february 2014 greenville natural awakenings

February 2014 | Upstate South Carolina | UpstateNA.com

FREE

H E A L T H Y L I V I N G H E A L T H Y P L A N E T

feel good • live simply • laugh more

Healthy at HeartDoctors Rethink

Cardiovascular Health

Be a Love MAGNET

How to Attract Your Soul Mate

Oh-So-Healthy CHOCOLATE

Why It’s Actually Good for Us

2 Upstate South Carolina | UpstateNA.com

3natural awakenings February 2014


IT’S TIME TO LOOK AND FEEL GREAT!

HORMONE SEMINARS MONTHLY, CALL OR VISIT OUR

WEBSITE FOR UPCOMING DATES

864.850.9988livingwellhealthcare.com

838 G Powdersville Rd. • EasleyCheryl W. Middleton, PA-C • Clif Caldwell, MD

"Most experienced and established" Bio-Identical Hormone Center in the Upstate

Check out our Foodie Dining Guide on page 40 to discover local, healthy

restaurants in the Upstate.

contents

25 HEALING HURT A Hawaiian Mantra Lets Love Back In

26 RETHINKING HEART HEALTH Pioneering Doctors and Patients Reinvent Cardio Care by Linda Sechrist

30 SIMPLE STRESS BUSTERS Natural Ways to Slide into a State of Calmness by Kathleen Barnes

32 LOVE MAGNET Katherine Woodward Thomas on Drawing True Love Our Way by Debra Melani

34 QUIET KIDS IN A NOISY WORLD Bringing Out the Best in Introverts by Meredith Montgomery

36 CHOCOLATE AS HEALTH FOOD Boosting Diets and Heart Health by Judith Fertig

Natural Awakenings is your guide to a healthier, more balanced life. In each issue readers find cutting-edge information on natural health, nutrition, fitness, personal growth, green living, creative expression and the products and services that support a healthy lifestyle.

26

34

36

32


How to AdvertiseTo advertise with Natural Awakenings or request a media kit, please contact us at 864-248-4910 or email [email protected] Deadline for ads: the 10th of the month.

editoriAl submissionsEmail articles, news items and ideas to: [email protected] Deadline for editorial: the 5th of the month.

cAlendAr submissionsEmail Calendar Events to: [email protected] Deadline for calendar: the 10th of the month.

regionAl mArketsAdvertise your products or services in multiple markets! Natural Awakenings Publishing Corp. is a growing franchised family of locally owned magazines serving communities since 1994. To place your ad in other markets call 239-449-8309. For franchising opportunities call 239-530-1377 or visit NaturalAwakeningsMag.com.

advertising & submissions

UpstateNA.com

contents 11 newsbriefs

15 physician spotlight

17 community spotlight

18 healthbriefs

22 globalbriefs

24 ecotip

25 inspiration

30 healingways

32 wisewords

34 healthykids

36 consciouseating

42 classifieds

43 calendar

46 resourceguide

18

22

24


Here we are with the hectic holiday season behind us preparing to celebrate the sweetest of all holidays—Valentine’s Day. In this special heart-healthy issue,

on page 21, we learn that having fond memories of happy times, once actually thought to be a psychiatric disorder, have now been confirmed as a healthy, and ultimately posi-tive activity.

In our culture, chocolate has become synonymous with Valentine’s Day. On page 36, we hear about the amaz-ing health benefits of dark chocolate. Why not whip up a healthy vegan chocolate pie for that special someone using a recipe on page 38? This delicious treat has a lower percentage of sugar than regular chocolate, and contains higher levels of antioxidants which can help reduce cell damage.

Also in this heart-focused issue, on page 26, we examine how our heart is more than a central organ pumping blood, oxygen and nutrients throughout the body. The heart is also the seat of our emotional energy. Unresolved and repressed emotions held onto can be as damaging as the plaque that can clog our arteries and bring on a heart attack. On the plus side studies also suggest that opening our hearts to feelings of love and forgiveness can promote harmony and cleanse hurt feelings.

Following along the same line, on page 25, we see that a Hawaiian mantra uses four healing phrases to “correct the errors” of holding on to anger and hurt feelings. The Ho’oponopono Forgiveness Mantra uses these four forgiveness phrases.

I am sorry.Please forgive me.Thank you.I love you.

Wonderful words that we can all use to heal ourselves and the people we touch in so many different ways.

Happy Valentine’s Day,

Roberta © 2014 by Natural Awakenings. All rights reserved. Although some parts of this publication may be reproduced and reprinted, we require that prior permission be obtained in writing.

Natural Awakenings is a free publication distributed locally and is supported by our advertisers. It is available in selected stores, health and education centers, healing centers, public libraries and wher-ever free publications are generally seen. Please call to find a location near you or if you would like copies placed at your business.

We do not necessarily endorse the views ex-pressed in the articles and advertisements, nor are we responsible for the products and services advertised. We welcome your ideas, articles and feedback.

Calendar listings must be emailed by the 10th of the previous month to: [email protected]

SUBSCRIPTIONSSubscriptions are available by sending

$24 (for 12 issues). Call or email to subscribe.

Natural Awakenings is printed on recycled newsprint with soy based ink.

Publisher Roberta Bolduc

managing editorJeanette Watkins

contributing editors Lauren Hanson - Michele Senac

Advertising Dawn DeBoskey - Linda Craig

Janet Krinke

nAn card Janet Krinke

design & Production / Ad design

Susan McCann - Wendy Wilson

distribution Jim Craig - Ed Wilmot

to contact natural AwakeningsUpstate South Carolina Edition:

Phone: 864-248-4910

Email: [email protected]

contact us

letterfrompublisher

Facebook.com/UpstateNA


newsbriefsOnline Radio Show Emphasizes Role of Natural Health Care

A special Rethinking Health Matters online radio show, hosted by Natural Awaken-

ings National Editor Linda Sechrist from 3-4:30 pm, February 7, will highlight the importance of independent media in informing the public about natural health care options. Guests will include several Natural Awakenings publish-ers and Scott Tips, president of Natural Health Federation, an international educational non-profit that protects access to healthy food and supplements and alternative therapies without government restrictions.

Additional guests are Joanne Quinn, Ph.D., executive director of the Foundation for Alter-

native and Integrative Medicine, which collects clinical data to advance nontoxic, cost-effective therapies, plus international research consultant

Ferdinando Pisani Massamormile. Also participating are Dr. James Forleo, author of Health is Simple, Disease is Complicated; Dr. Constance Casebolt, owner of South Carolina’s Greenville Functional Medicine; and Sayer Ji, founder of GreenMedInfo.com, the world’s foremost open-access, natural medicine database.

To listen, visit Rethinking Health Matters at BlogTalkRadio.com/greenmedradio.

Midwifery Legend to Speak at Spartanburg ExpoThe fourth Annual Joyful Birth & Breastfeeding Expo is coming to Spartan-

burg on Saturday, March 8, from 10am-4pm. This will be an all-day, free educational extravaganza at the WestGate Mall and will include inspiring birth films, dozens of mother-friendly informational exhibitors, and speakers

on healthy birth and breastfeeding. There will also be a maternity fashion show, a kid’s activity area and lots of giveaways. The main speaker, Ina May Gaskin, is an internationally known midwife and author.

A special ticketed event to hear Gaskin and author Henci Goer discuss mother-friendly childbirth will be held on Friday, March 7, from 1-4:30pm at Greenville Memorial Hospital. CEUs are available for health professionals, doulas and educators.

The cost for the Friday event is $45.WestGate Mall is located at 205 W. Black-stock Rd, #1, Spartanburg. Greenville Memorial Hospital is located at 701 Grove Rd, Greenville. For more information, visit UpstateBirthNetwork.org/expo. See ad, page 50.

First Salt Cave in SC Opens in Greenville

The Saltz Medical Spa recently opened for business with a variety of rejuvenation

services. One of the services they provide is the salt cave. Salt caves have been used by clients in Europe for many years and arrived in the United States fairly recently. Salt caves have become very popular and are highly sought after due to the healing properties of the salt therapy.

During a 45-minute session in the cave, clients relax in the custom-built salt room completely surrounded by hand-picked Himalayan salt rock crystals. Tranquil music and ambient lighting contributes to the ulti-mate relaxation experience. A halogenerator crushes pharmaceutical-grade salt into small particles, creating a therapeutic dry salt-air environment.

Halotherapy, or salt therapy, is a natural, drug-free, non-invasive treatment that has been extensively researched and developed by scientists and physicians. It aids in the reduction of inflammation associated with asthma, COPD, allergies, and other respira-tory conditions. It can also be used to nourish skin and relieve skin ailments such as acne, psoriasis, and eczema. Additionally, the re-laxing environment and negative ions found in the salt cave decreases stress and fatigue. “Clients continuously report how much better they can breathe and on the improvement of their daily life,” says Nina Raddatz, CEO.

Besides the salt cave, The Saltz Medical Spa provides a variety of spa services. Their staff consists of M.D.s, Ph.D.s, chemists, med-ical assistants, massage therapists, aestheti-cians and a nutritionist.

The Saltz Medical Spa is located at 210 Bren-dan Way, Greenville. For more information, call 864-990-4189 or visit TheSaltz.com. See ad, page 21.

Ina May Gaskin, M.A.,C.P.M., Ph.D. (Hon.)

Linda Sechrist


newsbriefsNew Chiropractor Joins Cherrydale Family Chiropractic

Brendal Epling, Doctor of Chiropractic Medicine and a graduate of Sherman College of Chiropractic in the

top three of his class, has joined Cherrydale Family Chi-ropractic. Cherrydale Family Chiropractic is a maximized living health center in Greenville. This means Dr. Epling has had extensive training above and beyond the average training of chiropractic health care. He’s proud to be a part of their chiropractic team and is excited to help his community by teaching patients how to live a maximized living lifestyle.

Maximized living is provided by a team of doctors that focus not just on spinal correction (although that is the most vital aspect in what they do), but also on nutrition, exercise, and detoxification. “We want our community to

be healthy from the inside-out, through living a maximized lifestyle,” says Epling. Epling is dedicated to finding out what is causing patients’ symptoms and re-

moving interference to the nervous system. This is done by correcting misaligned bones and using state-of-the-art techniques and equipment to ensure that all his patients receive the best care possible.

Cherrydale Family Chiropractic is located next to the Cherrydale Cinemas at 3223 N. Pleasantburg Dr, Ste. A, Greenville. For more information, call 864-558-8174.

The Spice & Tea Exchange Opens in GreenvilleThe Spice & Tea Exchange recently opened in downtown Greenville. Owners

Bob and Jill Long created a place where beauty, taste, and aroma combine to make this shop a “must-see” destination. Reminiscent of an 18th-century trading post, The Spice & Tea Exchange offers high qual-ity spices, herbs, specialty blends, salts, sugars, teas and accessories from the finest purveyors in the world. A selection of organic spices and teas are also available. There are no preservatives or anti-caking agents in any of the spices.

The highlight of the store is the custom-blend wall. This includes curries, popcorn seasonings, fish blends, bakers blend, spice cocoas and an entire row of salt-free blends. The salt wall in-cludes a variety of salts including Himalayan salts and salt blocks, Brazilian Atlantic sea salt and Hawaiian Red sea salt. The Spice & Tea Exchange offers such a large assortment of healthy culinary inspiration that mealtime and party possibilities are practically endless.

The Spice & Tea Exchange also provides recipe tips, cooking demonstrations, tasting parties, and educational and community events. Since The Spice & Tea Exchange was founded in 2008, they’ve grown to 34 franchise stores across the United States. The Longs invite you to experience their new store in Greenville or stop by and see them at their location in Asheville, North Carolina.

The Spice & Tea Exchange is located at 124 N. Main St., Greenville. For more infor-mation, call 864-509-0125 or visit SpiceAndTea.com. See ad, page 33.

Brendal Epling, D.C.

kudos WGCU Public Media has recognized Natural Awakenings founder Sharon Bruckman as one of its 14 exceptional women for 2014 Mak-ers: Women Who Make Southwest Florida. The award coincides with the magazine’s celebration of 20 Years in Publica-tion, a milestone recognized nationwide.

For more information and to connect,visit NaturalAwakeningsMag.com.

Sharon Bruckman, CEO/Publisher


InSight Transformation Life Coach Training Earns New CredentialInSight Transformation Life Coach Training, a division of Life Coaching Institute,

is now a Center for Credentialing and Education Approved Board Certified Coach Training Program. The Board Certified Coach (BCC) credential is a mark of quality. It demonstrates to the public that a professional coach has met educational and train-ing requirements, passed a psychometrically sound coach-specific examination, obtained experience in the field of coaching, has professional peer references, is accountable to an enforce-able ethics code, and had a commitment to continuing education.

