034305

034215 0342401½" 1000 034220P 034245P 034275P 034310P

034220 034245 034275 0343101¾" 1000 034225 034250 034280P 034315

0342802" 1000 034230P 034255P 034285P 034320P

034230 034285 0343202¼" 1000 034231 034256 034286 0343252½" 1000 034232 034260P 034290P 034330P

034260 034290 0343302¾" 1000 034262 0343353" 1000 034261P 034300P 034340P

034261 034300 0343403½" 775 034302 034345P

0343454" 500 034350P

0343504½" 450 034355P

0343555" 400 034360P

0343606" 250 034364

A 'P' at the end of the product number denotes a phillips head.

Standard Pack Wood ScrewsA standard package includes 100 screws per box.

GageLength 6 8 10 12 14

¾" 034034 034036 0340371" 034053 035055 034056 034058

1¼" 034066 034067 0340691½" 034074 034076 034077 0340781¾" 034083 034084 0340852" 034091 034093 034094

2¼" 034103 0341052½" 034112 034113 034114 0341152¾" 0341243" 034132 034133 034134

3½" 034153 0341544" 034164

4½" 0341725" 0341816" 034191

Steel Pinch Dogs Made of forged tool-steel. Sold individually.Catalog Number Description Length044400 Steel Pinch Dogs ¾"044405 Steel Pinch Dogs 1"044410 Steel Pinch Dogs 1¼"044415 Steel Pinch Dogs 1½"044420 Steel Pinch Dogs 2"044425 Steel Pinch Dogs 2½"044430 Steel Pinch Dogs 3"044435 Steel Pinch Dogs 3½"

Solid Brass Escutcheon Pins Sold in one pound boxes.Catalog Number Description L

Head Diameter Gauge

Shaft Diameter

033580 Brass Escutcheon Pins ¼" 0.165 14 0.083033581 Brass Escutcheon Pins 3⁄8" 0.130 16 0.065033582 Brass Escutcheon Pins ½" 0.165 14 0.083033583 Brass Escutcheon Pins ½" 0.130 16 0.065033584 Brass Escutcheon Pins 5⁄8" 0.165 14 0.083033585 Brass Escutcheon Pins 5⁄8" 0.130 16 0.065033587 Brass Escutcheon Pins ¾" 0.165 14 0.083033588 Brass Escutcheon Pins ¾" 0.130 16 0.065033589 Brass Escutcheon Pins ¾" 0.092 18 0.048033590 Brass Escutcheon Pins 1" 0.165 14 0.083033591 Brass Escutcheon Pins 1" 0.130 16 0.065

Wire Brads Sold in one pound boxes.Catalog Number Description Length Gauge033501 Wire Brads – Gauge ½" 20033504 Wire Brads – Gauge ¾" 16033505 Wire Brads – Gauge ¾" 17033506 Wire Brads – Gauge ¾" 18033512 Wire Brads – Gauge ¾" 20033508 Wire Brads – Gauge 1" 16033509 Wire Brads – Gauge 1" 17033510 Wire Brads – Gauge 1" 18033514 Wire Brads – Gauge 1¼" 15033515 Wire Brads – Gauge 1¼" 16033516 Wire Brads – Gauge 1¼" 17033517 Wire Brads – Gauge 1¼" 18033518 Wire Brads – Gauge 1½" 15033519 Wire Brads – Gauge 1½" 16033521 Wire Brads – Gauge 1½" 18


Hardware &

Equipment

Flat Head Wire NailsSold in one pound boxes.Catalog Number Description Length Gauge033541 Flat Head Wire Nails ½" 18033543 Flat Head Wire Nails ½" 20033545 Flat Head Wire Nails 5⁄8" 18033547 Flat Head Wire Nails ¾" 16033548 Flat Head Wire Nails ¾" 17033549 Flat Head Wire Nails ¾" 18033551 Flat Head Wire Nails ¾" 20033554 Flat Head Wire Nails 1" 16033555 Flat Head Wire Nails 1" 17033556 Flat Head Wire Nails 1" 18033557 Flat Head Wire Nails 1¼" 16033558 Flat Head Wire Nails 1¼" 17033559 Flat Head Wire Nails 1¼" 18033560 Flat Head Wire Nails 1½" 16033562 Flat Head Wire Nails 1½" 18

Drywall Screws Self-tapping, coarse threaded drywall screws which may be used for numerous fastening applications. All of our drywall screws feature a phillips-style head.Catalog Number Description Length Gauge

ScrewsPer Box

034381 Drywall Screws 1" 6 10,000034383 Drywall Screws 1¼" 6 8,000034384 Drywall Screws 15⁄8" 6 5,000034385 Drywall Screws 2" 6 3,500034386 Drywall Screws 2½" 8 2,500034387 Drywall Screws 3" 8 2,000

Corrugated Fasteners Sold by the box (100 per box).Catalog Number Description Depth Corrugations033572 Corrugated Fasteners ½" 5033574 Corrugated Fasteners 5⁄8" 5

Fasteners [CONTD.] Band Saw Accessories

Matchless Grease StickWax based band saw blade lubricant packaged in a 2½" by 10" tube. 24 per case. Sold individually.Catalog Number Description Availability027725 Matchless Grease Stick 1¼ Lb.

Castrol Stick Wax Lubricant Light yellow wax that is used for the lubrication of metal cutting band saw blades and cutting tools. It is packaged in a cardboard tube for ease of use. Net weight is 15 ounces. Sold by the full case of 24 tubes.Catalog Number Description Diameter Length027886 Castrol Stick Wax 2" 11"

Band Saw Tire CementA contact adhesive for gluing band saw tires onto band saw wheels.

Usage Instructions:•Removeoldtire&cleanwheelcompletely•Withoutadhesive,stretchthetireonto

the wheel•Usingsmallwedges,createaspacebetween

the tire & the wheel•Applybandsawtirecementtobothtire&wheel•Usinganairhose,drytheadhesivecompletely•Repeatwithanothercoatofadhesiveanddryagain•Applyathirdapplication,ifnecessary,tobuildupthickness•Drycompletely•Removewedgesandpresstirefirmlytowheel•Readyforuseinonehour

Catalog Number Description Availability031550 Band Saw Tire Cement Pint

Band Saw Replacement TiresAll tires are 3⁄16" thick and each tire diameter before attachment is approxi-mately 20% less than the wheel diameter. Catalog Number Description

Wheel Diameter Tire Width

031500 Band Saw Tire 12" 11⁄16"031505 Band Saw Tire 14" 11⁄16"031510 Band Saw Tire 16" 15⁄16"031512 Band Saw Tire 18" 1½"031515 Band Saw Tire 20" 15⁄8"031520 Band Saw Tire 26" 2"031522 Band Saw Tire 28" 2"031525 Band Saw Tire 30" 2"031530 Band Saw Tire 32" 2"031532 Band Saw Tire 34" 21⁄8"031535 Band Saw Tire 36" 21⁄8"031540 Band Saw Tire 38" 2¼


1.800.321.851198

Gas Vac II Industrial Vacuum Degassing Unit Efficiently deaerates urethane elastomers and silicone rubbers resulting in casts that are virtually void-free in quality. Gas Vac II is designed for simplified and dependable operation.

Gas Vac II features:• Large,14"diameterx17"deep

vacuum chamber.•½hp,twostage,directdrivepump

that displaces up to 6 CFM. Thermal protected, capacitor start. 20 micron factory rating.

•Heavygage,clearacryliclidpermitsviewingofdegassing operation while maintaining a complete seal.

•Heavygagesteelsupportstandmountedonswivelcasters for versatility.

Specifications — 28"W x 25"D x 31"H, 115V, 60 Hz Motor.


Net Wt.(Lbs.)

054300 Gas Vac II Vacuum Degassing Unit 185054302 Vacuum Pump Oil – Quart054303 Gas Vac II SealOil and Seal are included with purchase of degassing unit. They are also sold separately.

Jiffy Mixer This all-purpose mixer is designed and manufactured to thoroughly mix epoxies, resins, plastics, chemicals, paints and many other materials at 450 to 750 RPM without:

•Suckingairintomaterial.•Splashingmaterialoutsidecontainer.


Shaft Length

Container Size

Top Dia.

Bottom Dia.

Depth of Head

Shaft Dia.

Model No.

054220 Jiffy Mixer 10¼" Pint 1¼" 1¼" 13⁄8" ¼" LM054215 Jiffy Mixer 10¼" Gallon 25⁄8" 25⁄8" 23⁄8" ¼" HS-1054210 Jiffy Mixer 20½" 5-10

Gallon45⁄8" 5½" 5" ½" PS-1

Plunge Industrial MixersThe heavy-duty Plunge Mixer has a rugged mixing head that is manufactured from a durable zinc-aluminum alloy casting and mounted with a set screw to a steel shaft. This product features smooth-bottom teeth that can thoroughly mix resins containing high density fillers much faster and more effectively than standard drill-driven paint mixers. The tumble finish on the mixing head allows for quick clean up of resins and paints. Catalog Number Description Size Length

Shaft Dia.

Head Dia.

Model No.

054190 Plunge Mixer Quart 13¼" 5⁄16" 2¼" 002054195 Plunge Mixer Gallon 17" 5⁄16" 3¼" 003054200 Plunge Mixer 5 Gallon 24" ½" 53⁄4" 006

Degassing & Mixing Equipment

The Red Devil 1400-00 Features:•Heavy-duty,twinarmdesignformixing–six

pints, four quarts, two gallons•Newsafetycoversthatcoverthemixerarms•Availablewithbenchmountorpedestalmount.• 15-minutedialtimer•110volt,1/3 HP, 60 Hz, heavy guard.

Model 1400-00 SpecificationsHeight ............................................ 31"Width .............................................. 41"Depth ............................................. 29"Weight (lbs.) ..................................191

No. 5153 Counter Base with coil spring suspension21" x 19" x 2"

No. 5151 Pedestal Base20" x 18" x 29"

Catalog Number Description HP Volts HZ054312 Red Devil Mixer 1⁄3 110 60054313 Counter Base054314 Pedestal Base

Red Devil Mixer Heavy duty, clamp design, electric mixer for effective mixing of Freeman’s line of Repro Fast Cast urethanes, paint, or any other low to medium viscosity liquid.


Hardware &

Equipment

Dispensing Equipment

Michael Meter-Mix Machines Super EThis bench top meter-mix machine is designed for quick, accurate, and precise dispensing of two component urethanes and epoxies. Air-powered abrasive resistant pumps deliver each component to the static mix tube in separate hoses, eliminating time consuming clean up after every use. The Super E can dispense 3-4 pounds of product per minute with mix ratios between 100:6 and 100:100. Overall size is 24" wide, 17" deep, and 18" high.

Pro MeterThis meter-mix machine is a larger version of the Super E and can dispense up to 10 pounds of mixed resin per minute. The Pro Meter is also air-powered, has abrasive resistant pumps that deliver each com-ponenttothestaticmixtubeinseparatehoses,andisfullyadjustablefor mix ratios from 100:6 to 100:100. Overall size is 40" wide, 26" deep, and 30" high. Catalog Number Description054340 Michaels Super E Meter Mix Machine 054343 Michaels Pro Meter Mix Machine

Static mixers and replacement parts are available upon request. Please contact customer service for information.

Gel Coat Mini Sprayer This spray gun uses a 32 ounce cup to hold the desired product for fast and easy clean up. This lightweight, gravity fed spray gun is used for applying gel coats, paints, adhesives, or parting films. Included with the gun are one 32 oz. plastic cup, two 32 oz. untreated disposable cups, one mil gauge, one solvent resistant lid, and 6 different nozzles for different viscosity fluids.Catalog Number Description300406 Gel Coat Mini-Sprayer

Miapoxy 100 Hand PumpsMiapoxy 100 Hand Pumps are specifically designed for fast and accurate dispensing of the Miapoxy 100 Resin and Hardener (pg. 34). Each pump is clearly marked with a blue sticker for resin and a red sticker for hardener. Use one stroke of the hardener pump for every stroke of the resin pump to obtain the correct mix ratio. Kit Size 1/2 includes 1 resin pump for quarts and gallons and 2 hardener pumps–oneforpintsandonefor quarts and gallons. Kit Size 3 includes 1 resin pump for 5-gallons and one hardener pump for quarts and gallons.Catalog Number Description Size406650 Miapoxy 100 Hand Pump 1/2 406655 Miapoxy 100 Hand Pump 3

Ohaus Triple-Beam BalanceThe Ohaus No. 760 Triple Beam Balance is an invaluable accessory because of the precise proportioning required in the mixing and blending of most epoxies and other multi-component adhesives and coating systems. It provides all the convenience of a top load scale plus the durability of larger models. A few of the outstanding features are:

•Magneticdampening.•Diecastaluminumboxedendbeam.• 6"diameterstainlesssteelplatewith225gr.tare.•Threenotchedandtieredbeams,(10x0.1gr.),(500x100gr.)

and (100 x 10g.) with center reading, sliding poises. •Metricweightattachmentofone(1)500gr.and

two (2) 1000 gr. weights.

Number DescriptionMfg.No.

054240 Ohaus Triple Beam Balance 760054240W Ohaus Metric Weight Set 707

Balance and weight set sold separately.

Ohaus Digital Bench Scale “Champ II”This heavy duty scale features a 30 pound capacity, 2 gram resolution, a 12" x 14" stainless steel weighing plat-form, and a 14" high stainless steel indicator column with backlit LCD. AC power adaptor included.Catalog Number Description

Mfg. No.

054244 Ohaus Champ II Scale CH 15R11

Ohaus Compact Electronic ScaleThis scale is useful in a wide variety of applications. It offers ease of operation, long battery life, and great performance. Three AA alkaline batteries are included for operation.Catalog Number Description

Mfg. No.