“The achievement of the Board Certified Coach credential solidifies the profes-sional identity of the coach. The BCC credential is attractive to professionals who would like to provide independent third-party verification that they have achieved certain coaching competency standards,” states the Center for Credentialing and Education.

InSight Transformation Life Coach Training is also an International Coach Federa-tion (ICF) recognized training school. Its graduates are able to apply for ICF certifica-tion at two levels, depending upon their length of studies.

Insight Transformation Life Coach Training is located at 25 Woods Lake Rd, Ste. 207, Greenville. For more information, call 864-282-8989 or visit LifeCoachingInstitute.org. See ad, page 33.

1st Annual SC Organic Growing Conference Coming to Greenville

The South Carolina Organization for Organic Living (SCOOL) is happy to announce that the 2014 SC

Organic Growing Conference will be hosted on March 1 by the Culinary Institute of the Carolinas at the NW Campus of Greenville Technical College.

SCOOL was founded to provide quality educa-tion in sustainable and organic agricultural practices in South Carolina. Its first event was the SC Organic Growing Conference in March of 2012. At that point,

South Carolina did not have an annual organic conference. Now, our state has yearly access to the same leading information about sustainable and organic farming as its neighboring states.

The conference will feature a number of interesting classes for every experi-ence level on a variety of topics. Classes will include Beginning Organic Gardening, Top Bar Bee Hives, Aquaponics 101, Saving and Selling Seeds, Integrating Backyard Chickens, Raising Grass-Fed Beef, Hoop House Production Methods, and much more.

In addition to the educational events, SCOOL will have a small-scale organic farm site, where ginger, turmeric and heirloom vegetables are grown. The Culinary Institute will prepare SCOOL’s locally-sourced lunch and host the conference at the NW Campus on White Horse Road. SCOOL will be posting new information every week, so please be sure to visit the website often. The cost of registration is $65, and there are a limited number of special rates for middle and high school students at $15 and high school teachers and college students at $35. A light breakfast, locally-sourced lunch, and four classes are included in the registration price.

The Culinary Institute of the Carolinas is located 8109 White Horse Rd, Greenville. For more information, call 864-414-5337, visit SCOrganicLiving.com or email [email protected].


Clemson Area Food ExchangeAdds Vendors

Thanks to the new Cottage Food Law in South Carolina, Clemson Area Food Exchange (CAFE) has been able to add

two cottage producers to the online farmers market selection: Geneva’s Realm and Goat on the Hill. A cottage food business is one that follows certain restrictions for selling food items on a small scale. The restrictions include candy and safe-baked goods that don’t include meat or excessive amounts of dairy,

sell no more than $15,000 in product per year, sell only directly to consumers, use appropriate labeling, and receive applicable registration. Custom, made-to-order or special-order products like wedding cakes do not fall under the jurisdiction of the SC Department of Agriculture and therefore are not governed by the cottage food Law. South Carolina was previously one of a handful of states that did not have such a law, and some states have more restrictions than others. The law allows more opportunities to support local business and the local food movement and is also important for those who would like to start their own cottage food business in South Carolina. Locals can get these goods at farmers’ markets and online at the CAFE.

The CAFE is an online farmers’ market serving Pickens, Oconee, and Anderson counties with local, chemical-free food. Producers are within a 50-mile radius of Clemson. Customers order online and pick up their products in Clemson, Easley, Liberty or Seneca.

Visit ClemsonAreaFoodExchange.com to order local products or CottageFoods.org for more information about cottage food laws in the U.S.

Pediatric Chiropractic Clinic Opens in GreerDr. Erik Beauvais opened Small Spines Pediatric Chiropractic

Clinic in Greer in January, the only one of its kind in the state. Dr. Beauvais will be exclusively treating children ages in-fant to 18. Small Spines utilizes cutting-edge technology called THE INSIGHT™ to accurately diagnose, measure, and track improvements in a child’s health. THE INSIGHT is the only technology available that is certified by the Space Foundation. The Space Foundation certified INSIGHT technology establishes a reliable, scientifically valid, quantitative, multidimensional representation of a child’s condition – something never before possible. Beauvais is now able to analyze a child’s condition more accurately and communicate findings more effectively.

“We’ve seen great results with children suffering from allergies, ADHD, asthma, ear infections, colic, digestive problems, and more. We are committed to enhancing the lives of children utilizing cutting edge technology. Our care is scientific, safe and effective,” states Beauvais.

Beauvais graduated Magna Cum Laude in 2009 from Sherman College of Chi-ropractic in Spartanburg where he served as president of the Chiropractic Student Government. He also received several awards and honors, including being named The Most Outstanding Student of the Year and was honored with the Milton Garfun-kel Award of Excellence. He is a board certified and a Doctor of Chiropractic by the National Board of Chiropractic Examiners and South Carolina Board of Chiropractic Examiners and a Certified Epic Pediatrics chiropractor. Beauvais is the proud father of two little girls.

Small Spines is located at 996 Batesville Rd, #7, Greer. For more information, call 864-558-0516 or visit SmallSpines.net. See ad, page 20.

It’s Yoga! Celebrates Love, Yoga StyleIt’s Yoga! Studio Inc. in Greenville is

featuring several events and activi-ties celebrating the month of “love” in February. Aromatherapist Susan Cannon will be teaching how to combine fragrant essential oils, from bath salts to body sprays, on February 8. Athena Seay will facilitate a Partner Yoga session, with chocolates and champagne included, on Valentine’s Day. Reiki Master Jessica Peach will be conducting a Reiki I certification on February 22. Jackie Knafelc will begin five weeks of engaging children in poses and mindful practice with Children’s Yoga starting February 24.

“We encourage you to enjoy the various styles of classes and instruc-tors as you stretch body and mind. Your yoga practice will infuse you with strength, stamina, balance and flexibility while building your life with peace, health and happiness. We look forward to guiding you in reaching optimum results in your fitness and health goals,” adds Kristi Ried-Barton, It’s Yoga! owner.

It’s Yoga! is located at 120 Halton Rd, Ste. 1, Greenville. To register, call 864-354-2882 or email [email protected]. For more informa-tion, visit ItsYogaStudio.com. See ad, page 33.

Erik Beauvais, D.C.

Kristi Ried-Barton, E-RYT 500

newsbriefs


physicianspotlight

Greenville Functional Medicineby Linda Sechrist

Healthy food and good nutrition, the foundation of health and wellness, have always been subjects dear to Dr.

Connie Casebolt’s heart. Prior to entering college, the owner of Greenville Functional Medicine debated between studying to be a doctor or a nutritionist. “My dad was a family doc-tor so medicine won out,” quips Dr. Casebolt, whose love of learning and good medicine helped her earn a Doctor of Medicine, Bachelor of Science in Foods and Nutrition, a Master of Science in Public Health, and most recently, her participation in an extensive training program in Functional Medicine from the Institute for Functional Medicine.

Early in her 30-year medical career, while Casebolt was still a resident in her Family Medicine program, she made a disheartening discovery. “I was shocked to see patients with so many chronic issues that I knew could have been pre-vented or avoided with good lifestyle choices and a proper diet. Raised in a family of health-oriented vegetarians, I knew these things from experience even though my medical train-ing was limited to treating illness with prescription medicine. This is largely because undergraduate medical education in nutrition was inadequate and remains so according to a re-port by the National Institutes of Health, which was the result of a comprehensive and systematic assessment of the status of nutrition at US medical schools,” she advises.

Casebolt’s rewarding career as a board-certified Family Medicine doctor includes teaching in Family Practice Resi-dency programs such as that offered by Spartanburg Medical Center, serving as the Medical Director for nursing homes, working in urgent care centers and various family practices such as the Inman Family Practice, and even traveling inter-nationally for five years to promote wellness using nutritional supplements. Enthusiasm for her past experiences pales in comparison, however, whenever Casebolt talks about Func-tional Medicine, which she discovered in 2009 after reading The Ultra Mind Solution, written by Mark Hyman, M.D., Chairman of the Board for the Institute for Functional Medi-cine. “This new paradigm in medicine addresses the under-

lying causes of disease, using a systems-oriented approach and engages both the patient and the doctor in a therapeutic partnership,” advises Casebolt.

What Casebolt has learned since immersing herself in the study of functional medicine fits like a glove with her belief in supporting each individual’s expression of health and vitality. “This evolution in the practice of medicine better addresses the healthcare needs of the 21st century because it shifts the traditional disease-centered focus of medical practice to a more patient-centered approach, which means that I address the whole person, not just their isolated set of symptoms,” she says.

Casebolt’s depth of knowledge concerning supplements and the important role that they can play in helping to heal the root causes of many chronic illnesses began accumulat-ing while she worked for a health and wellness company, which used real food technology founded on the results of science-based nutritional supplementation. “I found the company while researching alternatives for a friend of mine who had a reoccurrence of breast cancer. I joined the com-pany in 1999 so that I could buy the products for her and to learn more about the science behind them. Back then I was a ‘supplement virgin’ but I learned quickly and by 2004 became the company’s top distributor in South Carolina. I found it personally satisfying to transfer this knowledge base, along with the solid results I saw in their application, to what I learned in functional medicine. However, along the way, I realized that reversing disease with the use of supplements isn’t tied to one particular company’s products,” explains Casebolt, who is an avid reader of books written by other physicians in search of what is best for their patients.

Another of Casebolt’s sweet spots is bio-identical hor-mone replacement therapy (BHRT) for men and women. “I know the subject backwards and forwards. I also have a re-markably accurate sixth sense for the correct dosage, which is aided by my careful and comprehensive assessment of symptoms. My evaluation is backed up by the results of their blood work tests. I’ve seen some amazing health improve-ments—including bone density—in the men and women I treat with HRT pellet therapy, which I believe is better than pills and creams because pellets help individuals avoid the daily spikes and dips of their hormones,” clarifies Casebolt.

Personal research and reading in the area of gluten intol-erance also benefits Casebolt’s patients. “Dealing with gluten intolerance is in my toolbox along with full knowledge of substitute entrées and snacks as well as the Paleo diet, which mimics the diets of our caveman ancestors and includes meats, seafood, vegetables, fruits and nuts. Although I’m per-sonally a vegetarian, I believe that both the vegetarian AND the Paleo diets can be beneficial. All healthy diets will have in common the elimination of GMOs, and packaged and processed foods, as well as paying close attention to the gly-cemic impact of foods. Other essentials to wellness include exercise, adequate sleep and proper stress management. I try to focus on the whole picture,” advises Casebolt.

Greenville Functional Medicine is located at 301 Halton Rd, Ste. A, Greenville. For more information, call 864-558-0200 or visit GreenvilleFunctionalMedicine.com. See ad, pages 2 and 3.


communityspotlight

by Michele Senac

Balanced Solutions, located in Greer, offers natural hormone replacement, thyroid manage-

ment and weight-loss therapies for men and women. Owner and Medi-cal Director, William Scott, M.D., and his staff of four Nurse Practitioners and two Registered Nurses provide treatment for a variety of symptoms related to hormone imbalance. Man-aging Director, Kris Oakes, explains, “Our method of delivery is one of

the things that sets us apart. We are one of the few places in the area that use the pellet delivery method, and our experi-ence in this delivery method insures that the patient will not experience any discomfort or pain.”

Oakes explains that hormonal balance is key to well-being and can be a delicate thing to achieve. Balanced Solutions uses only bioidentical hormones that are plant-derived compounds which have the same molecular structure as those made by the body. Each bioidentical hormone is custom compounded based on the individual’s laboratory test results. Oakes states that studies now show both the short and long-term benefits of natural hormone replacement therapy. Some of these benefits include improved mental clarity and sleep quality, reduction in mood swings and hot flashes, increased libido, improved blood flow, muscle strength and tone, and improved bone density. Bioidentical hormones can be delivered by pills, patches, creams, gels, shots or pellets. Balanced Solutions uses pellet therapy which Oakes says, “is very effective, is not hard on the liver and does not cause a roller-coaster effect, which makes it easier to maintain hormonal balance. Plus there’s no

fear of transference to loved ones, children or pets.” Pel-let therapy is described as a sustainable delivery system that balances body chem-istry. The pellets, some as tiny as a grain of rice, are placed underneath the skin in the fatty tissue. They are administered every three to four months, depending on the patient’s symptoms and labora-tory results.