054239 Ohaus Compact Electronic Scale CS5000

Plastic Resin Portion ScaleThis scale was designed and engineered specifically for weighing plastics, chemi-cals, and plasters. Face dial markings are graduated in 1⁄2 ounces up to 80 ounces. Theadjustabledialpermitsweighingupto80 ounces without figuring or allowing for the container weight.Catalog Number Description054235 Plastic Resin Portion Scale

Scales & Balances


1.800.321.8511100

Assorted Cutters and Bits

Multi-Spur Wood Boring Drill BitsThese high speed steel wood boring bits are ideal for fast cutting of larger holes. Spurs cut clean holes while the center point provides precise location. Designed for wood only.Catalog Number Description

Bit Diameter

ShankDiameter

043518 Multi-Spur Drill Bits 9⁄16" ½"043524 Multi-Spur Drill Bits ¾" ½"043526 Multi-Spur Drill Bits 13⁄16" ½"043528 Multi-Spur Drill Bits 7⁄8" ½"043530 Multi-Spur Drill Bits 15⁄16" ½"043532 Multi-Spur Drill Bits 1" ½"043534 Multi-Spur Drill Bits 11⁄16" ½"043536 Multi-Spur Drill Bits 11⁄8" ½"043538 Multi-Spur Drill Bits 13⁄16" ½"043540 Multi-Spur Drill Bits 1¼" ½"043542 Multi-Spur Drill Bits 15⁄16" ½"043544 Multi-Spur Drill Bits 13⁄8" ½"043546 Multi-Spur Drill Bits 17⁄16" ½"043548 Multi-Spur Drill Bits 1½" ½"043550 Multi-Spur Drill Bits 19⁄16" ½"043552 Multi-Spur Drill Bits 15⁄8" ½"043554 Multi-Spur Drill Bits 1¾" ½"043556 Multi-Spur Drill Bits 17⁄8" ½"043558 Multi-Spur Drill Bits 2" ½"043560 Multi-Spur Drill Bits 21⁄8" ½"043562 Multi-Spur Drill Bits 2¼" ½"043564 Multi-Spur Drill Bits 23⁄8" ½"043566 Multi-Spur Drill Bits 2½" ½"043570 Multi-Spur Drill Bits 2¾" ½"043572 Multi-Spur Drill Bits 27⁄8" ½"043574 Multi-Spur Drill Bits 3" ½"043576 Multi-Spur Drill Bits 3¼" ¾"043578 Multi-Spur Drill Bits 3½" ¾"043580 Multi-Spur Drill Bits 3¾" ¾"043582 Multi-Spur Drill Bits 4" ¾"

Adjustable Countersink CutterThe Countersink Cutter has a beveled head and is used to countersink while drilling pilot holes for flat head wood screws. Set screw holds countersink head onto drill, so depth of drill and counter-sinkisadjustable.The Countersink Cutter can be used on any one of four drill sizes: 1⁄8", 3⁄16", 7⁄32" and ¼".Catalog Number Description

CountersinkDiameter

DrillSize

041996 Adjustable Countersink Cutter ½" 1⁄8"043820 Adjustable Countersink Cutter ½" 3⁄16"043822 Adjustable Countersink Cutter ½" 7⁄32"043824 Adjustable Countersink Cutter ½" ¼"

Rotary SurfacerSurfacing cutter designed to be used in a drill press to machine and plane wood and plastic. Features two diameters and silicon carbide cutters for long cutter life.Catalog Number Description Diameter043900 Rotary Surfacer 1½"043902 Rotary Surfacer 3"043904 Blade Only 1½"043906 Blade Only 3"

Wagner Safe-T-PlanerA precision, heavy-duty tool designed to perform professional planing, rabbeting, tenoning, panel raising, molding and staving operations with-out grabbing or kickback. Adaptable to ½" drill presses, this planer consists of a balanced, die-cast aluminum body with three removable, high-speed steel blades and a ½" shaft for mounting onto a drill press.

Specifications:• 31⁄8" Diameter Cut•¼" Deep• 6000rpmmaximum

Catalog Number Description048030 Wagner Safe-T-Planer048035 One Set of (3) Cutters048036 One Set of (3) Centering Screws048037 Grinding Wheel048038 Arbor for Grinding Wheel


Hardware &

Equipment

Shears for Carbon, Kevlar, and Fiberglass

Airtech Shop ShearsThese high quality shears are constructed from heavy gage stainless steel to provide years of service in cutting fiberglass and carbon cloth. Other fea-tures include:

•Thickerbladesforheavydutycutting•Bladesarehardenedthroughout–notcasehardened•SoftSantopreneinsertstocushionthehandles

Heritage Spring Action SnipThese are hot forged, chrome plated snips for cutting aramid, carbon, and fiberglass fabric. Other features include:

•Springactionselfopeningreducesfatigueduringuse•Micro-serratedbladesforeffectivecuttingofaramidfabric•Cushionhandlegripsforusercomfort

Airtech TechshearsThese shears are the highest quality that Airtech offers. Techshears are designed with a cantilever action that reduces cutting effort significantly. Other features include:

•Titaniumnitridecoatedreplaceablebladesforasupersharp,long lasting edge

•Sideadjustmentscrewsthatpermitsthecuttingforcetobeadjustedtothethicknessofthematerial

•Micro-serratedbladesareavailableforcuttingaramidfabric•Designedforbothleftandrighthanduse

Airtech AirshearsThese are high quality, lightweight shears for the efficient cutting of aramid, carbon, and fiberglass fabric. Other features include:

•Madefromhighcarbonstainlesssteel•Micro-serratedcuttingedgeforeffectivecuttingofaramidfabric•Springopeningactionforeaseofuse

Catalog Number Description Length402368 Airtech Shop Shears 10"048040 Spring Action Snip 6.5"402375 Airtech TechShears 10.5"402360 Airtech Techshears Micro-Serrated Replacement Blades 4.5"402370 Airtech Techshears Standards Replacement Blades 4.5"402403 Airtech Airshears 2400 9.1"402405 Airtech Airshears AS-1800 7.1"

Pattern Knives

These knives have adjustablehandlesthatare made of solid brass castings with rosewood inserts. Each handle is sanded, polished, and buffed to a high luster. The blades are made of 17 gauge chrome vanadium steel which is ground, polished, and honed to a fine edge. The handles and blades are sold separately.Catalog Number Description Width Length046030 Pattern Knife Handle – Standard 41⁄8"046035 Pattern Knife Blade – Standard ½" 6"046036 Pattern Knife Handle – Long 43⁄8"046037 Pattern Knife Blade – Long 5⁄8" 9"

Karbide Kutzall® Rotary BurrsKarbide Kutzall Rotary Burrs are ideal for wood, fiberglass, plastic, rubber, soft stone and composites. They feature pat-ented SSG structured carbide teeth. These tungsten-carbide teeth are very free-cutting and can be dressed to produce very smooth finishes. ALWAYS WEAR SAFETY GLASSES when working with these Rotary Burrs.Catalog Number Description

Head Diameter

HeadWidth

Shank Diameter

Mfg. No.

043840 Taper Head Shape ¼" 1¼" ¼" T-14043842 Taper Head Shape ½" ¾" ¼" T-12043844 Taper Head Shape ¾" 1¼" ¼" T-34043850 Ball Nose Head Shape ¼" 1¼" ¼" BN-14043852 Ball Nose Head Shape ½" ¾" ¼" BN-12043854 Ball Nose Head Shape ¾" 1" ¼" BN-34043860 Cylinder Head Shape ¼" 1¼" ¼" C-14043862 Cylinder Head Shape ½" ¾" ¼" C-12043864 Cylinder Head Shape ¾" 1¼" ¼" C-34

Brad Point Wood Boring Drill BitsThis high speed steel drill bit features a sharp center point for precise hole location and the outside diameter is designed to score the hole before stock removal. These two features combine to create a clean and accurate hole without chipping. Ideal for dowel pin installation. For use with wood only.Catalog Number Description

BitDiameter

ShankDiameter

Flute Length

OverallLength

043280 Brad Point Drill Bit 1⁄8" 1⁄8" 3"043284 Brad Point Drill Bit 3⁄16" 3⁄16" 3½“043288 Brad Point Drill Bit ¼" ¼" 4“043292 Brad Point Drill Bit 5⁄16" 5⁄16" 4½"043294 Brad Point Drill Bit 3⁄8" 3⁄8" 5"043296 Brad Point Drill Bit 7⁄16" 7⁄16" 5½"043300 Brad Point Drill Bit ½" ½" 6"043302 Brad Point Drill Bit 9⁄16" ½" 4" 6"043304 Brad Point Drill Bit 5⁄8" ½" 4" 6"043306 Brad Point Drill Bit 11⁄16" ½" 4" 6"043308 Brad Point Drill Bit ¾" ½" 4" 6"043312 Brad Point Drill Bit 7⁄8" ½" 4" 6"

Assorted Cutters and Bits [CONTD.]

Accessor ies

102 1.800.321.8511

Pattern Coatings (Primers, Paints & Sealers)

Freeman 90-1 Pattern Coating The industry standard, Freeman 90-1 is a durable, high-gloss, fast-drying, lacquer-based coating made up of heat-resistant resins to withstand the chemicals and heat encountered with most air-set and cold-set binders. It is self-leveling and can be applied by spraying when thinned with Freeman Fre-Thin Thinner (pg. 113).Catalog Number Color Availability

Net Wt. (Lbs.)

024105 Clear Gallon 10024110 Clear Orange Gallon 10024115 Black Gallon 10024120 Red Gallon 10024125 Burnt Orange Gallon 10024130 Yellow Gallon 10024135 Gray Gallon 10024140 Aluminum Gallon 10024145 White Gallon 10

Freeman No. 60 Pattern Coating Freeman No. 60 Pattern Coating is a sandable, gray-colored lacquer primer which is formulated for use with cold box and no-bake sand systems. It is ideal for wood patterns and core boxes and it also used as a primer for 90-1 coatings.Catalog Number Description Availability

Net Wt. (Lbs.)

024005 No. 60 Gray Primer Coating Gallon 10

Aluminum Paint Pot – 2 Quart This heavy-duty aluminum pot is ideal for applying any pattern coating or sealer by brush. For convenience there is a bar just below the rim of the pot to hang the brush while keeping the bristles in the paint. The domed cover seals the container, enclosing both paint and brush, preventing evaporation and thickening of the contents. Catalog Number Description046668 Aluminum Paint Pot (2 Quart)

Freeman Wood & Plaster Sealer This clear lacquer sanding sealer may be applied by brush or low pressure spray. Use Fre-Thin Thinner (pg. 113) for desired viscosity. Specially formulated to seal wood, plaster, sheet wax, MDF and other porous materials, It is ideal for sealing wood master models to prepare the surface for plastic duplication. For basic release procedures see page 119. Catalog Number Description Availability054554 Freeman Wood & Plaster – Aerosol 12 oz.054553 Freeman Wood & Plaster Sealer Pint054550 Freeman Wood & Plaster Sealer Gallon054551 Freeman Wood & Plaster Sealer 5 Gallon

Bacolac Professional Sandable Sealer This clear lacquer sanding sealer is specifically formulated as a high build, easily sandable coat-ing for sealing and smoothing wood, MDF, plaster, and other porous surfaces. Ideal for sealing wood models to prepare the surface for plastic duplication.Catalog Number Description Availability054531 Bacolac Sandable Sealer Gallon054532 Bacolac Reducer Gallon

RenShape 5008 Hi-Performance Sealer Low viscosity sealer specifically designed to create a clear, tough, chemical resistant, and high temperature resistant surface to RenShape 5008. Dries for use in 2 hours.Catalog Number Description Availability056526 RenShape 5008 Hi-Performace Sealer Gallon

Devcon Flexane FL-10 PrimerThis product is a blue one component adhesion pro-moter used to increase the bonding strength of liquid polyurethanes to metal surfaces. To use, apply two coats to a clean and roughened metal surface permitting 15 minutes between applications and 30 minutes prior to pouring the urethane. Catalog Number Description Mfg. No. Availability054635 Devcon FL-10 Flexane Primer 15980 4 oz.

Devcon Flexane FL-20 PrimerThis product is an orange one component adhesion promoter used to increase the bonding strength of liquid polyurethanes to concrete, rub-ber, urethane, wood, fiberglass, and cured epoxy surfaces. To use, apply two coats to the clean and roughened surface permitting 15 minutes between applications and 30 minutes prior to pouring the urethane.Catalog Number Description Mfg. No. Availability054639 Devcon FL-20 Flexane Primer 15985 4 oz.

Accessories

103

Accessories

Duratec Polyester Clear SealerThis low viscosity, rapid curing, two-component sealer is used to anchor Duratec primers to porous or hard to bond substrates such as MDF, wood, plaster, and concrete. Features a 14-16 minute gel time and may be top coated in 1-2 hours.Catalog Number Description Mfg. No. Availability024452 Duratec Clear Polyester Sealer 823 Gallon

Duratec Polyester Sanding & Surfacing PrimersThe Sanding Primer is the original formulation for easy sanding on applications that require only a moderate shine. The new Sanding Primer EZ is even easier to sand and produces a higher luster finish. The Surfacing Primer, while more difficult to sand, produces the high-est luster of the group. The Duratec Clear Hi-Gloss additive may be added to all three of these formulations for even greater shine.Catalog Number Description Mfg. No. Availability024472 Duratec Gray Sanding Primer 707-007 Gallon024457 Duratec Gray Sanding Primer EZ 707-060 Gallon024455 Duratec Gray Surfacing Primer 707-002 Gallon024458 Duratec White Surfacing Primer 714-002 Gallon024475 Duratec Clear Hi-Gloss Additive 904-001 Gallon

Duratec Vinyl Ester Surfacing PrimerThis two-component polyester surfacing compound is similar to the regular Surfacing Primer but offers a higher heat distortion temperature of 300°F. It is ideal for use in surfacing large or small vacuum form tools, as a high temperature gel coat to be reinforced with epoxy laminates and general mold resurfacing projects. Features an 18-22 minute gel time and may be sanded within 1-6 hours to a high gloss finish. Catalog Number Description Mfg. No. Availability024460 Duratec Vinyl Ester Primer 1799-005 Gallon

Duratec HardenerThe hardener is required for use with all of the Duratec resins listed above. Two of the 1.48 oz. bottles are enough to catalyze one gallon of resin.Catalog Number Description Availability024465 Duratec Hardener Only 1.48 oz.024468 Duratec Hardener Only Gallon

Duratec Mold Surfacing ProductsDuratec Mold Surfacing Products from Hawkeye Industries are designed to quickly establish a hard, durable, high gloss surface on lower cost mold materials such as RenShape Polyurethane Foam boards, MDF, plaster, and wood. These systems may also be used to resurface polyester molds to increase mold life. Each product must be used with the Duratec Hardener (sold sepa-rately, below). It is highly recommended to read the technical data sheet for complete application instructions prior to usage.

Pattern Coatings (Primers, Paints & Sealers) [CONTD.]

Duratec Hi-Gloss CoatingsFor the ultimate in high-gloss surfaces, Duratec offers two top-coat materials to apply over either the Duratec Polyester or Vinyl Ester Primers.Catalog Number Description Mfg. No. Availability024476 Duratec Clear Polyester Hi-Gloss Coating 904-040 Gallon024480 Duratec Clear Vinyl Ester Hi-Gloss Top-Coat 1904-045 Gallon

Krylon® SparVar™ Lacquer Paint Krylon SparVar Lacquer Paint is a durable acrylic that dries in 15 minutes and can be recoated anytime. Available in 11 oz. aerosol cans.Catalog Number Description Mfg. No.038060 Krylon SparVar Ultra-Flat Black Lacquer KS111038062 Krylon SparVar Perma-Clear Lacquer KS500

Krylon® Tough Coat™ Light Gray Sandable Primer This lacquer-based primer fills in porosity and other imper-fections on models and rigid molds. It is fast drying and easily sandable and can be top-coated with another high gloss lacquer or left as is. Available in 12 oz. aerosol cans.Catalog Number Description Mfg. No.038064 Light Gray Sandable Primer SO0341

Flake Shellac The best grade of light orange flake shellac. A bright, hard and glossy surface can be secured when mixed with our Alcohol Solvent. Typical mix ratio is 4 lbs. of Flake Shellac to 1 gallon of Alcohol Solvent (pg. 113). Catalog Number Description Availability027110 Flake Shellac by the pound

Prepared Shellac Zinsser shellac based sealer for painting wood, plaster, and other porous surfaces. Excellent “stain blocker”. Will remain bright and dry hard. Catalog Number Description Availability027115 Prepared Shellac – Amber Gallon

Formula Five Clean ‘N GlazeFormula Five Clean ‘N Glaze is a mild buffing compound used to remove fine scratches and surface hazing from mold surfaces. It will also produce a high luster finish for subsequent applications of mold wax.Catalog Number Description Availability054270 Formula Five Clean ‘N Glaze Quart

Coatings

Primers

Sealers

Accessor ies

104 1.800.321.8511

RenLease 805-1RenLease 805-1 is a white paste wax release agent which can be used on plastic, metal, or properly sealed wood and plaster molds. Contains no silicones.Catalog Number Description Availability056209 RenLease 805-1 Paste Wax Quart

Partall Paste #2 Paste #2 is a hard paste wax that is effective as a release agent for urethanes, epoxies, or polyester resin systems. It contains no silicone.Catalog Number Description

Net Wt.(Lbs.)

054267 Partall Paste #2 1.5

Partall Hi-Temp Wax Hi-Temp Wax is a hard wax that contains a blend of waxes and semi-permanent release agents to create an excellent release for resins that cure or catalyze at higher temperatures (150°F - 350°F). It contains no silicone.Catalog Number Description

Net Wt.(Lbs.)

054266 Partall Hi-Temp Wax 0.75

Chemwax 500Chemwax 500 is a wax release agent that is designed to be applied and let dry. This material offers fast solvent evaporation, no buffing required, and temperature stability to 300°F. May be applied with spray equipment, wiping, or brushing.Catalog Number Description Availability058374 Chemlease Chemwax 500 Gallon

Marbalease® Polymer Concrete ReleaseMarbalease Polymer Concrete Release is a fast drying liquid polishing compound designed as a release agent for polymer concrete applica-tions on polyester or metal molds, including heated molds. It may also be used as a general purpose release agent in applications where a smooth post-production finish is not required.Catalog Number Description Availability054268 Marbalease Release 5 Gallon

Formula Five Mold Release WaxFormula Five Mold Wax is formulated using carnuba wax, hydrocarbon waxes, and silicone to produce a highly effective mold release. Supplied in a paste consistency, this release is ideal for use with polyesters, epoxies, or urethanes.Catalog Number Description Availability054271 Formula Five Mold Release Wax 12 fl. oz.

Mold Releases – Sacrificial

Wax-Based Mold Releases

Freeman Wax ReleaseThis product is formulated and manufactured by Freeman specifically for the effective release of urethanes, epoxies, or polyester resins. It has a gel-like consistency, making it easy to apply with a brush. For basic release procedures see page 119.Catalog Number Description Availability055051 Freeman Wax Release Quart055052 Freeman Wax Release Gallon055053 Freeman Wax Release 5 Gallon

Johnson Paste WaxA good, general-purpose release agent for epoxies, urethanes, rubber, acrylics or ceramics. SC Johnson's original blend of hard finish waxes is a popular general-purpose release agent. Catalog Number Description Availability027885 Johnson Paste Wax 1 lb. Can

Trewax® Clear Paste WaxTrewax is a high quality paste wax preferred by many moldmakers to effectively release epoxies, polyesters, and polyurethanes. Catalog Number Description Availability027884 Trewax Clear Paste Wax 12.35 fl. oz.

Synlube 531Synlube 531 is a non-silicone, wax-based aerosol or liquid release agent specifically designed for the effective release of urethanes, epoxies, and poly-ester resins. Synlube 531 has a low viscosity, good wetting action, and spreads uniformly when applied.Catalog Number Description Availability057596 Synlube 531 Quart057599 Synlube 531 Aerosol – Single Can 14 fl. oz.057598 Synlube 531 Aerosol Case Qty – 12/Case 10.5 lb.

RenLease 803RenLease 803 is a wax based, white, liquid parting agent that may be brushed or sprayed. Contains a small amount of silicone, dries clear, and may be polished for high gloss. An excellent release at tempera-tures to 250°F and from all types of surfaces. A minimum of three coats is recommended.Catalog Number Description Availability

056216 RenLease 803 Wax Release Quart056220 RenLease 803 Wax Release 5 Gallon

105

Accessories

Mold Releases – Sacrificial [CONTD.]

Silicone-Based Mold ReleasesCaution: Silicone based mold releases should not be used when parts have to be painted.

RenLease 76 Silicone SprayRenLease 76 Silicone Spray is a premium quality silicone based spray release designed for use on epoxies and polyure-thanes. Improved spray pattern and dispersal from can.Catalog Number Description Availability056195 RenLease 76 Silicone Release 12 fl. oz.

RenLease 78-2 Silicone SprayRenLease 78-2 Silicone Release Agent is formulated specifically for epoxy and poly-urethane resin systems. Forms a slick, non-melting surface with a heat-resistance of up to 400°F.Catalog Number Description Availability056210 RenLease 78-2 Silicone Release 9.25 fl.oz.

Silicone SprayThis is a high-solids-content liquid in an aerosol can. Silicone spray is used to release epoxies or urethanes from any mold. It has a heat resistance up to 600°F for high heat applications.Catalog Number Description Availability054420 Silicone Spray 12 fl. Oz.

Chemlease 66H Silicone Release AgentChemlease 66H is a silicone for the effective release of epoxies and urethanes. Excellent temperature resistance of 600°F for hot molded parts. Available in liquid and aerosol packaging.Catalog Number Description Availability058310 Chemlease 66H 9.5 fl. oz058334 Chemlease 66H Gallon

Devcon Release AgentA silicone-based release agent provided in a liquid form. Works well on most all epoxy and urethane resins.Number Description Availability054644 Devcon Liquid Release Agent Pint

PVA-Based Mold Releases

Partall Film #10Partall Film #10 is a water and alcohol based polyvinyl alcohol (PVA) coating comprised of water soluble, film forming materials. It is excellent for releasing epoxies, polyesters, and urethanes. For basic release procedures see page 119.Catalog Number Description Availability054251 Partall #10 Mold Release Pint054256 Partall #10 Mold Release Gallon054261 Partall #10 Mold Release 5 Gallon054262 Partall #10 Mold Release Clear 5 Gallon

Partall Coverall Film PVAPartall Coverall Film is a non-flammable, water based, polyvinyl alcohol (PVA) coating comprised of non-hazardous, film-forming materials. It is excellent for releasing epoxies, polyesters, and urethanes.Catalog Number Description Availability054269 Partall Coverall Film Gallon

Other Mold Releases

Pattern Release 202Ideal for patterns and coatings used in the preparation of silicone rubber molds. This material is petroleum jelly in an aero-sol can and may be used on a wide variety of pattern materials.Catalog Number Description Availability054426 Pattern Release 202 16 fl. oz.

Sprayon P.T.F.E. Dry Film Mold Release Sprayon P.T.F.E. Dry Film Mold Release is made with DuPont Krytox® Dry Film, which provides excellent anti-stick properties that will not transfer to the finished part. This product contains no silicone to interfere with the painting of finished parts. Temperature resistance to 575°F.Catalog Number Description Availability038077 Sprayon P.T.F.E. Dry Film Mold Release 12 fl. oz.

Sprayon Zinc Sterate Mold Release Sprayon Zinc Sterate Mold Release is a non-silicone, paintable, fine particle powder produced for use in reinforced polyester thermoset compounds and plaster molds.Catalog Number Description Availability038074 Sprayon Zinc Stearate Mold Release 12 fl. oz.

Sprayon Paintable Mold Release Sprayon Paintable Mold Release exhibits excellent release properties where low silicone concentration is required and it will not interfere with coating or bonding operations subsequent to molding.Catalog Number Description Availability038078 Sprayon Paintable Mold Release 12 fl. oz.

Accessor ies

106 1.800.321.8511

Semi-Permanent Mold Sealers

Chemlease 15 Sealer EZChemlease 15 Sealer EZ is a mold sealer specifically designed to min-imize mold porosity when using semi-permanent release agents. Compatible with fiberglass, metals, and most solid or dense surfaces. It is the recommended sealer for RenShape 2000.

The EZ version of this mate-rial does not contain any chemicals listed on the Hazardous Air Pollutants list (HAPs). The original non-EZ formulation is still available for a limited time.Catalog Number Description Availability058002 Chemlease 15 Sealer EZ Quart058004 Chemlease 15 Sealer EZ Gallon058006 Chemlease 15 Sealer EZ 5 Gallon058432 Chemlease 15 Sealer Quart058434 Chemlease 15 Sealer Gallon

Zyvax SealproofZyvax Sealproof is a durable non-VOC visible film with superior adhesion to all types of wood, composites, and metals. Zyvax Sealproof gives a matte surface. For parts requiring a high gloss finish, Zyvax Sealbrite or Zyvax Sealer GP should be used. Zyvax Sealproof, when applied in conjunction with Enviroshield Release Agent, provides multiple releases and reduces down time due to cleaning.Catalog Number Description Availability300010 Zyvax Sealproof Gallon

Zyvax Sealer GPZyvax Sealer GP is a high modulus, clear, flexible film with superior substrate adhesion that forms a protective shield on the mold or tool surface. As a conditioner, Sealer GP is designed to treat both the chemical and physical bonding sites found on every raw mold surface. In addition, Sealer GP provides the base needed to extend the life of the release coating and will allow optimal performance from the release coating.Catalog Number Description Availability300020 Zyvax Sealer GP Gallon

Semi-Permanent Release Agents

Chemlease R&B EZChemlease R&B EZ is a high slip semi-permanent release for closed molding of abrasive materials or low draft parts. This product features multiple releases between applications and produces an excellent gloss with minimal transfer to the finished part. Used as a wipe on/wipe off product.

The EZ version of this material does not contain any chemicals listed on the Hazardous Air Pollutants list (HAPs). The original non-EZ formulation is still available for a limited time.Catalog Number Description Availability058424 Chemlease R&B EZ Gallon058274 Chemlease R&B Gallon

Semi-Permanent Mold Release Systems

Semi-Permanent Mold Cleaners

Chemlease Mold Cleaner EZChemlease Mold Cleaner removes release agents, buffing and polishing compounds, dirt, and grease from a variety of mold surfaces. The resulting surface is then suitable for applying Chemlease semi-permanent primers and sealers, ensuring that a good chemical bond is obtained.

The EZ version of this material does not contain any chemicals listed on the Hazardous Air Pollutants list (HAPs). The original non-EZ formulation is still available for a limited time.Catalog Number Description Availability058194 Chemlease Mold Cleaner EZ Gallon058184 Chemlease Mold Cleaner Gallon058186 Chemlease Mold Cleaner 5 Gallon

Chemlease Hydrolease CleanerChemlease Hydrolease Cleaner is an environmentally friendly, water based mold cleaner. Ideal for removing sealers, primers, and topcoats from metal, polyester, and vinyl ester molds. Catalog Number Description Availability058154 Chemlease Hydrolease Cleaner Gallon

Chemlease Mold Cleaner 201BChemlease Mold Cleaner 201B is designed for removing thermoset and thermoplastic polymers from mold surfaces. It works effectively on metal molds, but due to the aggressiveness of this cleaner, it is not suggested for use on composite molds. Catalog Number Description Availability058486 Chemlease Mold Cleaner 201B 5 Gallon

Semi-Permanent Mold Primers

Chemlease MPP 117Chemlease MPP 117 is a one component mold primer for polyester, epoxy, phenolic, and metal molds. Applied using a clean cotton cloth, two coats of this material is typically sufficient to seal the mold surface. MPP 117 is not a release agent, so proper Chemlease release agents need to be applied over this cured surface to ensure good demold.Catalog Number Description Availability058204 Chemlease MPP 117 Gallon

Chemlease MPP 2180Chemlease MPP 2180 is a heavy duty primer used to prepare and seal mold surfaces. Excellent for polyester, epoxy, phenolic, and metal. Provides a smooth, non-porous surface for the application of semi-permanent sealers and release agents. MPP 2180 is a mold primer only and has no release properties.Catalog Number Description Availability058212 Chemlease MPP 2180 Quart058214 Chemlease MPP 2180 Gallon

107

Accessories

Semi-Permanent Releases Systems [CONTD.]