A new medically supervised weight-loss program, Slim Again, was introduced last month. Slim Again is designed to allow the body to burn stored fat naturally and to cause the body to reset so that it metabolizes fat properly. Meal replacement, human chorionic gonadotropin (hCG), natural appetite sup-pressants and detoxification are part of the program. Balanced Solutions also offers pharmaceutical-grade multi-vitamins and supplements and numerous over-the-counter products.

Potential new patients are offered a complimentary medi-cal evaluation where a detailed medical history is taken, the patient’s concerns and symptoms are addressed and possible treatment options are discussed. If the patient decides to pro-ceed, discounted initial laboratory tests are performed, and once laboratory results are received, a complete treatment plan is outlined. Oakes adds, “The key is not overpromising something. We go over the benefits and possible side effects. We want our patients to be informed and make informed deci-sions. We’re very thorough and we want to help our patients to have the best outcome.”

Balanced Solutions is located at The Village at Thornblade, 420 The Parkway, Suite J, Greer. For more information, call 864-343-8352 or visit BalancedAgain.com. See ad, page 16.

Michele Senac is a contributing editor for Natural Awakenings and a writer and author. She is certified in Interior Redesign, Home Staging and feng shui. Contact FineRedesigns.com or AroundTheTableCookbook.com. See ad, page 19.

Balanced Solutions

Take the Next Step

L I M I T E D T I M E O F F E RComplimentary,

No Obligation Blood Analysis!($250 Value)

Call to schedule your appoinment today.

888.299.9300 or go online at balancedagain.com

Hormonal balance is key to your well-being and a delicate thing to achieve. Other hormone

replacement therapies rarely accomplish or maintain the hormonal equilibrium your body depends

on for optimum health. Our Hormone Replacement Therapy is highly successful. Here’s why:

The right kind of hormoneWe use only bioidentical hormones that are natural, plant-derived compounds which have the same

molecular structure as those made by the human body.

The right amount and compound of hormonesAt Balanced Solutions, each bioidentical hormone regimen is custom-compounded, based

on individual diagnostic results and history, making them safer and more effective than

synthetic hormones.

The right delivery systemPellet therapy is a sustainable delivery method that balances body chemistry and restores health and

vitality. The effect of pellets is nearly identical to the way hormones are naturally produced in a

healthy, 30-something individual.

Additional Health Benefits include:

• Rejuvenation

• Increased Metabolism

• Enhanced Mental Clarity

• Improved Sleep Quality

• Reduction in Mood Swings

• Decreased Hot Flashes

• Increased Libido

• Improved Blood Flow

• Promotes Bone Density

Balanced Solutions 864.662.7655 toll free 888.299.9300 balancedagain.comThe Village at Thornblade • 420 The Parkway, Suite N • Greer, SC 29650

Don’t accept fatigue, weight gain, depressionor low sex drive as normal.

Feel great again with Hormone Replacement Therapy.The perfect treatment for both men and women!

William Scott, M.D.


healthbriefsEGG WHITES FUNCTION LIKE BLOOD PRESSURE MEDSMaintaining

healthy blood pressure is vital for long-term heart health, and scientists have now discovered evi-dence that a compo-nent of egg whites may have beneficial cardiovascular effects. Researchers from Clemson University, in South Carolina, found that a peptide in egg white, one of the building blocks of proteins, reduces blood pressure in animals about as much as a low dose of Captopril, a prescription medica-tion for high blood pressure. The RVPSL peptide acts as a natural ACE inhibitor, functioning similar to the en-tire family of prescription medications that treat hypertension.

Early Warnings of Heart Troubles Differ for Women

Women may worry more about breast cancer, but in reality, heart

disease is the top killer of American women, claiming 300,000 lives a year, 7.5 times the number that die of breast cancer, according to the Centers for Dis-ease Control and Prevention. Although heart disease is more often perceived as a men’s issue, since 1984 more women have died of heart disease than men.

Part of the reason may be that women’s heart attacks can differ from men’s and the American Heart Association (AHA) warns that women often fail to rec-ognize the symptoms, ranging from torso aches and pains and nausea to anxiety, shortness of breath, dizziness and extreme fatigue. They may experience subtle symptoms for months and write them off as byproducts of menopause, heart-burn or effects of aging. The National Institutes of Health states that 43 percent of women that have heart attacks experience no chest pain. The difference between the more subtle signs of a heart attack in women and the more dramatic signs in men may help explain why 75 percent of men, prompt-ed to act quickly, survive a first heart attack, while only 62 percent of women do, according to the AHA. “Research shows that women may not be diagnosed or treated as aggressively as men,” notes the Agency for Healthcare Research and Quality, part of the U.S. Department of Health & Human Services.


A Different Breathalyzer Test for Heart FailureSimply blowing up a balloon may help doctors test heart

function, according to a new study from the Cleveland Clinic. Although such examinations usually require expensive and some-times invasive procedures, the new test can be done in a doctor’s office in 30 seconds, according to the research findings published in the Journal of the American College of Cardiology. The patient simply breathes into a Mylar balloon, similar to a party version, and the air is passed through a machine to produce an individual “breathprint”. Researchers determined that exhaled breath contains volatile organic compounds that can be easily analyzed to determine potential heart failure.

Zinc Orchestrates Immune ResponseMany have heard that zinc can stop a cold in its tracks,

and new research from Ohio State University tells us why; it turns out that zinc gently taps the brakes on immune responses, slowing them down and preventing inflammation from spiraling out of control.

The researchers’ work with human cells and animals found that zinc serves to balance the immune response within the cells so that the consequences of insuf-ficient zinc at the time of an infection include excessive inflammation. Of all the zinc contained in our bodies, only about 10 percent of it is readily accessible to help fight off an infection, notes Daren Knoell, professor of pharmacy and internal medicine and lead author of the study, published in Cell Reports. The research team suggests that proper zinc balance is especially important in battling serious and potentially deadly infections. Zinc deficiency affects about 2 billion people worldwide, including an estimated 40 percent of the U.S. elderly.

Happy Marriage, Healthier LivesA University of Missouri expert says that people in happy marriages are more

likely to rate their health better than their peers as they age. Evidently, engaging with one’s spouse builds a strong relationship that can improve spirits, promote feelings of well-being and lower stress. Analyzing data from 707 continuously mar-ried adults that participated in the Marital Instabil-ity Over the Life Course panel study, a 20-year nationwide research project begun in 1980, researchers found that married people have better mental and physical health and are less likely to develop chronic conditions than their unmarried, widowed or divorced peers. Thus, researchers recommended involv-ing spouses and families in treatment for any illness. They further suggested that in cases of a strained marital relation-ship, improving marital harmony would also improve health.


FDA Moves to Ban Trans FatsHeart-clogging trans fatty acids may

soon be a thing of the past. The U.S. Food and Drug Administration (FDA) has taken the first step to re-move trans fats from its GRAS (gener-ally recognized as safe) list, effectively banning their use in food products. Trans fats, also known as hydro-genated vegetable oils, can be found in many processed foods, including baked goods, microwave popcorn, peanut butter, frozen pizza, marga-rine and coffee creamers. Created by adding hydrogen to liquid oils to turn them into a solid form, trans fats have been used to improve the texture, shelf life or flavor of foods. For more than a decade, numerous scientific studies have documented that trans fats raise dangerous LDL cholesterol and lower good HDL cholesterol. The FDA’s proposed ban would require the food industry to gradu-ally phase out all trans fats, likely over several months or years, noting their threat to health. Commissioner Margaret Hamburg said the move could prevent 20,000 heart attacks a year and 7,000 deaths. Many food manufacturers have already phased out trans fats since new nutrition labeling requirements were intro-duced by the FDA in 2006; plus an increasing number of local laws have banned them.


Nostalgia Arms Us for the FutureHaving lingering fond memories of hap-

py times, once actually thought to be a psychiatric disorder, have now been con-firmed as a healthy and, ultimately, positive activity. Most people experience nostalgia at least once a week and nearly half of those surveyed reported experiencing it three or four times a week, say researchers at England’s University of Southampton. When speaking wistfully of the past, individuals are usually reconstructing happy memories of family and friends, and typically become more optimistic about the future, reports lead researcher and Social Psychologist Constantine Sedikides, Ph.D., who observes, “Nostalgia makes us a bit more human.” The Southampton paper, presented to the American Psychological Association, meshes well with another study confirm-ing that nostalgic memories inspire positive feelings of joy, high self-regard, belonging and meaningfulness in life. In two studies, social psychologists at North Dakota State University found that past fond memories help us become more self-confident and cope better in the present. “We see nostalgia as a psycho-logical resource that people can dip into to conjure the evidence they need to assure themselves that they’re valued,” says lead researcher Clay Routledge.


globalbriefsNews and resources to inspire concerned citizens to work together in building a healthier, stronger society that benefits all.

Wild ValentinesMany Animals Mate for LifeHumans like to think of themselves as unique when it comes to taking vows of togetherness. But a surprising number of other species in the animal kingdom provide sterling examples of fidelity, monogamy and lifelong pairing. Gibbons, of the ape family, are the nearest relatives to humans that mate for life. They form extremely strong pairings and both sexes are on relatively equal footing in their relationships. Bald eagles, our national emblem, typically mate for life, except in the event of a partner’s inability to procreate. Wolves, often portrayed as tricksters in folklore, conduct a family life more loyal than many human relationships. Wolf packs typically comprise a male, a female and their offspring, making them akin to a human nuclear family. Swans form monogamous pair bonds that last for many years or even for life. Their loyalty is so storied that the image of two swans swimming with their necks entwined in the shape of a heart has become a universal symbol of true love. French angelfish are seldom found far from their mate, because they live, travel and even hunt in pairs. The fish form monogamous relationships that often last as long as both individuals are alive. In fact, they act as a team to vigorously defend their territory against neighboring pairs. Other examples include albatrosses, African antelopes, black vultures, Malagasy giant rats, prairie voles, sandhill cranes, termites and, of course, turtle doves.

To view images, visit Tinyurl.com/AnimalMatePics and Tinyurl.com/Animal MatesSlideshow.

Sweet SolutionTurning Agri-Waste to Good Use

Cement that incorporates waste ash from sugar production is not only stronger than ordinary cement, it also qualifies as a greener building material. Researchers at the Niels Bohr Institute at the University of Copenhagen, in Denmark, have found that cement made with sugar cane ash mixed in is stronger,

can withstand higher pressure and crumbles less than ordinary cement. In countries where sugar cane is grown, such as Cuba and Brazil, this agri-cultural waste product has been added to cement for years. Extracting sugar from the cane typically leaves a lot of fiber waste that is burned into ash, discarded and then requires disposal. Using sugar cane ash also can lower the energy use and carbon footprint of cement production. Heloisa Bordallo, a researcher at the Institute, comments, “You are saving both CO2 emissions and raw materials.”

Source: EcoSeed.org

A loving heart is the beginning

of all knowledge.~Thomas Carlyle


Handy CurriculumShop Class Teaches SustainabilityAccording to a report in The Bos-ton Globe, some American schools regret that they replaced woodshops with high-tech educational forums in the 1990s. Shop class is valuable for students that may underperform in traditional academic settings and em-powers them to learn and produce tangible results. Doug Stowe, a woodworker and teacher in Eureka Springs, Arkansas, writes in WisdomOfHands.Blogspot.ca, “Our society has inadvertently created a dependent generation of young people that don’t know how to fix things and lack even the most basic manual competence. Putting girls and boys into shop class would chal-lenge rampant consumerism because a person is less inclined to throw out a piece of furniture and buy a replacement if they know how to fix it. “With so many cheap imports flooding stores, it’s difficult for students to gain perspective on the resources and time required to create a piece of furniture, so shop class can teach students to appreciate long-lasting quality and its accompa-nying fair price tag. In this way, shop class is linked to sustainability.”

Source: Treehugger.com

Jumpin’ JellyfishNumbers Explode with Ocean Warming and OverfishingFavorite destination beach resorts around the world have seen huge increases in jellyfish “bloom” activity. “Jellyfish and tourism are not happy bedfellows,” says Dr. Lisa-ann Gershwin, Ph.D., a pioneering marine biologist and author of Stung!