Semi-Permanent Release Agents [con't]

Chemlease One FS EZChemlease One FS EZ is a semi-permanent release that is easy to apply and provides multiple releases for high gloss composite molding. Used as a wipe on only product.

The EZ version of this material does not contain any chemicals listed on the Hazardous Air Pollutants list (HAPs). The original non-EZ formulation is still available for a limited time.Catalog Number Description Availability058474 Chemlease One FS EZ Gallon058476 Chemlease One FS EZ 5 Gallon058478 Chemlease One FS EZ 55 Gallon058224 Chemlease One FS Gallon

Chemlease PMR EZChemlease PMR is a semi-permanent release specifically designed for the composites industry where a high quality finish is required. This product features multiple releases between applications and produces an excellent gloss with minimal transfer to the finished part. Used as a wipe on /wipe off product. Chemlease PMR-90 EZ is a higher slip formulation of Chemlease PMR EZ.

The EZ version of this material does not contain any chemicals listed on the Hazardous Air Pollutants list (HAPs). The original non-EZ formulation is still available for a limited time.Catalog Number Description Availability058244 Chemlease PMR EZ Gallon058246 Chemlease PMR EZ 5 Gallon058234 Chemlease PMR Gallon058264 Chemlease PMR-90 EZ Gallon

Chemlease MR-515HChemlease MR-515H is a specialized release agent designed specifi-cally for releasing urethane rigid foams, cast urethane elastomers, and other thermoset resins. For best results, apply using conventional spray equipment. Reapply after every part to ensure good release.Catalog Number Description Availability058496 Chemlease MR-515H 5 Gallon

Chemlease SK-3Chemlease SK-3 is a specialty top coat that is designed to be used for releasing polyester parts. This product is unique in the sense that it may be sprayed on with HVLP equipment or applied in the traditional wipe on manner. When applied via spraying there is no wait time between coats, thus reducing application costs.Catalog Number Description Availability058304 Chemlease SK-3 Gallon058306 Chemlease SK-3 5 Gallon

Chemlease 41 EZChemlease 41 EZ is a semi-permanent release specifically designed for the composites industry where a matte finish is desired. This product features multiple releases between applications with minimal transfer to the finished part. Used as a wipe on /wipe off product. Chemlease 41-90 EZ is a higher slip formulation of Chemlease 41 EZ. Neither product contains any chemicals listed on the Hazardous Air Pollutants list (HAPs).Catalog Number Description Availability058024 Chemlease 41 EZ Gallon058026 Chemlease 41 EZ 5 Gallon058044 Chemlease 41-90 EZ Gallon058046 Chemlease 41-90 EZ 5 Gallon

Chemlease 70 EZChemlease 70 EZ is a semi-permanent release specifically designed for the composites industry where a high quality finish is required. This product features multiple releases between applications and produces an excellent gloss with minimal transfer to the finished part. Used as a wipe on /wipe off product. Chemlease 70-90 EZ is a higher slip formulation of Chemlease 70 EZ. This material does not contain any chemicals listed on the Hazardous Air Pollutants list (HAPs). Catalog Number Description Availability058064 Chemlease 70 EZ Gallon058084 Chemlease 70-90 EZ Gallon

Chemlease 75Chemlease 75 is a semi-permanent release specifically designed for the marine and cultured marble industry where a high gloss finish is required. Excellent for large parts where pre-release may be a prob-lem. Used as a wipe on /wipe off product. Catalog Number Description Availability058094 Chemlease 75 Gallon

Zyvax EnviroShieldZyvax Enviroshield is a versatile, odorless and non VOC release agent that is recommended for applications requiring multiple releases, superior surface finish with high gloss, and easy touch-up for seamless production cycles. Enviroshield gives outstanding release performance when applied over Sealer GP. It chemically bonds to the mold surface and, when applied correctly, it will not transfer to the molded part or other processing equipment. Catalog Number Description Availability300025 Zyvax EnviroShield Gallon

Zyvax WaterShieldZyvax Watershield is a high performance polymer coating that has been created to give multiple releases while exceeding the most demanding environmental requirements. Watershield has no VOC's and is so versatile it can be used for most molding operations and is preferred for application directly on warm mold tools.Catalog Number Description Availability300030 Zyvax WaterShield Gallon

Accessor ies

108 1.800.321.8511

Tyvek® SleevesThese 18" long sleeves are designed to protect workers’ arms from resin contact. Tyvek is a durable, yet pliable fabric that resists tears, snags, and punctures, and its slick surface prevents particle entrapment.Catalog Number Description Length418002 Tyvek Sleeves 18"

Tyvek® ApronThese comfortable, reusable aprons form a virtually impermeable barrier against dirt, grease, grime, sprays, chemicals, and moisture. Tyvek is a durable, yet pliable fabric that resists tears, snags, and punctures. Its slick surface prevents particle entrapment. Even though these aprons are disposable, they can often be used over and over (depending on work conditions).

The bib-style aprons feature serged seams and long ties for a comfortable fit. The Tyvek aprons are 28 inches wide by 36 inches long.Catalog Number Description Size418001 Tyvek Bib Style Apron 28" x 36"

Freeman Heavy-Duty Shop ApronA very heavyweight cotton apron which is tough enough for shop use. Features include two chest pockets, two hip pockets, metal ferrule tie holes and heavy-duty stitching. Catalog Number Description054065 Heavy Duty Shop Apron

Gloves & Protective Wear

Vinyl GlovesVinyl gloves are an economical choice for use in activities that do not require the highest degree of tactile precision. Vinyl does not offer as much dexterity as nitrile or latex and tends to tear more easily. But for general, low-risk applications, vinyl offers the best value. Our vinyl gloves feature rolled cuffs to provide greater tear resistance and easy gripping.Catalog Number Description Size

PairsPer Box

054060 Vinyl Gloves – 5 mil Large 50054061 Vinyl Gloves – 5 mil X-Large 50

Latex GlovesLatex gloves provide superior dexterity and barrier protection. However, because latex is a natu-ral substance, the protein in latex gloves can cause an allergic reaction and irritation in many people. Our latex gloves feature rolled cuffs to provide greater tear resistance and easy gripping.Catalog Number Description Size

PairsPer Box

054064 Latex Gloves – 8 mil Large 100054063 Latex Gloves – 8 mil X-Large 100054066 Powder Free Latex Gloves – 7.5 mil Large 50054068 Powder Free Latex Gloves – 7.5 mil X-Large 50

Nitrile GlovesNitrile gloves are made of syn-thetic latex. They contain no latex proteins and are three times more puncture resistant than latex rub-ber. More importantly, they offer superior resistance to many types of chemicals.Catalog Number Description Size

PairsPer Box

054070 Nitrile Gloves – 7 mil Large 50054069 Nitrile Gloves – 7 mil X-Large 50

3M Particulate Respirators (Mask)Because of its low profile shape, eye glasses, goggles and face shields can be easily worn without interfer-ence. Excellent to wear when operating sanders and other dust creating equipment. Not designed for use against toxic dusts, spray paints, or organic vapor.Catalog Number Description Qty/Box

Mfg. No.

054526 3M Respirator 20 8210

109

Accessories

Mixing Cups & Paddles Clean-Up Supplies

Paper CupsThese economical paper cups are ideal for mixing all types of tooling and reproduction plastics. The lined paper cups are specially coated to prevent resin absorption. The larger paper cups are untreated.

Number Description SizeCups PerPackage

Cups PerCase

054037 Lined Paper Cups 16 oz. 50 500054042 Lined Paper Cups 32 oz. 25 500054045 Untreated Paper Cups 64 oz. 50 300054048 Untreated Paper Cups 83 oz. 25 100054050 Untreated Paper Cups 165 oz. 25 100

Plain Plastic CupsThese economical plastic cups are ideal for mixing all types of tooling and reproduction plastics. They are made of high density polyethylene (HDPE), white in color, and unmarked.

Number Description SizeCups Per

Case054031 White Plastic Cups 12 oz. 500054036 White Plastic Cups 16 oz. 500054041 White Plastic Cups 32 oz. 500054047 White Plastic Cups 64 oz. 200054049 White Plastic Cups 85 oz. 200054056 White Plastic Cups with Wire Handle 128 oz. 120054051 White Plastic Cups 166 oz. 120

Graduated Plastic CupsThese convenient plastic cups are also made of high density polyethylene (HDPE). However, these cups are translucent and have both milliliter and ounce graduations on the container to aid in mixing.

Number Description SizeCups Per

Case054025 Clear Plastic with Graduations 24 oz. 100054026 Clear Plastic with Graduations 48 oz. 50

Wood Mixing PaddlesWood mixing paddles for both gallon and 5 gallon containers. Both paddles are ideal for mix-ing paint, urethanes, epoxies, or any other liquid. Sold by the box.Catalog Number Description Thickness Width Length Qty/Box054521 Wood Mixing Paddles (for 1 Gallon) 1/8" 11/8" 14" 500054525 Wood Mixing Paddles (for 5 Gallon) 7/32" 13/8" 21" 200

Tongue Depressors Polished hardwood, ¾" x 6", packaged 500 per box. Excellent for mixing small quantities of tooling plastics and repair materials.Catalog Number Description Width Length Qty/Box054520 Tongue Depressors ¾" 6" 500

Freeman 302 Urethane Protectant Freeman 302 is an inert gas used to pre-serve and prolong the usable life of moisture sensitive polyurethanes. Before resealing the containers, spray a short burst of Freeman 302 in the open container and seal immedi-ately. Repeat after every use.Catalog Number Description Availability054706 Freeman 302 Urethane Protectant 10 oz.

MVP Waterless Hand Cleaner MVP is a waterless hand cleaner that removes grease, resins, oils, adhesives, and tar. Does not contain harsh abrasives or irritating solvents. Contains lanolin to soothe and smooth skin. MVP gallon size has a convenient pump (sold separately) for easy dispensing.Catalog Number Description Availability054208 MVP Waterless Hand Cleaner 10 oz.054209 MVP Waterless Hand Cleaner Quart054205 MVP Waterless Hand Cleaner Gallon054206 Pump Only for MVP Waterless Hand Cleaner

Epoxy Hand Cleaner, LiquidThis liquid cleaner contains no caustics or petroleum solvents. It cleans hands of the most resinous substances or greases includ-ing epoxy, urethane, polyester, adhesives, paints and inks.Catalog Number Description Availability054207 Liquid Epoxy Hand Cleaner 16 oz.

WypAll Shop Rags These general purpose shop rags are made of 100% cotton and used for clean-up, cleaning mold surfaces from excess release, and applying Chemlease mold cleaners, primers, and semi-permanent release agents. There are 100 rags in each handy pop-up dispenser.Catalog Number Description418010 WypAll X70 Shop Rags

Safety Plunger CanThe Safety Plunger Can is ideal for dispensing acetone (pg. 113) onto a shop rag for mold cleaning. Can is one quart size. For dispensing, place shop rag on dispenser and depress the plunger.Catalog Number Description Availability418005 Safety Plunger Can Quart

Accessor ies

110 1.800.321.8511

Brushes

White-Bristle Throwaway Brush Low cost and expendable. Ideal for epoxy tooling work and one-time use. Unpainted wood handle with pure bristles firmly fastened in the ferrule.Catalog Number Description Width Qty / Box

032215 White Pure Bristle Throwaway Brush, ½" 36032220 White Pure Bristle Throwaway Brush 1" 36032225 White Pure Bristle Throwaway Brush 1½" 36032230 White Pure Bristle Throwaway Brush 2" 36032235 White Pure Bristle Throwaway Brush 2½" 24032240 White Pure Bristle Throwaway Brush 3" 24

Ox Hair Brush This brush features very fine and soft ox hair bristles, a chiseled edge, nickeled ferrule, and a walnut finish handle. Ideal for applying shellac and other coatings. CatalogNumber Description Width Qty / Box032085 Ox Hair Brush ¼" 12032090 Ox Hair Brush ½" 12032100 Ox Hair Brush 1" 12

Acid Brush This acid brush, used for applying sur-face coats, features a long metal handle and ½" chiseled edge horsehair bristle. An economical, throwaway-type brush that is good for brushing into small areas. CatalogNumber Description Width Qty / Box032330 Acid Brush (box) ½" 144

Shop Brush The short trim makes this brush stiffer for factory use. Raised black band on natural lacquered block.CatalogNumber Description Width Length032030 Shop Brush 2" 8"

Nylon Throwaway Brush Low cost and expendable, this brush is excellent for applying epoxy surface coats. It features a plastic handle with nylon bristles firmly fastened in the ferrule.Catalog Number Description Width Qty / Box032300 Nylon Throwaway Brush ½" 72032305 Nylon Throwaway Brush 1" 72032310 Nylon Throwaway Brush 1½" 72032315 Nylon Throwaway Brush 2" 72032325 Nylon Throwaway Brush 3" 48

Molder’s Brush The Molder’s Brush features black horsehair set into a solid hardwood handle. A good brush for general foundry applications.CatalogNumber Description Width

TrimLength Block Size Qty / Box

032080 Molder’s Brush 11⁄8" 27⁄8" 9" x 11⁄8" 6

Economy Flat-Bristle Brush This brush features pure white china bristles, double thick with a chiseled edge. Bristles are secured with a nickeled ferrule plastic handle.

Number Description Width ThicknessTrim

LengthQty/Box

032060 Economy Flat Bristle Brush ½" ¼" 15⁄8" 12032065 Economy Flat Bristle Brush 1" 7⁄16" 21⁄8" 12032070 Economy Flat Bristle Brush 1½" ½" 21⁄8" 12032075 Economy Flat Bristle Brush 2" 9⁄16" 21⁄8" 12032080 Economy Flat Bristle Brush 3" 11⁄16" 23⁄8" 12

Casting Brush This brush is made of first grade flat tempered steel wire, mounted into a hardwood block.CatalogNumber Description

TrimLength Block Size Qty / Box

032275 Casting Brush 4" 7¾" x 2¾" 6

Wedges

High Impact wedges to assist in demolding applications. Color coded for easy identification.GREEN-“Super Tuff” – Made of extremely high impact nylon. High

quality wedge that maintains a sharp insertion edge five times longer than standard wedges to ensure that there is no damage to mold edges.