On Jellyfish Blooms and the Future of the Ocean. “In Florida, it’s not uncommon in recent years for a half a million people to be stung during an outbreak.” A report, Review of Jel-lyfish Blooms in the Medi-terranean and Black Sea, written by Fernando Borea for the General Fisheries Commission for the Medi-terranean and the United Nations, cites both global warming and overfishing,

which removes jellyfish predators, as causes for recent jellyfish population explo-sions. Of the more than 2,000 species of jellyfish swimming through the world’s waters, most are completely harmless. However, human contact with some types can cause excruciating pain, and the box jellyfish is among the handful of species that have caused fatalities around the globe. Gershwin says, “Australia is upfront about its jellyfish dangers and also assertive in safety management, whereas other places have them, but may understand less about them or in some cases, just don’t want to say. Tourists need to be aware of local hazards and not expect to necessarily be provided with pertinent information.”

Source: CNN

Green FinanceCanada Shows the Way via Mass TransitThe government of Ontario, Canada, is issuing “green bonds” to fund the expansion of mass transit infrastruc-ture in the province. Ontario Premier Kathleen Wynne says, “Green bonds are a great tool to raise capital for a project with specific environmental benefits. The worldwide market for green bonds in the last year has dou-bled; it’s now estimated to be more than $346 billion in U.S. dollars.”

Source: Treehugger.com

Star TrekkingVoyager 1 Enters Interstellar SpaceThe U.S. Na-tional Aero-nautics and Space Agency (NASA) recently confirmed that after 36 years, the Voyager 1 probe crossed the boundary of the heliosphere, or the extent of our Sun’s influence, a year ago. It’s the first manmade object to venture into interstellar space. At a distance of about 12 billion miles from the Sun, the latest data indi-cates that Voyager 1 has been traveling through the plasma, or ionized gas, present in the space between stars. The journal Science notes that this corrobo-rates the existence of a long-hypothesized boundary between the solar plasma and the interstellar plasma. Voyager 2, a com-panion craft launched at the same time, is also expected to break the barrier.

Source: EarthSky.org


ecotipBeyond Bling True Treasures Avert Eco-HarmDone right, Valentine’s Day and gifts of jewelry go together like love and marriage. Those that have no desire to support the unsafe worker conditions, widespread price fixing and waste associated with gold min-ing, also linked to pollution, financing wars and terrorism, look for better options. They wish to have no part in underwriting standard ring-making practices which, according to the Worldwatch Institute, create tons of toxic mining waste that can persist for decades and enter the food chain. Happily, there are far more ethical choices. Alternate routes. Among many sustainable and socially responsible options, jewelry made from recycled gold, silver and titanium plus synthetic gemstones is of-fered by GreenKarat (GreenKarat.com) while Brilliant Earth (BrilliantEarth.com) pro-vides antiques and also custom makes or helps customers create their own treasured gifts utilizing minerals from pure sources; the company also donates 5 percent of its profits to support communities that have suffered from unethical industry practices. Heirlooms. A son or grandson gifting a grandmother’s or mother’s cherished piece of jewelry to a spouse or girlfriend expresses a tradition of love and family connectivity, plus gives new life to precious items. Michelle Ercanbrack, a family historian at Ancestry.com, recommends using a family-treasured diamond in a more modern setting or making a ring into a pendant. “Heirlooms link the present to the past—they are part of a family narrative that can increase the present generation’s sense of belonging and identity,” she says. Native American jewelry. Deborah Nelson, owner of Silver Eagle Gallery, in Naples, Florida, and Highlands, North Carolina, attests that artful jewelry by Native Americans supports their culture and forges a connection to Americana with timeless appeal. Bracelets made by Navajo Indians incorporate turquoise pieces often linked together or set in mosaic form on a sterling band. Sterling silver and golden amber sunburst rings also make good gifts. “The handmade attention to detail is a stark contrast to what’s cast in a mold overseas,” says Nelson.

Loving LocalSmall Retailers Gaining ForceWhile online mega-shopping malls have deci-mated many types of small businesses around the country, the Business Alliance for Local Living Economies notes that independent bookstores are doing surprisingly well. For the last four years, their number and total sales have grown, despite the recent recession. In 2009, citizens patronized 1,651 independent bookstores in the United States; today their number exceeds 1,900. In addition, local coffee shops have grown faster than the largest chain’s store-fronts. Bakers and specialty food purveyors, independent pharmacies and pet, fabric and stationery stores are growing, too. One reason for the good news is the “buy local” ethic promoted by groups such as the American Independent Business Alliance. Last year, sales at independent busi-nesses in cities benefitting from these campaigns grew 8.6 percent; those without them still increased 3.4 percent. Independents are winning customer loyalty in part by hosting and sponsoring events that enrich the community. The public is realizing that buying local supports area families, keeps more dollars circulating locally and strengthens a healthy sense of community that benefits everyone.

Source: YesMagazine.org

globalbriefs


Ho’oponopono is an ancient Hawaiian huna, a secret to facilitating forgiveness within;

or simply, the art of forgiveness. Four healing phrases are employed in a harmonic mantra to help “make things right” or “correct the errors”. It works to cleanse hurt feelings and relieve suffering from being in an unforgiving or unforgiven state. Accord-ing to the Babylon online dictionary, Ho’oponopono is used to release prob-lems and blocks that cause imbalance, unease and stress in the self; bring peace and balance through physical, mental and spiritual cleansing that involves re-pentance and transmutation; and create balance, freedom, love, peace and wis-dom within individuals, social entities, the world and the universe.

Ho’oponopono Forgiveness Mantra

I am sorry.Please forgive me.Thank you.I love you.

These four forgiveness phrases, both individually and collectively, help heal us and our relationships with oth-ers, especially loved ones. Each one melts hearts and heals souls. Going deeper, we can voice this mantra in communing with the divine and see the effect both within and without.

I am sorry for participating in this er-roneous memory data.

Please forgive me for not seeing the perfection in this moment, and play-ing back a universal memory I have received within me that is riddled with wrongs and errors.

Thank you for cleansing me, others, the world and the universe.

I love you. Loving the sweet divine is the greatest power or energy there is in all space. I am now loving everyone involved and affected. I know that my perceptions of them are within me, where this error first occurred and where it can be eradicated.

Like planting a seed in soil that grows into nothing of our making, the divine does the work as we allow it to work through us. As we come to consis-tently use the Ho’oponopono mantra, we may elect to select a special word as a substitute for the whole mantra to use as a touchstone, so that when we say or think this word, we are immediately clear and clean of all the pain associated with any erroneous memory data pre-sented. Our heart is healed and family or friends will return to relationships with a lighter heart. We do not need to under-stand how it works, only that it does.

Source: Adapted from VividLife.me

HEALING HURTA Hawaiian Mantra Lets Love Back In

inspiration


RETHINKING HEART HEALTHPioneering Doctors and Patients

Reinvent Cardio Careby Linda Sechrist

improving heart health highlighted in his book, The 30-Day Heart Tune-Up, and an upcoming PBS special, concern life-style factors capable of shrinking plaque, improving circulation and strengthening the heartbeat. “Abnormal plaque growth is preventable 90 percent of the time,” states the president of Masley Optimal Health Center, in St. Petersburg, Florida. While conducting research on the heart health of nearly 1,000 patients over a period of 20 years, Masley suspected that the traditional assessment approach of measuring cholesterol, blood sugar and blood pressure didn’t effectively address the biochemistry within arter-ies. Testing intima-media thickness (IMT) using a simple 10-minute external ultrasound confirmed it. The test bounces high-frequency sound waves to measure the thickness of the carotid arteries’ in-nermost two layers on either side of the neck. “This valuable tool allows for an estimate of arterial age. A healthy, young cardiovascular system has less plaque and an unhealthy, old one has more,” advises Masley. IMT, a useful tool for preventing future heart attacks and strokes, differs from standard carot-id Doppler ultrasound, which looks for artery obstructions suggesting surgery. A practitioner of functional medi-cine, Masley explains heart-related diagnoses differently than his allopathic counterparts. “Rather than diagnosing high blood pressure as hypertension, I categorize it as not enough exercise, not enough fruits and vegetables, high emo-tional stress and excessive body fat.” To optimize heart health, Masley employs a broad, holistic matrix of op-tions that enhance the cardiovascular system—the interactions among diet, activity level, weight, environmental toxins, hormones, stress and bio- chemical factors such as blood sugar control and inflammation levels. He prescribes heart-healing foods that simultaneously help to manage the aging process, following a customized, heart-friendly supplement plan; engag-ing in exercise that strengthens the heart and arteries; and learning how to better manage stress. He contends that cardiovascular events remain the top cause of death because individuals are largely unaware of treatment options before they get into

In 1977, Dr. Dean Ornish began to think beyond an allopathic medicine paradigm that defined the reversal

of cardiovascular disease, including coronary heart disease (CHD) and the hypertensive diseases such as heart fail-ure and stroke, as physiologically im-plausible. Undaunted by the challenge of funding his research, he pushed for-ward. Results of his foundational 1986 to 1992 Lifestyle Heart Trial, published in the Journal of the American Medical Association, proved that individuals with preexisting coronary atheroscle-rosis that make intensive, integrated lifestyle changes can begin to experi-ence improvements in their condition after as little as one year without using lipid-lowering drugs. Based on his 30-plus years of clini-cal research, Ornish and his colleagues further showed that five years of follow-ing proper nutrition, fitness and stress

management—which must include love and support—can reduce symptoms of CHD and other chronic conditions. He remarks in Love & Survival: 8 Pathways to Intimacy and Health that despite nu-merous studies showing a medical basis for its occurrence, the reason why CHD is reversible is still the subject of debate. Ornish’s work has paved the way for a growing corps of pioneer-ing integrative physicians successfully collaborating with patients to reduce the leading cause of death for men and women in the United States.

Plaque the CulpritThe cause of cardiovascular disease is arterial plaque, a fine layer of fatty material that forms within the arteries and blocks blood flow. It is largely the result of food and activity choices, plus the degree of inflammation in the arter-ies. Dr. Steven Masley’s three keys to


trouble. More, “Most people falsely assume that their condition has been fixed with a medical procedure and/or drugs, and that a lifestyle change isn’t necessary.”

Cholesterol’s Bad RapDr. Stephen Sinatra, an integrative cardi-ologist, anti-aging specialist and bioen-ergetics psychotherapist in Manchester, Connecticut, has also shifted his heart health paradigm. He now prescribes a combination of conventional medicine, food, supplements, mind/body strategies and natural healing methods. His book, Heartbreak and Heart Disease: A Mind/Body Prescription for Healing the Heart, relates many inspiring case histories that address the psycho-emotional component of heart health and illustrate how to repair and reopen a broken heart by releasing long-repressed emotions. Following two years of Gestalt psy-chotherapy training and seven years of bioenergetics training, Sinatra likewise realized that heartbreak was one of the major causes of heart disease. An expert in the field of natural cardiology, he had once believed that cholesterol and fat were the primary causes before 40 years of treatment research taught him other-wise. “Cholesterol is not the reason for heart disease,” advises Sinatra, founder of HeartMDInstitute.com and author of The Great Cholesterol Myth. “The body produces and needs cholesterol to convert sunlight to vitamin D, to make sex hormones, vital semipermeable membranes for the body’s trillions of cells, plus bile salts for digestion. Even your brain makes and uses cholesterol to build connections between the neurons

Love and intimacy are at the root

of what makes us sick and what

makes us well, what

causes sadness

and what brings happiness,

what makes us suffer

and what leads to healing.

~ Dr. Dean Ornish,

Love & Survival

Upgrade your indoor air quality

www.palmettoac.com

Call for a FREE consultation! (864) 845-1400

Let us help you improve your indoor air with our Indoor Air Quality Products.• Cleaner, healthier air

• Designed for use with new and existing systems

• Low maintenance

• Improved system performance

The air inside can be up to 100 times more polluted than the air outside. The EPA ranks indoor air quality as a top-five environmental concern. Dust, pollen, mold, bacteria, pet dander can be found in any home, no matter how careful you are.


that facilitate learning and memory.”

Real PerpetratorsSinatra names the real perpetrators of heart disease—stress, inflammation and overeating sugar and processed foods containing saturated fat. He counsels that the heart benefits less from a low-fat, high-carbohydrate diet than one low in carbohydrates and higher in healthy fats, overturning widespread medical mantras. Also, a high-fructose, high-grain carbohydrate diet raises triglycer-ides, increases the risk of metabolic syndrome and contributes to insulin resistance, causing the liver to produce more cholesterol, as well as more inflammatory, low-density lipopro-tein cholesterol (LDL) particles, all of which increase the risk for CHD, diabetes and stroke. The American Heart Association (AHA) estimates that metabolic syndrome, which affects

nearly 35 percent of American adults, may overtake smoking as the leading risk factor for CHD. The AHA currently is focused on increasing awareness that heart disease is the number one killer of women. Its Go Red for Women campaign empha-sizes the vital need to take preventive basic actions, including adopting an ex-ercise routine, healthier diet and doctor visits for appropriate non-invasive tests.

Essential SpiritDr. James Forleo, a chiropractor in Durango, Colorado, with 30-plus years of clinical experience, maintains that health is simple, disease is complicated (also the title of his book). He counsels patients, “If mental stress is present in your life, you owe it to your cardiovas-cular system to change to a healthier lifestyle. Your life may depend on it.” Forleo has recognized that an indi-vidual’s state of mind can be a big help

It is no coincidence that we address our physical and emotional

heart by the same name. Our physical heart usually reflects the

state of our emotional heart, and vice versa.

~ Dr. James Forleo

or hindrance in maintaining a healthy heart. “The heart represents a differ-ent realm of experience entirely, one that cannot be explained by logic and reason,” comments Forleo. He champions the link between maintaining normal spinal function and healthy heart function, along with supporting the inner presence of Spirit, which he calls the healthy heart’s ultimate elixir. “Its essence relaxes the heart, opens the mind to possibilities greater than itself and provides the per-spective that the heart and the mind are complementary,” he observes. He explains that when our emo-tions get bottled up, something in our heart or circulation has to give. “If you or someone you know experi-ences heart problems, chances are that unresolved emotions lie directly below the surface,” he says. “There are excep-tions, and genetic problems can explain many heart defects, but heart problems don’t usually show up unless emotions are involved.” Forleo’s concept is supported by the work of Rollin McCraty, Ph.D., executive vice president and direc-tor of research at California’s Institute of HeartMath. His research papers

this month ONLY $99.00 same day headshot

F I R S T I M P R E S S I O N M A T T E R S !


include The Energetic Heart: Bioelectro-magnetic Interactions Within and Between People. “Today, evidence suggests that the heart may play a particularly important role in emotional experience. Research in the relatively new discipline of neurocar-diology has confirmed that the heart is a sensory organ and acts as a sophisticated information encoding and processing center that learns, remembers and makes independent functional decisions that don’t involve the cerebral cortex,” advises Mc-Craty.

To Happy HeartsPioneering integrative medical doctors Masley, Sinatra, Forleo and Mona Lisa Schultz, who also holds a Ph.D. in behav-ioral neuroscience, agree that in matters of heart disease, emotions take center stage. Schultz, who recently co-authored All is Well: Heal Your Body with Medicine, Affir-mations and Intuition, with Louise L. Hay, a leading founder of the self-help move-ment, applies her 25 years of experience as a medical intuitive with the best of Western clinical science, brain research and energy medicine. Shultz observes, “Every illness has an emotional component, which tells us intuitively that something or someone in our life or environment is out of balance and needs to be addressed. Our use of language—such as frustration makes our heart race, anger boils our blood—and our common sense are telling us what we don’t need more studies to confirm. If we can’t deal with our anger in a timely fashion, name our feelings, respond effectively and release them, we increase our chance of illness, ranging from hypertension to car-diovascular events.” According to the American Journal of Cardiology, the U.S. spends 10 percent of all healthcare dollars for cardiovascular disease prevention and medical manage-ment versus 90 percent on medical treat-ment procedures and hospital care. For individuals interested in taking charge of their heart health, working with a physi-cian that embraces the emerging para-digm of integrative lifestyle changes and prevention can be a drug-free, life-saving decision.

Linda Sechrist is the senior staff writer for Natural Awakenings. Visit ItsAllAboutWe.com for full interviews.

Write it on your heart that every day is the best day in the year.~Ralph Waldo Emerson


Simple Stress BustersNatural Ways to Slide into a State of Calmnessby Kathleen Barnes

We all encounter everyday stressors and usually find our own ways of defusing them.

However, when chronic stress remains unresolved, it extracts a toll on health that may range from heart disease and stroke to obesity, gastrointestinal problems and depression. Thankfully, Natural Awakenings has uncovered inviting ways to regularly de-stress that naturally make us feel good. Here are some refreshing ideas for immediate rest and relaxation. Eat Mindfully. Chocolate can be an excellent antidote to stress-related binge eating, advises Dr. Susan Lord,

an integrative physician in Great Bar-rington, Massachusetts, who leads mind-body medicine programs at the Kripalu Center for Yoga & Health, in Stockbridge. “We rarely eat mindfully,” comments Lord. “We’re usually gulping down our food while watching TV, ar-guing with the kids or reading a book.” She often leads a meditation in which participants are allotted one small piece of chocolate that they must eat slowly and consciously. “Most people discover they have never really tasted their food,” she says. “They are pleas-antly surprised to discover that they feel satiated and satisfied on every level.”

healingways Lord’s teaching is supported by a study from an Oregon Research Institute affiliate in Albuquerque, New Mexico, showing that people lost significant amounts of weight by eating slowly and mindfully. Accordingly, Kripalu has encouraged eating in silence for nearly 40 years, a practice Lord heartily recommends to her pa-tients for one meal a day. Walk a labyrinth. A meditative walk on a labyrinth may be just what the doctor ordered, says physician Esther Sternberg, professor of medicine and research director at the Arizona Center for Integrative Medicine at the University of Arizona, in Tucson. “A labyrinth dif-fers from a maze, which has high walls and many dead ends,” notes Sternberg. “Walking a maze is inevitably stressful; a labyrinth has the exact opposite effect. There is only one path in and one path out. You go to the middle, meditate and walk back out. It’s a perfectly calming walking meditation.” In physiological terms, Sternberg explains, the deep breathing induced by labyrinth walking activates the vagus nerve, which prompts relaxation. It does this by interrupting the brain’s stress response and halting the release of adrenaline and the stress hormone cortisol from the adrenal glands. Our ancestors built labyrinths as early as 4,000 BCE. They exist today in churches, healing centers and backyards all over the world. Finger labyrinths, even as simple as an outline printed on


a piece of paper, also have proved to be effective relaxation tools, says Neal Harris, a licensed clinical professional counselor in Barrington, Illinois. His study confirming its relaxing effects was published in the Annals of Psychothera-py & Integrative Health. Shake (or laugh) it off. Anyone that has ever felt like exploding from tight shoulders, indigestion, head-aches or other conditions caused by accumulated stress can benefit from Lord’s recommendation to experience a whole-body shake. “Just stand with your feet firmly planted and start shaking—first your feet, then your legs, arms, head and neck and eventually, your whole body—for at least two or three minutes,” she coun-sels. “You’ll shake off all of that tension, energize every cell and probably start laughing, another great stress reliever.” A good belly laugh is likewise a powerful stress reliever, according to a study by researchers at Indiana State University, in Terra Haute, published in Alternative Therapies in Health and Medi-cine. Results also showed that laughter increased production of the protective cells that boost immune function. Create a memory garden. For Sternberg, her personal place of peace is an unconscious re-creation combining

the sights and smells of her grand-mother’s garden with the comfortable “at home” feeling of her parents’ deck and mementos from a happy time in Crete. At the center of Sternberg’s happy memories are fragrant jasmine and gardenia trees, lavender and basil, all reminders of happy times in her life. She recalls, “It wasn’t until I was fin-ished that I realized what I had done.” A review of relevant science report-ed in Neural Plasticity explains that the brain’s hippocampus region, a seat of memory, especially related to place, also normally regulates the production of cortisol. But an excess of cortisol due to stress can impair its memory functions. “When we are in a place that brings happy memories to mind, we let go of stress and stop the release of cortisol,” says Sternberg. “It helps to just think of a place where we have been happy.” She recommends creating a home space with some plants on a window-sill, photos of happy family gatherings, fabrics or paint in beloved colors and perhaps inherited items that trigger fond memories.

Kathleen Barnes is the author of numer-ous natural health books, including 10 Best Ways to Manage Stress. Connect at KathleenBarnes.com.

Breathe DeeplyPerform this subtle de-stressor while in line at the market or driving. It slows heart rate, oxygenates the body, improves mental clarity and has a relaxing effect on the nervous system.

n Sit or stand straight.

n Put the tip of the tongue against the ridge of tissue just behind the upper front teeth, and keep it there throughout the entire exercise.

n Inhale through the nose for a count of four.

n Hold each breath for a count of seven.

n Exhale completely through the mouth with a whoosh sound for a count of eight.

n Repeat three more times.

Source: DrWeil.com

Music Soothes the SoulDozens of studies from leading institutions like Brandeis University, in Waltham, Massachusetts, the Elizabeth Seton Pediatric Center, in Yonkers, New York, and Colorado State University, in Fort Collins, show that music can offset stress, relieve pain, lower blood pressure, improve immune function and support rest-ful sleep. So play a tune or two of much-loved music and let the calming effects induce a state of relaxation. According to research from the American Society of Hy-

pertension, classical music, the blues and other soothing music work best because they cause the body to release endorphins and slow breathing rates. It’s better yet if our favorite music inspires stress-releasing body movement.

Source: GreenMedInfo.com

NaturalAwakeningsSingles.com

What Better TimeTo Find Your

Natural Match!Join in February and recieve

a 20% Valentine’s discount using

referral code “NASingles”! 20% OFF

NewMembships

February Special


wisewords

After years of expe-riencing love going sour, Katherine

Woodward Thomas set a goal: She would marry her soul mate within a year. Her quest inspired a surprising awakening that spurred her to look deep inside for the key that would unblock love. Thomas realized the trans-formation that enabled her success involved clear steps that could help anyone. Today, the licensed psychotherapist and relationship expert has guided thousands toward successful relationships via her national bestseller, Calling in “The One”: 7 Weeks to At-tract the Love of Your Life, and subse-quent books and seminars.What catalyzed your calling in “the one” professional journey?I was 41, a card-carrying member of one of America’s largest-growing groups—the never-marrieds. I had bought into the cultural belief that a woman my age had little chance of

LOVE MAGNETKatherine Woodward Thomas

on Drawing True Love Our Wayby Debra Melani

finding a great husband. I felt anxious and resigned, trying to come to terms with it, but sad inside. Fortunately, at the time, I was part of a small group supportive of each other’s intentions. So I set the outrageous intention that I would be engaged by my next birthday. I also recognized my longstand-ing pattern of attracting

unavailable men who were engaged, married or alcoholics. A woman in the group said, “Katherine, I will hold that intention with you if you permit me to hold you accountable to be the woman you would need to be in order to fulfill it.” Her wake-up call turned my focus from running out to find love to going within to discover the barriers I had against it. Thus I began what became the Calling in “The One” process.

How does it differ from other approaches to finding love?Many approaches focus on the external

reasons love is elusive, such as all the good men are taken, men don’t like powerful women or just not having met the right person. This approach focuses more on the internal reasons—going within to discover and release one’s own conscious and unconscious barri-ers. For most of us, a gap exists between how much we think we want love and how much we are actually open and ready to receive it. Until we bridge that gap, we will covertly keep love at bay, and won’t even realize we are doing it.

What are the most common hidden barriers to love?One hidden barrier is resentment. We only resent people to the extent that we’ve given our power away to them. Uncover your role in what happened. Even if it was 97 percent their fault and 3 percent yours, zero in on that 3 percent, because you’ll only be able to trust yourself to love again once you’ve taken that responsibility. If you still feel resentful, you have not yet evolved beyond the person you were before. Another centers on old agree-ments—the spoken and unspoken,agreements we make, usually in an emotional time—such as “I’m never going to let myself get hurt again” or “I’ll never love anyone the way I love you.” Such agreements live in our lives as intentions. They may no longer be conscious, yet still set our course. Another has to do with toxic relational dynamics. To find the best partnership, you need to be your best self. Maintaining a toxic dynamic drains personal power, making it hard

A Positive Path forSpiritual Living

Celebration Services Sundays 10:30 AM

Children’s Ministry Available7538 Highway 76, Pendleton, SC

P.O. Box 212, 29670864-646-6114

www.unityofclemsonanderson.orgfor calendar of events and more...

Unity o�erspractical, spiritual

teachings that empower

abundant and meaningful living.


to move forward in life. It’s vital to evolve out of this debilitating dynamic so you are in the center of your power everywhere in life. The fourth area, and probably the most important, revolves around the core beliefs you hold about both yourself and others. You might have a reasonably clear sense of yourself around money, career and friendship, but your core love identity might cause you to believe yourself unworthy of a quality partner. Identifying and challenging these beliefs is critical in learning how to break free from them, helping to raise your value in your own eyes and thus in others.