WHITE-“Econo” – Made of high grade plastic to resist breakage. Lower cost wedge. Has a textured finish.

TAN-“Flex” – Made of flexible plastic for inserting into compound curved mold edges.

Catalog Number Description Thickness Width Length Color300380 Super Tuff Nylon Wedge ½" 1½" 4" Green300386 Super Tuff Nylon Wedge 5⁄8" 21⁄8" 6" Gray300384 Econo Wedge ½" 1½" 4" White300390 Econo Wedge 5⁄8" 21⁄8" 6" White300394 Econo Wedge 1 31⁄8" 10" White300382 Flex Wedge ½" 1½" 4" Tan300388 Flex Wedge 5⁄8" 21⁄8" 6" Tan300392 Flex Wedge 1 31⁄8" 10" Tan

111

Accessories

Bodi Standard RollersBodi Standard Rollers are strong, long-life rollers made with deep grooves and thin fins providing excel-lent air release. The patented handle, with a rubber modified polypropylene design, is proven least tiring during long hours of use. Also accepts exten-sion handles for hard to reach jobs. Non-corrosive ¼" frames. Cleans easily in solvent.Catalog Number Description Diameter Length300308 Standard Aluminum Roller, w/ Handle ½" 3"300310 Standard Aluminum Roller, w/ Handle ½" 6"300320 Standard Aluminum Roller, w/ Handle 5⁄8" 6"300322 Standard Aluminum Roller, w/ Handle ¾" 3"300326 Standard Aluminum Roller, w/ Handle ¾" 6"300328 Standard Aluminum Roller, w/ Handle 1" 3"300330 Standard Aluminum Roller, w/ Handle 1" 6"300324 Standard Plastic Roller, w/ Handle ¾" 3"300331 Standard Plastic Roller, w/ Handle 1" 3"300332 Standard Plastic Roller, w/ Handle 1" 6"

Bodi Quik Change RollersBodi Quik Change Rollers are easy to clean, especially in acetone replace-ment systems. Roller-head is easy to remove--just push on and pull off. Non-corrosive ¼" steel frames. Purchase the complete rollerhead with frame and handle, or just the replacement heads separately. Number Description Diameter Length300354 Aluminum Quik Change Roller, w/ Handle 3⁄8" 3"300356 Aluminum Quik Change Roller, w/ Handle 3⁄8" 5"300358 Aluminum Quik Change Roller, w/ Handle ½" 2"300360 Aluminum Quik Change Roller, w/ Handle ½" 3"300364 Aluminum Quik Change Roller, w/ Handle ½" 4"300366 Aluminum Quik Change Roller, w/ Handle ½" 6"300368 Aluminum Quik Change Roller, w/ Handle ¾" 3"300493 Aluminum Quik Change Roller, w/ Handle ¾" 4"300492 Aluminum Quik Change Roller, w/ Handle ¾" 6"300362 Plastic Quik Change Roller, w/ Handle ½" 3"300488 Aluminum Quik Change Roller, Head Only 3⁄8" 3"300487 Aluminum Quik Change Roller, Head Only ½" 3"300402 Aluminum Quik Change Roller, Head Only ½" 6"300486 Aluminum Quik Change Roller, Head Only ¾" 3"300485 Aluminum Quik Change Roller, Head Only ¾" 6"300484 Aluminum Quik Change Roller, Head Only 1" 3"300483 Aluminum Quik Change Roller, Head Only 1" 6"300404 Plastic Quik Change Roller, Head Only ½" 3"300476 Plastic Quik Change Roller, Head Only 1" 6"

Bodi Bristle Rollers (Quik Change)Pure Bristle Rollers are spirally wound to produce strong laminations and roll out glass smoothly. Catalog Number Description Diameter Length300344 Bristle Quik Change Roller, w/ Handle ¾" 3"300346 Bristle Quik Change Roller, w/ Handle ¾" 6"300348 Bristle Quik Change Roller, w/ Handle 1" 3"300350 Bristle Quik Change Roller, w/ Handle 1" 6"300408 Bristle Quik Change Roller, Head Only ¾" 3"300410 Bristle Quik Change Roller, Head Only ¾" 6"300412 Bristle Quik Change Roller, Head Only 1" 3"300414 Bristle Quik Change Roller, Head Only 1" 6"

Bodi Corner RollersHigh quality Delrin™ and aluminum rollers for quick and easy rolling of corners and ridges. Corner rollers help save time when rolling out non-flat surfaces.Catalog Number Description Diameter Width*300478 Aluminum Corner Roller 2" ¼"300497 Aluminum Corner Roller 2" 3⁄8"300477 Aluminum Corner Roller 2" ½"300340 Plastic Corner Roller 2" 3⁄16"300342 Plastic Corner Roller 2" ¼"300498 Plastic Corner Roller 2" 3⁄8"300499 Plastic Corner Roller 2" 5⁄8" *Widths listed are the roller head thickness.

Bodi Mini RollersFor applications requiring a really tiny roller, these are high quality ¼" diameter aluminum rollers on 1⁄8" small steel frames mounted in aluminum handles. Disassembles for easy cleaning. Catalog Number Description Diameter Length300370 Aluminum Mini Roller ¼" 1"300372 Aluminum Mini Roller ¼" 1½"300374 Aluminum Mini Roller ¼" 2"300376 Aluminum Mini Roller ¼" 3"

Bodi Paddle Wheel Rollers (Quik Change)With the thinnest fins in the busi-ness for excellent air release, these rollers have smooth horizontal (reg-ular) fins. All heads are aluminum. Catalog Number Description Diameter Length300495 Paddle Wheel Roller, Quik Change, w/ Handle ¾" 3"300352 Paddle Wheel Roller, Quik Change, w/ Handle ¾" 6"300481 Paddle Wheel Roller, Quik Change, Head only ¾" 3"300479 Paddle Wheel Roller, Quik Change, Head only ¾" 6"

Rollers

Accessor ies

112 1.800.321.8511

Clay Modeling Products

Chavant Industrial Styling & Sculpting ClaysFreeman stocks a complete line of high quality Chavant Modeling Clay products for the professional sculptor as well as the industrial designer.

Hardness ScaleSoftest Hardest

1 5 10

Professional Plasteline This modeling compound is ideal for the professional sculptor and all school levels. Plasteline is soft, smooth, permanently plastic, reusable and does not require heating. Contains sulphur.Catalog Number Description Hardness Color

Net Wt. (Lbs.)

027200 Professional Plasteline Modeling Clay 3 Brown 1027205 Professional Plasteline Modeling Clay 3 Brown 10

Non-Sulphurated Plasteline (NSP) This modeling clay is similar in performance to the Professional Plasteline except for the fact that it does not contain any sulphur which will minimize curing inhibition when molding with silicone rubbers. The soft formulation can cause some cure inhibition with silicones. Use Plast-Econ Modeling Clay (027208) to eliminate all silicone inhibition.Catalog Number Description Hardness Color

Net Wt.(Lbs.)

027201 NSP Clay (Soft) 4 Brown 2027202 NSP Clay (Medium) 7 Brown 2027203 NSP Clay (Hard) 8 Brown 2

CM-50 This medium-hard formulation is the softest of the styling clays. Excellent adhesion and consistency for producing accurate models. Billets now deaired. Contain sulphur.Catalog Number Description Hardness Color

Net Wt.(Lbs.)

027214 CM50 Styling Clay 5 Brown 2.5

CM-70This extra hard styling clay is the hardest of the sulphur-type clays. Popular throughout the automotive industry where surface detail and finish are critical. Contain sulphur.Catalog Number Description Hardness Color

Net Wt.(Lbs.)

027217 CM70 Styling Clay 7 Brown 2

J-525This hard formulation provides a slightly harder modeling compound than the CM-50. This results in better edge definition and surface detail. Billets are now deaired. Contain sulphur. Catalog Number Description Hardness Color

Net Wt.(Lbs.)

027215 J525 Clay 6 Brown 2.5027207 J525 Clay 6 Brown 6

Le Beau Touche This clay is an extremely smooth plasteline that does not contain sulphur. Often charac-terized as having the feel of a water-base clay. Also available in higher melting point formulation. Catalog Number Description Hardness Color

Net Wt.(Lbs.)

027221 Le Beau Touche Clay 4 Brown 2

Y-2 KlayChavant’s Y-2 Klay is the hardest product in their line of industrial styling clays. This clay is sulphur free for use with silicone rubbers and is 30-40% lighter than other styling clays for ease of handling larger models.Catalog Number Description Hardness Color

Net Wt.(Lbs.)

027206 Y-2 Klay 9 Dark Brown 1.75

Plast-Econ Modeling ClaysThis soft, sulphur-free modeling clay is ideal for use in styling and engineering shops, development and prototype work, and die and pattern shops. It will not deteriorate with age, is not sticky or greasy and will not crumble. Supplied in 1 lb. wrapped packages.Catalog Number Description Hardness Color

Net Wt.(Lbs.)

027208 Plast-Econ Modeling Clay 2 Tan 1027210 Plast-Econ Modeling Clay 2 Green 1027212 Plast-Econ Modeling Clay 2 Red 1027213 Plast-Econ Modeling Clay 2 Gray 1

113

Accessories

Freeman Lacquer Thinners 90-1 Fre-Thin Lacquer Thinner is our premium product for the reducing of the 90-1 Pattern Coatings, Wood & Plaster Sealer, and No. 60 Coating. The 45 Lacquer Thinner is an economical alternative for less demanding performance. Catalog Number Description Availability024155 90-1 Fre-Thin Thinner Gallon024210 90-1 Fre-Thin Thinner 5 Gallon024215 90-1 Fre-Thin Thinner 55 Gallon024405 45 Lacquer Thinner 5 Gallon024410 45 Lacquer Thinner 55 Gallon

Freeman Acetone Solvent Formerly known as Freeman Fillet Cement Thinner, Freeman Acetone is a popular solvent for removing uncured resins, greases, and most wax release agents from work surfaces or molds. This product dries very fast and leaves no residue behind. Excellent solvent for our Freeman Fillet Cement (pg. 78).Catalog Number Description Availability023210 Freeman Acetone Solvent Quart023215 Freeman Acetone Solvent Gallon023217 Freeman Acetone Solvent 5 Gallon

Alcohol Solvent Pure methyl alcohol for use in our alcohol lamps. It is also the best sol-vent available for cutting flake shellac and various cleaning requirements. Catalog Number Description Availability027130 Alcohol Solvent Gallon027135 Alcohol Solvent 5 Gallon

Freeman Industrial Solvents

Miscellaneous Accessories

Masking & Double-Face TapesHigh-quality masking and double-face tape for various shop uses.Catalog Number Description

Width(mm)

Length(yds.) Rolls / Box

035210 Double Face Tape 18 36 48035215 Double Face Tape 24 36 36035220 Double Face Tape 36 36 24035225 Double Face Tape 48 36 24035240 Masking Tape 24 60 36035250 Masking Tape 48 60 24

Mineral Spirits Excellent solvent for thinning oil based paints and varnishes or for gen-eral cleaning purposes. Removes oil and wax residue, grease, and dirt.Catalog Number Description Availability027129 Mineral Spirits 5 Gallon

Prep Solvent Prep Solvent is a highly effective degreaser used to remove oily films, release agents, and waxes from cast parts prior to painting. It may also be used on mold surfaces to remove wax or release build up.Catalog Number Description Availability027240 Prep Solvent Gallon

Freeman Methyl Ethyl Ketone (MEK) Formerly Freeman Celastic Solvent, Freeman MEK is an excellent thinning agent for Freeman Fillet Cement as well as Duratec Surfacing Primers. It may also be used for general purpose cleanup. Catalog Number Description Availability027275 Freeman Methyl Ethyl Ketone (MEK) Gallon027280 Freeman Methyl Ethyl Ketone (MEK) 5 Gallon

Freeman Xylene Solvent Formerly Freeman Pitch Solvent, Freeman Xylene Solvent removes pitch and sap build-up on saw blades, joiner and planner knives, and other wood cutting tools. It is also great for removing solvent based adhesives from the metal discs of disc sanders. Catalog Number Description Availability027230 Freeman Xylene Solvent Gallon

Kraft PaperThis is a high-quality, 40 lb Kraft paper.Catalog Number Description Width Length054076 Kraft Paper - Wax one side 36" 1500'054078 Kraft Paper - Plain 36" 900'

Appendix

1.800.321.8511114

Products by Trade Name or ManufacturerManufacturer Material Page3M Abrasives 903M Adhesives 673M Scotch-Brite Abrasive Pads 943M Mold Release Agents 1053M Morson Platinum Body Filler 593M Respirators 1083M Roloc Discs & Holders 933M Sprayon Blue Layout Fluid 81Adhesive Systems, Inc. (ASI)

Adhesives 61

Adolf Cope and Drag Inserts 70Airtech Sheers 101Alvin Labs Lab-metal 58Araldite Adhesives 61Bacolac Sealer 102Bluestar Silicone Rubbers 26Cab-O-Sil Fumed Silica 49Chavant Styling Clay 112Chem-Trend Release Agents 104Cleveland Vibrators 81Devcon Adhesives 60, 63Devcon Repair Materials 58Devcon Tooling Resins 23, 31Dike-O-Lastic Ejector Buttons 78Dike-O-Seal Preform Strips 77Dike-O-Seal Gating Components 81Disa-Matic Wiper Blades 81Duratec Polyester Surface Primer 103Dux-Bak Parting Bags 81Dymo Tapewriter 89Dynalite Repair & Build Up Material 59F-Bond Cyanoacrylate Adhesive 64Freeman Epoxy Tooling Plastics 30Freeman Machinable Wax 2, 52Freeman Pattern Coating 102Freeman Polyurethane Tooling Plastics 18Freeman Quik-Fil 57Freeman Repro Fast Cast Urethanes 16Freeman Sheet Wax 53Freeman TUF Products 56Freeman Wax Release 104Freeman Wood Glue 66Freeman Wood & Plaster Sealer 102Freeman-Palmer Pattern Plates 68

Manufacturer Material PageFre-Sealer PVC Lacquer 113Gas Vac II Vacuum Degassing Unit 98Huntsman Ren Shape Tooling Boards 3Huntsman Tooling Plastics 17Jiffy Mixer 98Johnson Paste Wax 104Kutzall Carbide Rotary Burrs 101Marbalease Polymer Concrete Release 104Match-Lok Buttons 70Michael Engineering Super ‘E’ Meter Mixing Machine 99Mold-Lock Alignment Buttons 70Ohaus Measuring Scales 99Palmer Pattern Plates 68Partall PVA Mold Release 104Peerless Core Box Clamps 79Perfect Plank Pattern Lumber 8Plast-Econ Modeling Clay 112Plunge Mixer 99Pro-Cast Tooling Plastics 17Puma Polymers Tooling Plastics 21Red Devil Mixer 98RenCast Polyurethanes 17RenGel Epoxy Surface Coats 36RenLam Epoxy Laminating Resins 33RenLease Releases 105RenPaste Epoxy Tooling Materials 41RenPIM Rapid Cast Polyurethanes 25RenShape Modeling Material 3Repro Tooling Plastics 16Richlite Fibre Laminate Sheets 13Roloc Abrasive Discs & Pads 93Roovers Embossing Press 89Safe-T-Planer Wagner 100Shalco Blowplate Gasket 77Shalco Super Vents 74Sprayon Aerosol Mold Releases 105Striptube Core Box Seal 77Tecbond Hot Melt Adhesives 66True-Line Dowels 73TUF Repair & Build-up Material 56USC Polyester-Base Repair Materials 59U.S.G. Industrial Plasters 42Ventistamp Core Box Air Release Vents 74Wagner Safe-T-Planer 100

Appendix

Appendix


Alphabetical Product Listings

AAbrasive Cartridge Rolls ................................. 95Abrasive Cleaner Bar ...................................... 91Abrasive Discs & Holders ............................... 94Abrasive Discs, Sanders ................................. 91Abrasive Hand Pads, 3M Scotch-Brite ........... 94Abrasive Sheets .............................................. 90Abrasive Sleeves, Sanders ............................ 92Acetate Sheet ................................................. 85Acetone Solvent ............................................ 113Acid Brush ..................................................... 110Adhesives, Araldite ......................................... 61Adhesives, ASI ................................................ 63Adhesives, Cyanoacrylate .............................. 64Adhesives, Devcon ................................... 63, 64Adhesives, Epoxy ........................................... 60Adhesives, Freeman F-Bond .......................... 64Adhesives, Freeman White Glue .................... 66Adhesives, Hot Melt ........................................ 66Adhesives, Huntsman Ren-Weld ................... 67Adhesives, Methacrylates ............................... 63Adhesives, Polyurethanes .............................. 64Adhesives, 3M ................................................ 67Adolf Cope & Drag Buttons ............................ 70Aerosil 200 Fumed Silica ................................ 49Alcohol Lamp .................................................. 54Alcohol Solvent ............................................. 113Alder, Perfect Plank .......................................... 9Alumina Trihydrate (ATH), Mia 67 .................. 48Aluminum Fillers ............................................. 48Aluminum Honeycomb .................................... 51Aluminum Oxide Abrasive Discs .................... 91Aluminum Paint Pot ...................................... 102Aluminum Pattern Plates ................................ 68Aluminum Powder ........................................... 48Aluminum Puffs ............................................... 48Aluminum Sand ............................................... 48Aluminum Sheet .............................................. 85Aprons ........................................................... 108Araldite Adhesives .......................................... 61Aramid Fiber Honeycomb ............................... 51Armorboard ..................................................... 85

BBacolac Sealer .............................................. 102Band Saw Accessories ................................... 97Band Saw Tire Cement .................................. 97Band Saw Tires............................................... 97Beeswax .......................................................... 55Bench Rammer ............................................... 80Bench Scale, Ohaus ....................................... 99Birch Plywood ................................................. 84Bits, Machine................................................. 100Blade, Wipers, Disa-Matic .............................. 83Blind Gauging Wax ......................................... 55Blowplate Gasket – Shalco ............................. 77Bluestar Accessories ...................................... 29Bluestar, Silicone Rubbers ............................. 26Bodi Rollers ................................................... 111Bottles, Glue .................................................... 66Brad Point Drill Bits ....................................... 101Brads, Wire ..................................................... 96Brass Dowels .................................................. 72Brass Escutcheon Pins ................................... 96Brass Rod ....................................................... 81 Brass Sheet..................................................... 85Brush, Acid .................................................... 110

Brushes, Assorted ......................................... 110Brushes, Throwaway .................................... 110Bulb, Paste ...................................................... 80Burrs, Rotary, Karbide Kutzall ...................... 101Buttons, Adolf .................................................. 70Buttons, Dike-O-Lastic Ejector ....................... 78Buttons, Match-Lok ......................................... 70Buttons, Mold-Lock ......................................... 70

CCab-O-Sil Fumed Silica .................................. 49Cabinet, Pattern Letters .................................. 88Calcium Carbonate, Mia 61 ............................ 48Carbon Fiber Cloth ......................................... 47Carbon Fiber Tape, Unidirectional ................. 48Cartridge Rolls, Abrasive ................................ 95Cartridge Rolls, Mandrels ............................... 95Casting Resin, Polyurethanes ........................ 15Casting Resins, Epoxy .................................... 30Celastic Solvent (MEK) ................................. 113Cement, Band Saw Tire ................................. 97Cement, Disc .................................................. 71Cement, Fillet .................................................. 78Cement, USG Gypsum ................................... 46Ceramic Spheres, (Mia 64) ............................. 48Chainlock Plates Freeman-Palmer ................ 68Chavant Modeling Clay ................................. 112Chemwax 500 ............................................... 104Chopped Strand Mat ....................................... 46Clay, Plast-Econ Epoxy Modeling ................ 112Clays, Chavant Modeling .............................. 112Cleaner Bar, Abrasive ..................................... 91Cleaner, Hand ............................................... 109Clean-Up Supplies ........................................ 109Cloth, Fiberglass ............................................. 44Coatings, Pattern .......................................... 102Cold Glue ........................................................ 66Color Pastes, DW ........................................... 49Color Pastes, Polyester .................................. 49Color Tints, Freeman ...................................... 49Compact Scale, Ohaus ................................... 99Concrete Release, Marbalease .................... 104Cope & Drag Inserts, Adolf ............................. 70Core Box Clamps, Peerless ........................... 79Core Box Seals ............................................... 77Core Box Vents ............................................... 74Core Vent Wax.......................................... 55, 78Corrugated Fasteners ..................................... 97Cotton Flock .................................................... 49Countersink Cutter ........................................ 100Cups, Paper & Plastic ................................... 109Cyanoacrylate Adhesives ............................... 64

DDegassing Unit, Gas Vac ............................... 98Devcon Repair Materials ................................ 58Di-Dup Wax Fillet ............................................ 55Digital Bench Scale, Ohaus ............................ 99Dike-O-Lastic Ejector Buttons ........................ 78Dike-O-Seal Preform Strips ............................ 77Disc Cement ................................................... 91Discs, State Sander Abrasive ......................... 91Discs, 3M Abrasive Roloc ............................... 93Dispenser, for TUF Products .......................... 57Dispensing Gun, Adhesives ........................... 65Dispensing Nozzels, Adhesives ..................... 65Double Face Tape ........................................ 113

Dowels, Malleable Iron ................................... 73Dowels, Husky ................................................ 71Dowels, True-Line Steel ................................. 73Dowels, Square Head Brass .......................... 72Dowels, Square Head Steel ........................... 72Dowels, Wood ................................................. 73Drill Bits ......................................................... 100Drill, Vent Inserting .......................................... 77Drums, Expandable Rubber

for Spindle Sanders .................................... 92Dry Parting, Dux-Bak ...................................... 81Drywall Screws ............................................... 97Duratec Primers ............................................ 103Dux-Bak Dry Parting ....................................... 81Dyes & Pigments ............................................ 49Dymo Tape Embosser .................................... 89Dynalite Repair Material ................................. 59

EEastern White Pine Pattern Lumber ............... 10Ejector Buttons, Dike-O-Lastic ....................... 78Electronic Scale, Ohaus ................................. 99Embosser, Dymo Tape ................................... 89Embossing Press, Roovers ............................ 89Embossing Tapes ........................................... 89Epoxy Adhesives, Araldite .............................. 61Epoxy Casting Resins ..................................... 30Epoxy Hand Cleaner ..................................... 109Epoxy Laminating Resins ............................... 33Epoxy Repair Materials ................................... 58Epoxy Surface Coats ...................................... 36Epoxy, Resin Infusion Systems ...................... 39Epoxy, Resin Systems .................................... 42Epoxy, Specialty Tooling Pastes .................... 40Escutcheon Pins, Brass .................................. 96Eurobirch Plywood .......................................... 83Euroform Plywood ........................................... 83

FFast-Cast Urethanes, Freeman ...................... 14Fasteners, Corrugated .................................... 97Fasteners, Link-Lock ....................................... 79Fast Set 505 Adhesive ................................... 60F-Bond Cyanoacrylate

Adhesive, Freeman ................................... 64Fiberglass, Chopped Strand Mat .................... 47Fiberglass Cloth .............................................. 44Fiberglass Strand ...................................... 16, 46Fiberglass Tape .............................................. 45Fiberglass Tooling Fabrics .............................. 44Fiberglass, Veil Cloth ...................................... 46Fiberglass, Woven Roving .............................. 46Fibre-Laminate, Richlite .................................. 13Fillers, Aluminum ............................................ 48Fillers, Tooling Plastic ..................................... 48Fillet Cement ................................................... 78Fillet Cement Thinner .......See Acetone SolventFillet, Di-Dup Wax ........................................... 54Fillet, Leather .................................................. 78Fillet Shapers .................................................. 59Fillet Tools ....................................................... 54Fillet Wax ........................................................ 54Fir Plywood ..................................................... 84Flake Shellac................................................. 103Flexane Primers ............................................ 102Flock, Cotton ................................................... 49Formula Five Clean & Glaze ........................ 103

Appendix

1.800.321.8511116

Alphabetical Product Listings [CONTD.]

FFormula Five Mold Release Wax ................. 104Freeman Color Tints ....................................... 49Freeman Fast Set 505 Adhesive .................... 60Freeman-Palmer Pattern Plates ..................... 68Freeman Wax Release ................................. 104Fre-Sealer, PVC .............................................. 43Fumed Silica ................................................... 49

GGarnet Abrasives ............................................ 90Gas Vac II ....................................................... 98Gating Components Dike-O-Seal ................... 81Gauging Wax .................................................. 55Gel Coat Mini Sprayer .................................... 99Glass Bubbles, Mia 67 .................................... 48Glass Fibers, Milled ........................................ 49Gloves, Plaster ................................................ 43Gloves, Vinyl Latex, Nitrile ............................ 108Glue Bottles ..................................................... 66Glue, Freeman Cold ....................................... 66Glue, Styro ...................................................... 67Graduated Plastic Cups ................................ 109Graphite Powder, Mia 84 ................................ 49Grease Stick, Matchless ................................. 97Gypsum Cement ............................................. 42

HHand Cleaners .............................................. 103Hand Pad, Scotch-Brite .................................. 94Hand Pumps, Miapoxy 100 ............................ 99Hand Riddle .................................................... 80HDO Plywood ................................................. 84Hemp, Manila .................................................. 43Hi-Performance Sealer ................................. 102Holders, Lok-In Patter Letters ......................... 86Holders, Roloc Disc ........................................ 93Honeycomb ..................................................... 51Hot Melt Foundry Adhesives .......................... 66Huntsman Adhesives ...................................... 67Huntsman Epoxies .......................................... 31Huntsman Polyurethanes ............................... 18Huntsman Release Agents ........................... 104Huntsman Repair Materials ............................ 58Huntsman Seamless Modeling Paste ............ 12Huntsman Tooling Boards ................................ 3Husky Dowels, Freeman ................................ 71

IInsert Drills, Core Boxes ................................. 77Inserts, Cope & Drag, Adolf ............................ 70

JJelutong Pattern Lumber ................................ 10Jiffy Mixer ........................................................ 98Johnson Paste Wax ...................................... 104

KKarbide Rotary Burrs, Kutzall ....................... 101Kevlar Fabrics ................................................. 46Knives, Pattern .............................................. 101Krylon Primer ................................................ 103Kutzall, Carbide Rotary Burrs ....................... 101

LLab Metal ........................................................ 58Lab Solvent ..................................................... 58Laminates, Richlite Fibre ................................ 13Laminating Resin, Epoxy ................................ 33Laminating Resin, Repro ................................ 16Lamp, Alcohol ................................................. 54Lance Pyrometer ............................................. 80Latex Disc Cement ......................................... 91Layout Fluid ..................................................... 81Leather Fillet ................................................... 78Letters, Pattern................................................ 86Link-Lock Fasteners ........................................ 79Logos, Pattern Letter ...................................... 88Lok-In Pattern Letters ..................................... 86Lumber, Perfect Plank ...................................... 8Lumber, Rough Sawn Pattern ........................ 10

MMachinable Wax Adhesive, 3M ...................... 67Machinable Wax, Freeman ............................. 52Magnesium Pattern Plates, Dowmetal ........... 69Mahogany Pattern Lumber ............................. 11Malleable Iron Dowels .................................... 73Malleable Iron Rapping Plates........................ 81Mandrels, Cartridge Rolls ............................... 95Manila Hemp ................................................... 43Maple Pattern Lumber .................................... 11Marbalease Concrete Release ..................... 104Marbalease, Polymer Concrete Release ..... 104Masking Tape ............................................... 113Mask, 3M Respirator ..................................... 108Masonite Sheet Material ................................. 85Match-Lok Buttons .......................................... 70Matchless Grease Stick .................................. 97Maxim Fast...................................................... 58Maxvents, Ventistamp .................................... 74MDO Plywood ................................................. 84Medium Density Fiberboard, MDF ................. 13Melaboard ....................................................... 85Meltvents FS, Ventistamp ............................... 74Meter-Mix Machine, Michael ........................... 99Methacrylate Adhesives, Araldite ................... 63Methyl Ethyl Ketone (MEK) .......................... 113Mia Fillers ........................................................ 48Mia Vacuum Bagging Supplies ...................... 50MicroCrystalline Wax ...................................... 55Mineral Spirits ............................................... 113Milled Cotton Fibers, Cotton Flock ................. 49Mixer, Jiffy ....................................................... 98Mixer, Plunge .................................................. 98Mixing Bowls, Rubber ..................................... 43Mixing Paddles, Wood .................................. 109Mixer, Red Devil .............................................. 98Mixer, Super E ................................................ 99Modeling Clays, Chavant .............................. 112Mold Cleaners, Semi-Permanaent ............... 106Mold Primers, Semi-Permanent ................... 106Mold-Lock, Alignment Buttons ........................ 70Mold Releases .............................................. 104Mold Sealers, Semi-Permanent.................... 106Mouth-Type Spray Can................................... 80Multi-Spur Drill Bits ....................................... 100