You believe the best way to find a needle in a haystack is to become magnetic and allow that needle to find you. How does one become magnetic to love?Being centered in the truth of your own value and the real possibilities you hold for true love is wildly attractive. Love yearns to embrace us, but can’t come to us if it can’t come through us. When we shift into this place of possibility, we can become profoundly magnetic to love.

Learn more at CallingInTheOne.net, ConsciousUncoupling.com or KatherineWoodwardThomas.com.

Explore the qualities possible in an enlightened mate at NaturalAwakenings Singles.com.

Freelance journalist Debra Melani is from Lyons, CO. Connect at DebraMelani.com.

Mention this ad for a FREE gourmet gift! 864-509-0125 | 124 North Main Street, Greenville, SC 29601 Facebook.com/TSTEGreenville | [email protected]

www.spiceandtea.com/greenville

Find Your Way to Flavor™ at The Spice & Tea Exchange® of Greenville!Purveyors of Fine Spices, Herbs, Blends, Salts, Teas®


healthykids

Gabrielle Perillo’s daughter, A’ngel, 11, is a deep thinker, compassionate for all beings

(human and not), a defender of justice, spiritual and extremely creative. She pursues any subject she studies with focus and passion. Although other chil-dren are naturally drawn to her, A’ngel, a born introvert, generally prefers to play quietly on her own. At first, her mother worried that her daughter was being insensitive to others and not pay-ing attention to her surroundings. But once Mom released her own emotional projections, she recognized how happy her daughter is in her own space and began to appreciate the benefits of this independence. At least a third of Americans are introverts, yet many parents are prone to mischaracterize their more private children as antisocial, self-centered and lonely. Susan Cain, a former corporate at-torney and au-thor of Quiet: The Power of Introverts in a World That Can’t Stop Talking, ex-plains, “Introverts are not antisocial, they just prefer socializing in lower-key ways.” They usually form a few deep and in-timate relationships compared to extro-verts that often culti-vate many friends. Christine Fonse-

Quiet Kids in a Noisy World

Bringing Out the Best in Introvertsby Meredith Montgomery

ca, an educational psychologist and au-thor of Quiet Kids, notes the danger in misunderstanding a child’s hesitancy or reserved nature. “Kids can benefit from understanding who they are and what it means to be an introvert. Otherwise, they may compare themselves to their extrovert friends and feel deficient.” Introverts own many exceptional qualities. They tend to be deep thinkers able to work independently in highly creative and innovative ways. They may prefer to learn a lot about a few topics instead of a little about many different areas. Often described as empathetic, conscientious and self-aware, introverts make authentic leaders and effective managers as adults. Introvert and extrovert tempera-ments are distinguished by how individ-uals generate energy. Introverts process the world and recharge through soli-

tude; many can flourish in social situ-ations as long as they can rejuvenate by being on their own. Fonseca notes a defining differ-ence in physiol-ogy. “Introverts use part of the nervous system that has a long

pathway from point A to point B, so it takes them longer to process

information.” Cain adds, “Introverts

to advertise or

participate in our

march edition, call

864-248-4910

coming next month

The Latest LOCAL FOOD TRENDSGood at Home and On the Go


also usually have a longer runway than others, so it takes them longer to take off and fly. It’s crucial that the message they’re receiving from parents and teachers is, ‘That’s okay.’” It’s important that parents balance how they honor a child’s prefer-ences with teaching them skills to thrive. “Don’t expect them to follow the gang,” says Cain. “Instead, encourage them to follow their passions.” Parents can empower children with tools to increase their comfort zone. If youngsters have difficulty speaking up in class, it helps to prepare them with what they want to say beforehand. Cain notes that this lessens anxiety and when they are able to speak up, they’ll feel like part of the class. Simple tips can offer relief in un-comfortable social situations. Perillo reinforces social manners before she and A’ngel arrive at an event. She focuses on the greetings, reminding her to extend her hand first, speak clearly, make eye contact and smile. Also, because self-promotion doesn’t come naturally to introverts, they often need coaching to highlight their own assets when applying for a club, college or job. Fonseca encourages families to embrace digital technology. She observes, “Most introverts are extroverts online. While face-to-face communication tends to drain them, that doesn’t happen as much online, plus it’s easier to feel more adept socially there.” They’ll still need to disconnect and renew after socializing online, so it’s important to set usage boundaries. Fonseca, who has one introverted and one extroverted child, facilitates dialogue

that teaches each of them to com-municate with their peers about their needs. “My introvert tells her extrovert friends not to take offense if she needs to take quiet time alone. They offer each other a perspective that makes their own point of view more well-rounded.” From a neuropsychological per-spective, introverts and extroverts can learn from each other, as well. Accord-ing to Fonseca, extroverts that habitu-ally activate their sympathetic nervous system (“fight-or-flight”) can experience burnout if they don’t learn how to slow down and be calm. However, intro-

Change Your Life!

Powdersville Wellness Spa215 Siloam Rd., Easley, SC

Linda Allen, LMT (864) 509-1159www.powdersvillespa.com

• Headache/Migraine• Manage Stress• Alleviate Pain

In the hands of acaring professional…

MASSAGE THERAPY

verts, relying mostly on their parasym-pathetic system (“rest and digest”), can be overly calm and slow to respond to situations. Fonseca notes, “It’s not about one temperament being more positive than the other; it’s about understand-ing who everyone is, their authentic self and finding balance.”

Meredith Montgomery is the publisher of Natural Awakenings Mobile/Baldwin, AL (HealthyLivingHealthyPlanet.com).


consciouseating

“Research tells us that 14 out of any 10

individuals like choco-late,” quips cartoonist Sandra Boyn-ton. American chocolate lovers buy 58 million-plus pounds around Valentine’s Day, accord-ing to Nielsen Research. Ideally, the dark treat would be as healthy as a salad or an apple. Fortu-nately, accumulating research is on the way to giving plant-based chocolate superfood status. All chocolate starts with cacao beans, seeds from the pods of the tropical cacao tree that thrives only in hot, rainy climates in Africa, Indone-sia and South America. Local soil and climate conditions determine flavor characteristics, much as with grapes. Harvested beans are fermented to cre-ate the chocolate taste and then dried. Afterwards, chocolate makers add brand-specific ingredients to the cacao solids. “The percentage number on a bar’s wrapper represents the weight that actually comes from the cacao bean content,” says Robert L. Wolke, professor emeritus of chemistry at the

CHOCOLATE AS HEALTH FOODBoosting Diets and Heart Health

by Judith Fertig

University of Pittsburgh and author of What

Einstein Told His Cook: Kitchen

Science Explained.

“The higher the number, the

lower the percent-age of sugar and the less sweet, more bitter

and complex the flavor.” This is significant because dark chocolate contains higher levels of antioxidants which can help reduce cell damage, according to the Integrative Medicine Department at the University of Michigan, in Ann Arbor. Alex Whitmore, founder of Taza Chocolate, in Somerville, Massachu-setts, recently had one of its bars lab tested for antioxidant levels, called ORAC, or oxygen radical absorption capacity; the higher the value, the more antioxidants. Taza Chocolate’s 80% Dark Bar had a 65 percent higher ORAC than Himalayan goji berries, famed for being a superfood. “This is very high for a chocolate bar,” notes Whitmore. Cocoa also serves as a superfood for cardiovascular and metabolic health, report two recent studies from separate teams of Harvard School of Public Health researchers. A 2012 meta-analysis of clinical trials pub-

coverartist

Planted HeartsDarlene Seale

“Each heart image has its unique markings and patterns, just as our own heart experiences make us who we are,” explains cover artist Darlene Seale. She created Planted Hearts on an iPad using a digital painting pro-gram with a specialized stylus as her brush. “I make every stroke by hand as if I were using traditional paint and a brush,” she says. Inspired by Russian painter Wassily Kandinsky, she shares, “I admire artists that combine unusual elements that invite the viewer in. There’s always more to explore the deeper one is willing to look.” As a child, Seale discovered color via crayons and paint and recalls the power they gave her. “Those tools suddenly opened my eyes to so many possibilities,” she recalls. Seale’s artistic explorations are executed in a variety of media, with a primary focus on graphic design, blending art and words. She shares, “I believe art heals the heart and its creation promotes joy. For this rea-son, I find myself drawn to making iconic images using an abundance of color, texture and pattern.” Seale creates art and teaches art workshops in her home studio near San Diego in Fallbrook, California. She remarks, “When I make some-thing and it evolves into art that’s quite different than what I expect, I love it. It’s both humbling and joyful.”

View the artist’s portfolio at BadBirdStudio.com.


lished in the American Journal of Clini-cal Nutrition concluded that consum-ing dark, unsweetened cocoa powder and dark chocolate can improve blood pressure, vascular dilation and cho-lesterol levels, plus reduce metabolic precursors like diabetes that can lead to heart disease. In 2011, Eric Ding, Ph.D., a Har-vard School of Public Health epidemi-ologist and nutrition scientist, reviewed short-term trials of subjects ingesting 400 to 500 mg per day of flavonoid-rich cocoa, which he equates to 33 bars of milk chocolate or eight bars of dark chocolate. While Ding feels this is an unreasonable amount to eat because of the extra calories from sugar and fat, he states, “Supplements with concentrated cocoa flavonoids may perhaps be help-ful for garnering the benefits discov-ered. The key is getting the benefits for heart disease while avoiding the calo-ries, and for that, chocolate bars are not likely the best solution.” Another observational study pub-lished in Nutrition shows that eating dark chocolate might help keep the pounds off for teenagers. Researchers with the Healthy Lifestyle in Europe by Nutrition in Adolescence program at the University of Zaragoza, in Spain, knew that chocolate consumption in adults already had been linked to lower body mass index. They found that chocolate consumption was also asso-ciated with lower total and midsection fat in European adolescents, reports Sayer Ji, founder of GreenMedInfo.com, a natural health research database. “The quality and cocoa content they used in their research is probably much higher than in America,” says Ji. “From my perspective, it appears that even when researchers don’t control for type, the results across the board are rather startling. Even American sub-jects, presumably eating common milk chocolate bars, see benefits.” So, this Valentine’s Day—and every day—we can happily relish that one-ounce piece of artisan dark chocolate melting slowly in our mouth and know we’re doing it for pleasure and for health. Judith Fertig blogs at AlfrescoFoodAnd Lifestyle.blogspot.com from Overland Park, KS.

Yoga Resource Guide

ANDERSON

Yoga Place2508 N. Main St.

864-404-1616 or 864-376-7750www.YogaPlace.org

ClEmSON/PENDlEtON

The Purple Mat [Yoga • Wellness]

the Purple mat, ltd.102 E. Main St.864-916-YOGA

www.ThePurpleMat.com

EASlEY

Integrative Yoga therapy633 Saco Lowell Rd.

864-444-5523www.LindaPattersonYoga.com

GREENVIllEwww.GreenvilleIndoorRowing.com

Halton Business Park120 Halton Rd, Ste. 1

864-354-2882www.ItsYogaStudio.com

404 N. Pleasantburg Dr.864-420-9839

www.QiWorksStudio.com

“Row-ga!” and YOGA at Greenville Indoor Rowing, llC

576-A Woodruff Rd.864-281-1505 or 864-901-3776

www.GreenvilleIndoorRowing.com

GREENVIllE

1140 Woodruff Rd. 864-329-1114

www.SouthernOm.com

GREER

R

Yoga East 2105 Old Spartanburg Rd.

864-244-6478 www.YogaEast.us

SPARtANBURG

1040 Fernwood-Glendale Rd., Ste. 58

864-583-3335www.Zen-Studios.com


Small-batch, artisan chocolate makers strive to make delicious chocolate in the purest, most ethical and sustainable ways possible. They often travel to meet the growers to source the best cacao beans (organic preferred), use fair trade principles and take a personal interest in making fine chocolate without filler ingredients. Here is a partial list of conscientious members of Craft Choco-late Makers of America:

Amano Artisan Chocolate, AmanoChocolate.com

Askinosie Chocolate, Askinosie.com

DeVries Chocolate, DeVriesChocolate.com

Patric Chocolate, Patric-Chocolate.com

Taza Chocolate, TazaChocolate.com

Vegan Chocolate PieServe this with fresh raspberries and enjoy a little romance.

Yields 8 servings

Chocolate Wafer Crust6½ oz dairy-free chocolate wafer cookies, crushed into fine crumbs1 Tbsp maple or date sugar3 oz vegan buttery stick (such as Earth Balance), melted and slightly cooled

Chocolate Filling13 oz dairy-free semisweet chocolate chips (such as Ghirardelli)1/3 cup strong brewed coffee1 tsp vanilla extract1 lb silken tofu, drained1 Tbsp agave1 (9-in) prepared chocolate wafer crust

Preheat the oven to 350° F.