NNails ................................................................ 97

OOhaus Scales .................................................. 99Optical Soluble Wax ....................................... 55

PPaddles, Wood Mixing .................................. 109Pads, Scotch-Brite Abrasive ........................... 94Paint Pot ........................................................ 102Paper Cups ................................................... 109Paraffin Wax.................................................... 55Partall Mold Releases ................................... 104Particle Board.................................................. 85Parting Bags, Dux-Bak ................................... 81Paste Bulb ....................................................... 80Paste Wax, Johnson ..................................... 104Paste Wax, Trewax ....................................... 104Pattern Coatings, Freeman .......................... 102Pattern Knives ............................................... 101Pattern Letters................................................. 86Pattern Letter Logos ....................................... 88Pattern Letters Cabinet ................................... 88Pattern Lumber, Perfect Plank ......................... 8Pattern Lumber, Rough Sawn ........................ 10Pattern Plates, Freeman-Palmer .................... 68Pattern Plywood .............................................. 81Pattern Release 202 ..................................... 105Peerless Core Box Clamps ............................ 79Perfect Plank Alder ........................................... 9Perfect Plank Jelutong ...................................... 9Perfect Plank Mahogany................................... 9Perfect Plank Pine ............................................ 9Perfect Plank Poplar ......................................... 9Pigments & Dyes ............................................ 49Pinch Dogs ...................................................... 96Pine Pattern Lumber ....................................... 10Pine Plywood .................................................. 82Pins, Escutcheon, Brass ................................. 96Pitch Solvent ....................... See Xylene SolventPlast-Econ Modeling Clay............................. 112Plaster Accessories ........................................ 43Plaster Gloves ................................................. 43Plaster Release ............................................... 43Plaster Rubber Mixing Containers .................. 43Plasters, U.S.G., Industrial ............................. 43Plastic Cups .................................................. 109Plastic Portion Resin Scale ............................ 99Plastic Sheet, Acetate ..................................... 85Plates, Pattern, Freeman-Palmer ................... 68Plates, Rapping ............................................... 81Plunge Mixer ................................................... 98Plunger Can .................................................. 109Plywood ........................................................... 82Pneumatic Dispenser - TUF Products ............ 57Polyester Coloring Pastes .............................. 49Polyester Primers .......................................... 103Polyester Repair Materials .............................. 59Polyester Resins & Gelcoats .......................... 39Polyurethane Adhesives ................................. 64Polyurethane Repair Materials ....................... 58Polyurethanes, Fast-Cast ............................... 14Polyurethanes, Intermediate Cure .................. 18Polyurethanes, Overnight Cure ...................... 20Polyurethanes, Rapid Cure ............................ 25Poplar Pattern Lumber .................................... 11Portion Scale, Plastic Resin ........................... 99Powder, Aluminum .......................................... 48Prepared Shellac .......................................... 103

Appendix


Alphabetical Product Listings [CONTD.]

Prep Solvent.................................................. 113Pressure Sensitive Tape ................................. 51Primers .......................................................... 103Pro-Cast Tooling Plastics ............................... 17PVA-Based Mold Releases .......................... 105PVC, Fre-Sealer .............................................. 43Pyrometer, Lance ............................................ 80

QQuik-Fil Tooling Board Repair Paste .............. 57

RRags, Shop ................................................... 109Rammer, Bench .............................................. 80Rapping Plates ................................................ 81Red Devil Mixer ............................................... 98Release Agents, Semi-Permanent ............... 106Release, Freeman Wax ................................ 104Release, Plaster .............................................. 43Releases, PVA, Silicone & Wax ................... 104Ren Tooling Products .................See HuntsmanRenShape Tooling Board ................................. 3Repair Material, TUF Products ....................... 56Repair Materials, Epoxy .................................. 58Repair Materials, Maxim Fast ......................... 58Repair Materials, Mia Plas-Fil ......................... 59Repair Materials, Polyester ............................. 59Repair Materials, Polyurethane ...................... 58Repair Paste, Quik-Fil Tooling Board ............. 57Repro Tooling Plastics .................................... 14Resin Dyes & Pigments .................................. 49Resin Infusion Epoxy Systems ....................... 39Respirators, 3M ............................................. 108Richlite Fibre-Laminates ................................. 13Riddles, Hand ................................................. 80Rod, Brass ...................................................... 81Rollers ........................................................... 111Rolls, Abrasive Cartridge ................................ 95Roloc Abrasives .............................................. 93Roovers Embossers & Tapes ......................... 89Rotary Burrs, Karbide Kutzall ....................... 101 Rotary Surfacer ............................................. 100Round Rapping Plates .................................... 81Roving, Woven Fiberglass .............................. 46Rubber Drums for Spindle Sanders ............... 92Rubber Mixing Containers .............................. 43Rubbers, Bluestar Silicone ............................. 27Russian Birch Plywood ................................... 83

SSafe-T-Planer, Wagner ................................. 100Safety Plunger Can ....................................... 109Sand Paper ..................................See AbrasivesScales, Ohaus ................................................. 99Scale, Plastic Portion Resin ........................... 99Scotch Bright Discs (3M) ................................ 93Scotch Bright Hand Pads (3M) ....................... 94Screen Core Vents ......................................... 75Screws, Drywall .............................................. 97Screws, Wood ................................................. 96Sculpture Wax ................................................. 55Sealant Tape ................................................... 51Sealer, Devcon ............................................. 102Sealer, Wood & Plaster ................................ 102Seals, Core Box .............................................. 77Seamless Modeling Paste .............................. 12

Semi-Permanent Mold Release Systems .... 106Shalco Blowplate Gasket ................................ 77Shalco Super Vents ........................................ 74Shapers, Fillet ................................................. 59Shears ........................................................... 101Sheet, Acetate ................................................ 85Sheet, Aluminum ............................................. 85Sheet, Brass.................................................... 85Sheets, Abrasive ............................................. 90Sheet Wax Adhesive ...................................... 67Sheet Wax, Freeman ...................................... 53Shellac, Prepared & Flake ............................ 103Shop Rags .................................................... 109Silicon Carbide Coated Abrasive Mesh .......... 90Silicone-Based Mold Releases ..................... 105Silicone Rubbers, Bluestar ............................. 27Silicone Spray Release ................................. 105Sleeves.......................................................... 108Sleeves, Abrasive, State Sanders .................. 92Slicks & Trowels .............................................. 97Slotted Core Vents .......................................... 76Sol-U-Carv ...................................................... 55Soluble Wax, Optical ...................................... 55Solvents......................................................... 113Spherecore Core Material............................... 51Spray Can, Mouth-Type.................................. 80Sprayer, Gel Coat Mini ................................... 99Sprayon Mold Releases................................ 105Sprue Cutters, Tapered .................................. 80Square Head Dowels, Brass .......................... 72Square Head Dowels, Steel ........................... 72Steel Dowels, True-Line ................................. 73Steel Pinch Dogs ............................................ 96Steric Acid ....................................................... 43Stick Wax Lubricant ........................................ 97Stitchmat ......................................................... 46Strand, Fiberglass ..................................... 16, 46Striptube .......................................................... 77Styro Glue ....................................................... 67Sugar Pine Pattern Lumber ............................ 10Super E Mixer, Michaels ................................. 99Surface Coat, Epoxies .................................... 36Surface Coat, Repro ....................................... 16Surface Primers ............................................ 103Surfacer, Rotary ............................................ 100Surfacing Primers ......................................... 103Synlube 531 .................................................. 104

TTape, Aluminum & Zinc Embossing ............... 89Tape, Double-Face ....................................... 113Tape, Fiberglass ............................................. 45Tape, Masking .............................................. 113Tape, Pressure Sensitive .............................. 51Tape, Sealant .................................................. 51Tape, Unidirectional Carbon Fiber ................. 47Tapered Sprue Cutters ................................... 80Tapewriter Dymo ............................................. 89Tecbond Hot Melt Adhesives.......................... 66Thinner, Fillet Cement ......See Acetone SolventThrowaway Brushes ..................................... 110Tire Cement, Band Saws ................................ 97Tires, Band Saw.............................................. 97Tongue Depressors ...................................... 109Tooling Board Adhesives ................................ 67Tooling Fabrics, Fiberglass ............................. 44Trewax Paste Wax ........................................ 104Triple Beam Balance, Ohaus.......................... 99Trowels & Slicks .............................................. 79

True-Line Dowels, Freeman ........................... 73TUF-Carv Repair Material............................... 57TUF-Fil Repair Material .................................. 56

UUnidirectional Carbon Fiber Tape .................. 47Urethane Adhesives, Araldite ......................... 64Urethane Protectants .................................... 109Urethane Tooling Board, Ren Shape ............... 4USG Industrial Plasters .................................. 42

VVacuum Bagging Supplies ............................. 50Vacuum Degasser, Gas Vac .......................... 98Vent Cleaners ................................................. 77Vent Inserting Drill ........................................... 77Ventistamp Zanatta Vents .............................. 74Vent Plugs ....................................................... 77Vents, Core Box .............................................. 74Vents, Shalco Super ....................................... 74Vibration Inducers ........................................... 81Victory Brown Wax ......................................... 55

WWalnut Shells .................................................. 48Wax, Blind Gauging ........................................ 55Wax, Core Vent......................................... 58, 78Wax Fillet ........................................................ 54Wax Fillet, Di-Dup ........................................... 54Wax, Freeman Machinable ............................. 52Wax, Miscelaneous ......................................... 55Wax, Paste .................................................... 104Wax Release, Formula Five ......................... 104Wax Release, Freeman ................................ 104Wax, Sheet Freeman ..................................... 53Wax-Based Mold Releases .......................... 104Wedges ......................................................... 110White Cold Glue .............................................. 66Wiper Blades, Disa-Matic ............................... 81Wire Brads ...................................................... 96Wire Nails ........................................................ 97Wood & Plaster Sealer, Freeman ............... 102Wood Dowels .................................................. 73Wood Flour, Mia 62 ........................................ 49Wood Glue ...................................................... 66Wood Mixing Paddles ................................... 109Wood Screws .................................................. 96Woven Roving, Fiberglass .............................. 46

XXylene Solvent .............................................. 113

ZZanatta, Ventistamp Vents ............................. 74Zinc Embossing Tape ..................................... 89

AppendixGlossary ........................................................ 118Sealing/Releasing Procedures ..................... 119Metric & English Conversions Table ............ 120Reference Tables .......................................... 120Calculating Material Requirements ............... 121Fractions, Decimals, Millimeters ................... 121

Appendix

1.800.321.8511118

Adhesion – The state in which two surfaces are held together by interfacial force.

Coefficient of Thermal Expansion – The fractional change in length of a material for a unit of change in temperature. Normally expressed in “inch-per-inch, per degree Fahrenheit”.

Compressive Strength – 1⁄2" x 1⁄2" x 1" specimen is mounted in a compression-type tester between two heads that exert pressure at a constant rate of movement until the specimen fails by rupturing or deforming to a % of its’ height. Normally expressed in “pounds per square inch”, this test provides the maximum load sustained, divided by the original area of the specimen.

Cure – To change the physical properties of a plastic or resin by chemical reaction, which may be condensation, polymerization, or addition: usually accomplished by the action of either heat or catalyst or both, and with or without pressure.

Deflection Temperature – The temperature at which a 5" x 1⁄2" x 1⁄2" specimen deflects .010 inches under a stated load of 66 or 264 pounds per square inch.

Density – Mass per unit volume of a substance, expressed in units such as grams per cubic centimeter, pounds per cubic foot or pounds per gallon.

Endothermic – Pertaining to a reaction which is accompanied by the absorption of heat.

Exothermic – Pertaining to a reaction which is accompanied by the evolution (giving off) of heat.

Flexural Modulus – The ratio, within the elastic limit, of the applied stress on a test specimen in flexure to the corresponding strain in the outermost fibers of the specimen.

Flexural Strength – 5" x 1⁄2" x 1⁄8" specimen is placed on supports 4" apart and a standard load is applied to the center of the specimen at a specified rate. The maximum stress in the outer fiber at the moment of crack or break is expressed in “pounds-per-square-inch”.

Glass Transition Temperature (Tg) – A reversible change that occurs when plastic is heated to a certain temperature range, char-acterized by a rather sudden transition from a hard, glassy, or brittle condition to a flexible or elastomeric condition.

Gel Time – With reference to thermosetting resins, the interval of time between introduction of the catalyst and the formation of a semi-solid system consisting of a network of aggregates in which a liquid is held. The initial jelly-like solid phase that develops during the formation of a resin from a liquid, usually a 4-fluid ounce mass.

Percentage of Elongation – Increase in length of a specimen at the instant before rupture occurs. Normally expressed as a percentage.

Plasticity – The ability of a material to withstand continuous and permanent deformations by stress exceeding the yield value of the material without rupture. The opposite of elasticity.

Post-curing – The process of forming an uncured thermosetting resin article, then completing the curing after the article has been removed from its forming mold or mandrel.

Pot-life (working life) – The period during which a compound, after mixing with a catalyst, solvent or other compounding ingredients, remains suitable for its intended use.

Shore Hardness (Indention Hardness) – The hardness of a mate-rial as determined by either the size of an indention made by an indenting tool under a fixed load, or the load necessary to produce penetration of the indenter to a pre-determined depth. To measure the Shore hardness of a material a Shore testing instrument is used which is comprised of spring-loaded indenter point projecting through a hole in a presser foot and a device to indicate the distance the point projects beyond the face of the foot. The scale readings range from 0 (for 0.100 penetration) to 100 (for zero penetration). A Shore “A” instrument employs a “sharp” indentor point with a load of 822 grams. The Shore “D” instrument employs a “blunt” point and the load is 10 pounds.

Taber Wear Index – The ability of a material to withstand mechani-cal action such as rubbing, scraping or erosion, that tends to progressively remove material from its surface. Usually expressed in milligrams loss per number of cycles per a given load.

Tensile Modulus – The ratio of stress to corresponding strain below the proportional limit of the material. Expressed normally in pounds-per-square-inch.

Tensile Strength – 1⁄8" thick x 3⁄4" to 1⁄2" wide x 81⁄2" long specimen is inserted in an Instron Tester and is pulled apart at specified rates until the specimen fails by separating. Usually expressed in pounds-per-square-inch.

Thermoforming – The process of forming a thermoplastic sheet into a three-dimensional shape by clamping the sheet in a frame, heating it to render it soft and flowable, then applying differential pressure to make the sheet conform to the shape of a mold or die positioned below the frame.

Thermoplastics – Resins or plastic compounds which in their final state as finished articles are capable of being repeatedly softened by increased temperature and hardened by decrease of temperature by means of physical change.

Thermosetting Plastics (thermosets) – Resins or plastic com-pounds which in their final state as finished articles are substantially infusible or insoluble. Thermosetting resins are often liquids at some stage in their manufacture or processing, which are cured by heat, catalyst or other chemical means. After being fully cured, thermosets cannot be reliquified by heat.

Thixotropy – A flow characteristic evidenced by a decrease in vis-cosity of a fluid when it is stirred at a constant or increasing rate of shear. When the stirring or shearing is discontinued, the apparent viscosity of the fluid gradually increases back to the original value. Changes in both directions are dependent on time as well as shear.

Viscosity – The thickness of a substance and its resistance to flow. The higher the viscosity number, the thicker the substance.

Glossary of Plastic Tooling Terms

Appendix


Preparation of Patterns/Molds

1. Apply one coat of Freeman Wood and Plaster Sealer (a fairly thin viscosity, lacquer-based paint) to the bare wood surface using a pure bristle brush and allow the material to absorb into the wood.

2. After the first coat has dried (about half an hour), you’ll notice that the sealer has swelled the grain and made it rough. Using sand paper or Scotch-Brite®, lightly sand the surface to make it smooth again. Sanding is not necessary when working with plaster or sheet wax.

3. Wipe off the pattern with a cloth and then apply a second coat of sealer.

4. After allowing the second coat to dry overnight, lightly sand the wood again and wipe it off with a cloth.

5. You are now ready to apply the release agents.

Sealing A Wood Pattern/Model(also applies to plaster and sheet wax)

1. Cover the entire surface with Freeman Wax Release (a semi-paste, typically applied with a brush).

2. Allow this coat to dry or immediately wipe the off excess with a cloth.

3. We suggest at least two coats of Wax Release to make sure your entire part is covered evenly.

4. Next, you’ll need to apply two layers of Partall PVA mold release (a polyvinyl alcohol) with brush or a spray.

5. Each coat will require a half hour of drying time unless you use a fan or air hose.

6. After the second coat of PVA has dried thoroughly, apply a final coat of Freeman Wax Release.

7. Buff this last coat very gently so as not to break through the layers of the PVA.

Applying Release Agents

Additional Notes:•Epoxy,urethane,ormetalpatternsrequireonlytheuseofwaxreleaseagents.Applythreecoatsandlightlybuffaftereach.

•Plasterpatternsshouldbedriedinanair-circulatingovenat120°-125°Ffor16hours,orindryairfor48hoursbeforeapplyingsealer.

•PlasterpatternscanalsobesealedwithFreemanFre-Sealer(PVC).

Instructional videos available online and on DVD.

Appendix

1.800.321.8511120

Metric & English Conversions Table

Reference Tables

Liquid Volume

When you know You can findIf you

multiply byounces milliliters 30pints liters 0.47quarts liters 0.946gallons liters 3.785milliliters ounces 0.034liters pints 2.1liters quarts 1.0567liters gallons 0.2642

Mass


multiply byounces grams 28.35pounds kilograms 0.4536short tons (2000 lbs) metric tons 0.9grams ounces 0.03527kilograms pounds 2.2046metric tons (1000 kg) short tons 1.1

Properties of Metal CastingWt. Lbs. Cu. In.

Wt. vs Mahogany

Shrink In./Ft.

Melt Pt. °F

Aluminum .0975 3.1 x 5⁄32 1,220Brass .2961 9.5 x 3⁄16 1,616Copper .3210 10.1 x 3⁄16 1,981Cast Iron .2670 8.5 x 1⁄8 2,105Steel .2835 9.5 x 1⁄4 2,500Zinc .2565 8.2 x 5⁄16 788

Viscosity GuidelinesViscosity in

Centipoise (@ 75°F)Similar in Consistency to:

1 = Water500 = #10 Motor Oil

2,500 = Pancake Syrup10,000 = Honey25,000 = Chocolate Syrup50,000 = Catsup

250,000 = Peanut Butter>1,000,000 = Paste Caulking

Length


multiply byinches millimeters 25.4feet centimeters 30.48yards meters 0.9144miles kilometers 1.6093millimeters inches 0.03937centimeters inches 0.39370meters yards 1.0936kilometers miles 0.6214

Area


multiply bysquare inches square centimeters 6.452square feet square meters 0.0929square yards square meters 0.836square miles square kilometers 2.5899acres square hectometers 0.4square centimeters square inches 0.155square meters square yards 1.196square kilometers square miles 0.3861square hectometers acres 2.5

Shore Hardness Guidelines

MaterialApproximate

Shore AApproximate

Shore DRubber band, white eraser 25-30 –Pink eraser 35-45 –Rubber stamp 40-55 –Hard eraser, inner tube 45-65 –Leather belt, tire tread 65-75 –Rubber shoe sole 75-85 25-30Tap washer, skateboard wheel 85-95 30-40Garden hose 95-100 40-50Hard book cover – 50-55Golf ball – 55-65Wood yard stick – 70-75White board – 75-80Bowling ball, bone – 85-90

Temperature When you know You can find If youFahrenheit Celsius subtract 32 and then

multiply by .55Celsius Fahrenheit multiply by 1.8

and then add 32

Appendix


Step One:Calculate the volume of the part (or mold) in cubic inches. Follow whichever shape is closest to your model or mold:

Step Two:Find the volumetric yield for the material you have selected. This number, which can be found in most specification tables, represents how much coverage your material will achieve.

If the Volumetric Yield is not available, you can calculate it based on the specific gravity (density).

1) Find the specific gravity (or density) of the material (on the specification table and/or MSDS). This is measured in grams per cubic centimeter (grams/cm3)

2) Take 27.68 divided by the density (grams/cm3) and this gives you the Volumetric Yield (in3/lb.)

Step Three:Divide the volume of the part in cubic inches (step 2) by the volumetric yield (step 1) to determine the amount of material required in pounds

Volume of Model or Mold (in.3) = Weight of Product

Volumetric Yield (in3/lb.) Required (lbs.)

Step Four:Select package size and quantity based on calculated weight of product required.

Fractions, Decimals, Millimeters

Calculating Material Requirements

.0156 0.3969 .0313 0.7938 .0469 1.1906 .0625 1.5875 .0781 1.9844 .0938 2.3813 .1094 2.7781 .125 3.1750 1406 3.5719 .1563 3.9688 .1719 4.3656 .1875 4.7625 .2031 5.1594 .2188 5.5563 .2344 5.9531 .250 6.3500 .2656 6.7469 .2813 7.1438 .2969 7.5406 .3125 7.9375 .3281 8.3344 .3438 8.7313 .3594 9.1281 .375 9.5250 .3906 9.9219 .4063 10.3188 .4219 10.7156 .4375 11.1125 .4531 11.5094 .4688 11.9063 .4844 12.3031 .500 12.7000

13.0969 .5156 13.4938 .5313 13.8906 .5469 14.2875 .5625 14.6844 .5781 15.0813 .5938 15.4781 .6094 15.8750 .625 16.2719 .6406 16.6688 .6563 17.0656 .6719 17.4625 .6875 17.8594 .7031 18.2563 .7188 18.6531 .7344 19.0500 .750 19.4469 .7656 19.8438 .7813 20.2406 .7969 20.6375 .8125 21.0344 .8281 21.4313 .8438 21.8281 .8594 22.2250 .875 22.6219 .8906 23.0188 .9063 23.4156 .9219 23.8125 .9375 24.2094 .9531 24.6063 .9688 25.0031 .9844 25.4000 1.000

Millimeters Decimals Fractions Fractions Decimals Millimeters33⁄64

17⁄32 35⁄64

9⁄16 37⁄64

19⁄32 39⁄64

5⁄841⁄64

21⁄32 43⁄64

11⁄16 45⁄64

23⁄32 47⁄64

3 ⁄449⁄64

25⁄32 51⁄64

13⁄16 53⁄64

27⁄32 55⁄64

7⁄857⁄64

29⁄32 59⁄64

15⁄16 61⁄64

31⁄32 63⁄64

1

1⁄64

1⁄32

3⁄64 1⁄16

5⁄64

3⁄32

7⁄64 1⁄8 9⁄64

5⁄32

11⁄64

3⁄16

13⁄64

7⁄32

15⁄64 1⁄4 17⁄64

9⁄32

19⁄64

5⁄16

21⁄64

11⁄32

23⁄64 3⁄8 25⁄64

13⁄32

27⁄64

7⁄16

29⁄64

15⁄32

31⁄64 1⁄2

Appendix

1.800.321.8511122

Notes

_____________________________________________________________________________________________________________________

_____________________________________________________________________________________________________________________

_____________________________________________________________________________________________________________________

_____________________________________________________________________________________________________________________

_____________________________________________________________________________________________________________________

_____________________________________________________________________________________________________________________

_____________________________________________________________________________________________________________________

_____________________________________________________________________________________________________________________

_____________________________________________________________________________________________________________________

_____________________________________________________________________________________________________________________

_____________________________________________________________________________________________________________________

_____________________________________________________________________________________________________________________

_____________________________________________________________________________________________________________________

_____________________________________________________________________________________________________________________

_____________________________________________________________________________________________________________________

_____________________________________________________________________________________________________________________

_____________________________________________________________________________________________________________________

_____________________________________________________________________________________________________________________

_____________________________________________________________________________________________________________________

_____________________________________________________________________________________________________________________

_____________________________________________________________________________________________________________________

_____________________________________________________________________________________________________________________

_____________________________________________________________________________________________________________________

_____________________________________________________________________________________________________________________

Beyond Our Catalog

FreemanSupply.comUser-friendly layout

• Easy navigation for both industry veterans and newcomers to the tooling industry – the website follows the layout of this catalog

• Selection Guides to help guide you select the best materials for your applications.

• A powerful search engine that provides access to any one of our many products—easily search by using product names, catalog numbers, or generic keywords to find what you are looking for… fast!

• Instant access to detailed specification tables, which are designed in a print-friendly format for easy retrieval.

• Full cross-referenced links showing what products may be used with what accessories, etc.

• Easy access to our entire MSDS library. • Constantly updated, ensuring you have access to the most current

product information and availability.

State-of-the-art quote system • Browse our website and easily add or remove items from your

quote list. • Review and submit your quote request with special instructions

that help us fulfill your exact needs. • Receive a completed quote fast – usually within one hour from

8:00 am to 5:00 pm EST or first thing the next business morning if you choose to visit our site after 5:00 pm EST.

• After reviewing your quote, you may turn your quote into an order with a few simple clicks, or go back and make quick changes and submit a new quote.

• Additionally, our quote system will remember who you are so on future visits you do not need to re-enter your account information.

FreemanSupply.net – U.S. Members Only FreemanSupply.ca – Canadian Members OnlyAs Freeman continues to expand its web presence, we now offer a Members Only website. This enhanced service is for our premier customers and features:

• Our complete pricing structure • Immediate ordering capabilities (bypassing our quote system) • Your order history (both online orders and phone/fax orders) dating

back at least a year, making reordering faster & easier • Exclusive content and more

FreemanWax.com – Specialty WaxFreeman has created a website dedicated to our jewelry investment and carving wax products. You’ll find the most comprehensive information on:

• Jewelry Injection Waxes• Carving Wax Ring Tubes• Carving Wax Blocks And Slices• Soluble Waxes• Wax Wires• Sprue Waxes• Casting Wax Sheets

Sample KitsFreeman offers several sample kits including our very popular Machinable Media Sample Kit. Available exclusively through our website, each kit includes a copy of our latest DVD and is designed to give our custom-ers an inexpensive way to gain familiarity with new materials.

For more information, visit www.freemansupply.com

VideosFreeman has produced hours of instruc-tional videos and product demonstration videos, which are available online 24 hours a day and on compilation DVDs. The online videos are available in both Quicktime and Windows Media formats and in low and high bandwidth versions. We also provide quick and easy links to the specific pages for products being demonstrated.

Our videos cover:• Repro Fast-Cast Urethanes• Freeman & Ren Polyurethanes• Bluestar Silicone Rubber• Freeman Machinable Wax• RenShape Modeling & Tooling Boards (and SMP)• Preparing Models and Molds• Weighing & Mixing Liquid Tooling Materials• Vacuum Degassing & Pressurizing• Mass Casting With Opaque & Clear Silicone Rubber• Surface Casting• Epoxy Laminating Systems• Glove Molding Systems• Paste Laminating Systems• The Repro Laminating System

…and more (with more on the way)

®

FREEMAN MANUFACTURING & SUPPLY CO.1101 Moore Road • Avon, Ohio 44011 Phone 800-321-8511 • Fax 440-934-7200 www.freemansupply.com • [email protected]

freeman manufacturing and supply company

Documents