For the crust, combine the cookie crumbs, sugar and melted vegan but-tery stick. Press this mixture firmly and evenly into the bottom, up the sides and just over the lip of a 9-inch metal pie pan. Bake on the middle rack of the oven until the crust is set and appears dry, 18 to 20 minutes. Remove from the oven and cool completely, about 1 hour.

For the filling, melt the chocolate chips with the coffee and vanilla in a me-dium metal bowl set over a saucepan of simmering water, stirring often with a spatula. Combine the tofu, melted chocolate mixture and agave in a blender or food processor until smooth, about 1 minute. Pour the filling into the crust and refrigerate for 2 hours or until the filling becomes firm.

Vegan Hot ChocolateA comforting way to enjoy the benefits of chocolate on a cold day.

Yields 4 servings

2½ cups plain rice milk3 Tbsp maple or date sugar3 Tbsp unsweetened cocoa powder½ tsp salt½ tsp vanilla extract1 pinch ground cinnamon1 pinch cayenne pepper

Bring the rice milk, sugar, cocoa pow-der, salt, vanilla extract, cinnamon and cayenne pepper to a simmer in a sauce-pan over medium-high heat. Remove from the heat and whisk until frothy. Serve immediately.

Source: Recipes courtesy of Judith Fertig

Chocolate Cookery

Chocolate Artistry

AWAKENING AMERICA

Natural AwakeningsCelebrates 20 Yearsof Conscious Living

Read What People Are Saying About

Natural AwakeningsNatural Awakenings provides helpful information on natural health and en-vironmental issues with a consistently positive perspective and tone, which is not always easy considering how serious and intimidating some of these topics are. It’s a rarity.

~ Sayer Ji, founder, GreenMedInfo.com

Publications like Natural Awakenings reach many people and I’m so glad to be able to share a voice beyond the propaganda.

~ Melinda Hemmelgarn, Food Sleuth

I have changed so much over the last year finally realizing that life is so much bigger than me. I love this Earth and all the wonders that are a part of it, and your magazine contributes to my appreciation.

~ Theresa Sutton, Connecticut

It is unusual to see your level of writing and consciousness in a free publica-tion. Thanks for a great work.

~ Kaih Khriste’ King, Arizona

Natural Awakenings magazine is the only advertising I use for my practice other than word of mouth referrals and it has brought us new patients consis-tently especially now that we advertise monthly. The quality of the leads is great and we really enjoy helping the holistic-minded patient. The publisher is great to work with and truly wants to see the business succeed. We plan on always advertising with Natural Awak-enings and expanding our presence in the magazine.

~ Cate Vieregger, DDS, Colorado


5000 Old Spartanburg Rd., TaylorsEastgate Village (Beside Pivotal Fitness) 864-244-2733

Explore our full line of pure oils.Find wellness solutions for the entirefamily, just the way Mother Natureintended. We offer gift sets, personalconsultations and custom blends.

Email: [email protected] Website: www.GoodToGoJuiceBar.com

(Gift Cards Available)

3, 5, & 10 Day Programs Reset your Metabolism with our Complete Program Cleansing from $45 Per Day

Reset Raw Juice Cleanse™


HEALTHY

LOCAL

FRESH

SEASONAL

ORGANIC

GLUTEN-FREE

DAIRY-FREE

FARM-TO-TABLE

VEGETARIAN

VEGAN

PALEO

RAW

check out these local

restaurants!

Anderson

SUMMA JOE’SJoe & Summer Fredette127 N. Main St.864-965-9030

We are proud to use local produce from Polecat Vegetable Farm, Bethel Trails Farm, Split Creek Farm, and other local f a r m s w h e n available.

greenville

JASON’S DELI824 Woods Crossing Rd.864-284-9870JasonsDeli.com

Greenville’s fa-vorite deli of-fers gluten-free, vegetarian, veg-an and dairy-free options ev-ery day. No

high-fructose corn syrup or trans fats are ever in any of our food. Salad bar with many organic choices is also available. See ad, page 49.

LIFEIT CAFE’730 S. Pleasantburg Dr, Ste. L(near Greenville Tech) 864-271-4334LifeItCafe.com

“Change your diet into a Lifeit.” Organic, vegan, raw, living foods, smoothies, fresh juices, soups, sandwiches, des-serts, gluten-free options, weekly meal plans, catering, classes, free wi-fi. Making healthy food taste good!

TORTILLA MARIA115 Pelham Rd.864-271-0742TortillaMaria.com

Organic food, the way na-ture intended. Fresh from

the earth, wholesome and beautifully prepared entrees. Plenty of yummy, gluten-free and raw food options.

TRIO - A BRICK OVEN CAFE22 N. Main St.864-467-1000TrioCafe.com

Indulge in delicious, glu-ten-free choices for lunch, dinner and dessert. You can even quench your thirst with gluten-free beer. We offer a full-ca-tering menu at affordable

prices which will amaze you. See ad, page 41.

sPArtAnburg

GARNER’S NATURAL FOODS1855 E Main St.Specialty Row at Hillcrest864-585-1021

Garner’s is a local f a m i l y - o w n e d health food store and deli with or-ganic, gluten-free options, and in-door/outdoor seat-ing. Hours: Mon- Fri: 9am-4pm, and Sat: 9am-3pm.

JASON’S DELI1450 WO Ezell Blvd.864-574-0202JasonsDeli.com

S p a r t a n -burg’s favor-ite deli offers gluten-free, vegetarian, vegan and

dairy-free options every day. No high-fructose corn syrup or trans fats are ever in any of our food. Salad bar with many organic choices is also available. See ad, page 49.

tAYlors

GOOD TO GO5000 Old Spartanburg Rd.Eastgate Village864-244-2733Facebook.com/GoodToGoJuiceBar

F e a t u r i n g whole food s m o o t h i e s , juices, well-

ness shots, acai bowls, salads, juice cleanses, and nutritional supplements. All-natural, all the time. Your body will thank you. See ad, page 39.


classifiedseXHibitors wAnted

NATURAL AWAKENINGS HEALTHY LIVING EXPO ─ Celebrating 5 years of Natural Awaken-ings magazine in the Upstate. To be held inside McAlister Square in Greenville on Saturday, April 12, from 10am-4pm. Sponsored by EARTH FM 103.3 and the University Center. Film screenings with documentary film star from Los Angeles in attendance. Early-bird, advertiser and non-advertiser rates available. For details and application, call 864-569-8631 or visit HealthyLiving5.com.

For rent

NEW OFFICE/STUDIO SPACE ─ Beautiful new garden complex. Upstairs office and/or yoga/Pilates studio now being added. 1300 sf will be ready early 2014. Natural health office and massage downstairs. Located at 2802 E. North St. Easy access to all areas of Greenville. Beautiful garden and event setting. Call 864-640-2598.

ROOMS FOR RENT ─ Powdersville Wellness Spa is looking for massage therapists, nail tech or health practitioners. Beautiful, clean environ-ment. Call Linda Allen at 864-509-1159.

SPACE FOR RENT ─ Space available for bodywork professionals. Prefer massage therapists. Great loca-tion and space for those just starting out. Space may be shared between therapists. Qi Works Studio, 404 N Pleasantburg Dr, Greenville. 864-420-9839.

For sAle

ACUGRAPH ─ By Miridia Technology, Acugraph is an excellent tool for health clinics. Retails for over $3,000. Item is brand new. $2,100. 864-457-2005.

HelP wAnted

AD SALES REP, SPARTANBURG AREA ─ If you are confident in your sales ability, thrive in straight com-mission roles, and relish unlimited earning potential, Natural Awakenings Spartanburg may be the right fit for you. Training provided. For consideration, send resume to [email protected] or call 864-248-4910.

FT/PT OCCUPATIONAL THERAPIST (OT) – Cur-rently seeking licensed OTs for our private practice. Submit resumes to [email protected].

FT/PT SPEECH-LANGUAGE PATHOLOGIST (SLP) – Currently seeking experienced SLPs to provide professional, preventative treatment to children and adults. Submit resumes to [email protected].

YA-REGISTERED YOGA TEACHERS, YOGA THERAPISTS, AERIAL YOGA INSTRUCTORS AND PILATES TEACHERS – Easley location. Weekday, weekend, and night class times available. Email resume to [email protected].

nutritionAl Products

MENTAL HEALTH SUPPLEMENT ─ Depression/Anxiety? Bi-Polar/Mood Disorders? ADD/ADHD issues? 15 Universities in England, Canada, New Zealand, and the United States have studied this product because of people’s incredible healing claims. Watch these highly informative videos to see how this nutritional product has been helping people get their life back! Visit BrainHealth.Me and order this product at BrainBalance55.MyQXLife.com.

sHAred oFFice sPAce wAnted

OFFICE SPACE ─ One day per week until practice established. Damaris Drewry, Ph.D. Psychology. Specializing in fast-track alternatives to psychotherapy using Energy Psychology and 25 years experience. Upstate South Carolina. 520-320-6366 or [email protected].

sPeciAl event

COMMUNITY HU SING ─ Sunday, February 2nd and 16th; 11-11:30am. Singing HU will help put you in tune with the ever-present reality of God. Free presentation by ECKANKAR, Religion of the Light and Sound of God. Event held at the American Red Cross, 940 Grove Rd, Greenville. To learn more about HU, visit HearHU.org or Eckankar.org. Local contact: [email protected].

testimonies wAnted

ARE YOU GROUNDED? ─ Have you experienced great results from Earthing? We are looking for people who have read the Earthing book and have been ground-ed by using the pads and/or by going barefoot. Anyone interested in giving their testimony at an upcoming screening of the documentary Grounded, please call 864-517-6939 or email [email protected] with “Grounded” in the subject line.


calendarofeventsNote: Dates are subject to change. Please use contact information to confirm dates and times of events. How to submit: All listings must be received by the 10th of the month prior to publication. Please help by following the format as seen below and email listings to [email protected]. All non-advertiser calendar entries are subject to availability and are $15 per each submission.

sAturdAY, FebruArY 1Yang Style 24 Forms ─ 10:30am-12pm. Learn one of the most popular tai-chi routines. Yang Style 24 form improves balance, strength, concentration & health. Pre-registration required. Feb 1-May 10. 16 hrs of instruction in 12 meetings. $120. Qi Works Studio, 404 N. Pleasantburg Dr, Greenville. 420-9839.

sundAY, FebruArY 2Think Win/Win ─ 10:30am-12pm. Learn how to relate to others from a mind-set and heart-set that is mutually beneficial to the individuals involved. Free-Love Offering appreciated; No registration re-quired. Unity Spiritual Center of Clemson Anderson, 7538 Highway 76, Pendleton. 646-6114.

FridAY, FebruArY 7Candelight Yin Yoga ─ 6:30-8:30pm. Register at YogaEast.us under Events tab or pay at the door. $15. Yoga East, 2105 Old Spartanburg Rd, Greer. 244-6478.

sAturdAY, FebruArY 8Valentine’s Aromatherapy Workshop ─ 9:30-11:30am. Learn how essential oils can help awaken your sense during our DIY workshop with registered Aromatherapist. $40. It’s Yoga Studio, Inc, 120 Halton Rd, Ste. 1, Greenville. 354-2882 or 908-0138.

sundAY, FebruArY 9Seek First to Understand, Then to be Understood ─ 10:30am-12pm. Learn the language of effective communication with others. Seek first to understand and then to be understood. Free-Love Offering ap-preciated; No registration required. Unity Spiritual Center of Clemson Anderson, 7538 Highway 76, Pendleton. 646-6114.

tuesdAY, FebruArY 11Childhood Ear Infections & Chiropractic Care ─ 6:15-7:15pm. Learn how you may be able to end your child’s suffering safely and naturally through chiropractic care. Small Spines Pediatric Chiroprac-tic, 996 Batesville Rd, #7, Greer. Free. Registration required. 558-0516.

Finding Nutritional Balance in an Age of Fad Diets & Quick Weight Loss Schemes ─ 6:45-8pm. Learn how to decipher opinions of doctors, dieticians, trainers and others who are telling you how to eat. Create a lifestyle that increases your vitality and helps you surpass your health goals. Free. The Wild Radish, 161 Verdin Rd, Greenville. RSVP 297-1105.

sundAY, FebruArY 16Synergy ─ 10:30am-12pm. You will learn that there are times, places, ways and situations in which one plus one equals more than two. Free-Love Offering appreciated; No registration required. Unity Spiri-tual Center of Clemson Anderson, 7538 Highway 76, Pendleton. 646-6114.

mondAY, FebruArY 17Chi Toning ─ 7:30-8:30am. Chi Toning is a combi-nation of qigong warm-up, slow weights movements using qigong, followed by yoga cool-down. New session begins Mar 24. Session of 12 lessons $90. Pre-registration required. Feb 17-Mar 15 (M-W-F)). Qi Works Studio, 404 N. Pleasantburg Dr, Greenville. 420-9839.

Yang Style 48 Forms Tai Chi ─ 1:30-2:30pm. Tai-Chi based on the Yang Forms. Improves balance, strength, concentration & flexibility. Must know Yang Style 24 Forms. Session of 16 lessons $120. Pre-registration required. Feb 17-Apr 9 (Mon & Wed). Qi Works Studio, 404 N. Pleasantburg Dr, Greenville. 420-9839.

Qi Flex ─ 5:30-6:30pm. Qi-Flex is a new class that will improve balance, strength & flexibility. Combi-nation of martial arts training & yoga. Session of 16 lessons $120. Pre-registration required. Feb 17-Apr 9 (Mon & Wed). Qi Works Studio, 404 N. Pleasantburg Dr, Greenville. 420-9839.

Tai Chi for Arthritis ─ 6:30-7:30pm. This class helps reduce pain, enhances balance, health, coor-dination, strength and reduces stress. Movements are based on Sun Style. Session of 16 lessons $120. Pre-registration required. Feb 17-Apr 9 (Mon & Wed). Qi Works Studio, 404 N. Pleasantburg Dr, Greenville. 420-9839.

tuesdAY, FebruArY 18QiGong Dawn ─ 7:30-8:30am. Begin your day energized. QiGong Dawn is gentle but powerful movements of qigong. New session begins Mar 24. Session of 8 lessons $75. Pre-registration required. Feb 18-Mar 13 (Tu & Th). Qi Works Studio, 404 N. Pleasantburg Dr, Greenville. 420-9839.

Chi Toning ─ 3:30-4:30pm. Chi Toning is a com-bination of qigong warm-up, slow weights move-ments using qigong, followed by yoga cool-down. New session begins Mar 24. Session of 8 lessons $75. Pre-registration required. Feb 18-Mar 13 (Tu & Th). Qi Works Studio, 404 N. Pleasantburg Dr, Greenville. 420-9839.

Correcting Eye Issues without Surgery ─ 6:45-8pm. Dr. Connie Casebolt, M.D., from Greenville Functional Medicine will be our guest speaker. Learn how supplements can aid in repairing many eye dis-orders as well as specific micro-current stimulation. The Wild Radish, 161 Verdin Rd, Greenville. Free. RSVP 297-1105.

sundAY, FebruArY 23A Peace that Surpasses Understanding! ─ 10:30am-12pm. What is the biggest inhibitor to our experiencing A Peace That Surpasses Understand-ing? You will receive information guaranteed to assist you in eliminating this blockage from your life. Free-Love Offering appreciated; No registration required. Unity Spiritual Center of Clemson Ander-son, 7538 Highway 76, Pendleton. 646-6114.

uPcomingevents

sAturdAY, mArcH 11st Annual SC Organic Growing Conference ─ Organized by The South Carolina Organization for Organic Living (SCOOL). Hosted by the Culinary Institute of the Carolinas at the NW Campus of Greenville Technical College, Greenville. $65. Limited special rates for students and teachers. For details and to register, visit SCOrganicLiving.com or email [email protected].

sAturdAY, mArcH 8The Joyful Birth & Breastfeeding Expo ─ 10am-4pm. Educational extravaganza. Speakers, including author and midwife. Films, fashion show, kid’s activities, and lots of giveaways. Free. Westgate Mall, Spartanburg. Visit UpstateBirthNetwork.org/Expo.


Note: Dates are subject to change. Please use contact information to confirm dates and times of events. How to submit: All listings must be received by the 10th of the month prior to publication. Please help by following the format as seen below and email listings to [email protected]. Non-advertiser cal-endar entries are subject to availability and are $15 per each submission.

ongoingevents

sundaySouthern Flow Hot Yoga ─ 9am; 4pm and 6pm. Vigorous series of poses accessible to all levels. Packages available. Southern Om, 1140 Woodruff Rd, next to Whole Foods Market, Greenville. 329-1114.Healing Circle ─ 6-7:30pm. Dedicated to the principals of healing, prayer, spiritual growth and meditation. Free. Oma’s Healing Garden, 150 Mile-stone Way, Ste. A, Greenville. 354-4505.

mondaySouthern Flow Hot Yoga ─ 6am, 10am, 12pm, 5pm and 7pm. See Sunday 9am listing for details.

All Levels Yoga ─ 8:30-9:30am. Structured around learning how to focus on the breath throughout various yoga postures. $15. It’s Yoga! Studio Inc, 120 Halton Rd, Ste. 1, Greenville. 354-2882 or 404-798-3442.

Tai Chi for Arthritis ─ 9:30-10:30am. Reduces pain and stress, enhances balance, health, coor-dination and strength. First class free; 1, 4, 8, or 16-class passes $12-$120. Qi Works Studio, 404 N. Pleasantburg Dr, Greenville. Must pre-register. 420-9839.

Yoga Therapy Class ─ 11am-12pm. Learn poses and breath for releasing and healing issues of arthritis, neck pain, cancer care, injuries and overworked muscles. It’s Yoga! Studio, 120 Halton Rd, Ste. 1, Greenville. 354-2882 or 908-0138.

Intermediate Yoga Class ─ 12:15–1:15pm. For those that have the fundamentals of Yoga and are looking for a more intense practice. $13. Yoga East, 2105 Old Spartanburg Rd, Greer. 244-6478.

Veggie Delights ─ 3-5pm. Each week a new veg-etarian recipe to try. Easy and delicious. Whole Foods Market, 1140 Woodruff Rd, Greenville. 335-2300.

Pre-Natal Yoga ─ 5:15pm. Poses and breathing specific for the mother-to-be, relieving low back pain, swollen feet, insomnia and preparing for labor and delivery as well as recovery after the baby is born. $75 for 5 classes. It’s Yoga! Studio Inc, 120 Halton Rd, Ste. 1, Greenville. 354-2882 or 908-0138.MeaningSight™: Establishing Vision, Goals, Meaning and Spirit ─ 6:15-8:30pm. Second Mon-day of the month. Establish a life vision and goals for meaning, flourishing and spirit – 6 small group classes to bring more meaning and a deeper spiri-tuality into your life. $150. InSight Transformation Life Coach Training, 25 Woods Lake Rd, Ste. 207, Greenville. 282-8989.All Levels Yoga ─ 6:30-8pm. Relieve tired muscles and calm the stress of the day. $15 per class. It’s Yoga! Studio Inc, 120 Halton Rd, Ste. 1, Greenville. 354-2882.All Levels Yoganize® ─ 7pm. Unique combina-tion of yoga, yoga therapy, Pilates and specialized toning exercises to invigorate the mind, body and spirit. $13. Yoga East, 2105 Old Spartanburg Rd, Greer. 244-6478.

tuesdayAll Levels Yoganize® ─ 6am. See Monday 7pm listing for details.Southern Flow Hot Yoga ─ 6am, 8am, 10am, 12pm, 4pm, 5:30pm and 7:15pm. See Sunday 9am listing for details.Yoga for Cancer Survivors ─ Intermediate/Advanced ─ 9 and 10:30am. Gentle stretching and breathing exercises that relax and invigorate the body and mind. St. Francis Millennium Campus (near ICAR campus), Greenville. $7 per class. Call to register, 675-4656.All Levels Yoganize® ─ 9:15am. See Monday 7pm listing for details.

Toning Class ─ 9:30-10:15am. Main goal of class - get rid of belly fat and tone muscles. Great for new mothers. Combination of yoga, weights and qigong. First class free; 1, 4, 8, or 16-class passes $12-$120. Qi Works Studio, 404 N. Pleasantburg Dr, Greenville. Must pre-register, 420-9839.

VBAC Support Group Meeting ─ 10am. 2nd Tuesday’s. Share your experience about VBAC. Carolina WaterBirth, 915-J South St, Simpsonville. 329-0010 or 866-564-5554.

All Levels Yoga ─ 11am. Recharge your day with this morning class, energizing, stretching, rejuvenat-ing mind and body. $15 per class. It’s Yoga! Studio Inc, 120 Halton Rd, Ste. 1, Greenville. 354-2882 or 908-0138.

Beginner Yoga Class ─ 11am–12:15pm. Great class to start a practice. Learn basic Yoga poses and breathing techniques. $13. Yoga East, 2105 Old Spartanburg Rd, Greer. 244-6478.

“Row-ga!” Fitness ─ 11am-12pm. A fusion of in-door rowing and yoga that strengthens the muscles of the body, improves cardiac function, flexibility and stamina through breathing, low intensity rowing and yoga postures. $10. Greenville Indoor Rowing, 576-A Woodruff Rd, Greenville. 281-1505.

Yang Tai Chi Forms ─ 11am-12pm. Tai chi builds muscle, enhances balance, mind-body connection, health, coordination, strength and reduces stress. First class free; 1, 4, 8, or 16-class passes $12-$120. Qi Works Studio, 404 N. Pleasantburg Dr, Greenville. Must pre-register, 420-9839.

Community Acupuncture ─ 12-9pm. Economical group opportunity to benefit from natural therapy. Plan at least 45 minutes for therapy. $45 initial, then $25. 3100 Grandview Dr, Simpsonville. 406-3800.

Essential Oils Classes ─ 12-1pm. New oils pre-sented each week. Free. Creative Health, 14 S. Main St, Greenville. Space is limited; must register, 233-4811.

Dynamic Vinyasa Flow Yoga Class ─ 12:15-1:15pm. Follow the breath through poses to increase flexibility, develop core strength, strengthen and tone muscles. It’s Yoga! Studio, 120 Halton Rd, Ste. 1, Greenville. 354-2882 or 908-0138.

Chair Yoga ─ 4-5pm. Yoga with a chair assist, great for seniors, post surgery and people with chronic pain/injury. $10. Integrative Yoga Therapy, 633 Saco Lowell Rd, Easley. 444-5523.

coming next month


Qigong ─ 5:30-6:30pm. Gentle exercise that heals the body, enhances balance, health, coordination, strength & reduces stress. Meditation forms includ-ed. First class free; 1, 4, 8, or 16-class passes $12-$120. Pre-registration required. Qi Works Studio, 404 N. Pleasantburg Dr, Greenville. 420-9839.

Birthing Class ─ 6-9pm. Birthing classes first 4 Tuesdays in September. Carolina Waterbirth/Doula Du Jour, 915 South St, Simpsonville. 735-7270.

Flying Rainbow Tai Chi Fan ─ 6:30-7:30pm. Basic tai chi & fan techniques. Enhance balance, health, coordination, strength and reduce stress. First class free; 1, 4, 8, or 16-class passes $12-$120. Pre-registration required. Qi Works Studio, 404 N. Pleasantburg Dr, Greenville. 420-9839.

Parent Talk at Brain Balance ─ 6:30-7:30pm. Learn about brain function and how to help a child struggling with ADHD, sensory issues, autism and learning differences. Free. Brain Balance, 2531 Woodruff Rd, Ste 113, Simpsonville. Space is limited, RSVP to 329-9933.

Dynamic Vinyasa Flow Yoga ─ 6:30-8pm. See Tuesday 9:15am listing for details.

Aerial/Swing Yoga Class ─ 7:30-8:45pm. Take your yoga off the ground and experience familiar poses in a new way. $18 per class. Integrative Yoga Therapy, 633 Saco Lowell Rd, Easley. 444-5523.

wednesdaySouthern Flow Hot Yoga ─ 6am, 10am, 12pm, 5pm and 7pm. See Sunday 9am listing for de-tails.Dynamic Vinyasa Flow Yoga Class ─ 8:30-9:30am. See Tuesday 12:15 listing for details. Tai Chi for Arthritis ─ 9:30-10:30am. See Mon-day 9:30am listing for details. Senior Day ─ 10am-6pm. Seniors 60+ receive 10% off total purchase. Normal exclusions ap-ply. The Wild Radish, 161 Verdin Rd, Greenville. 297-1105.All Levels Yoga ─ 11am. See Tuesday 11am list-ing for details.Oxy-Ionic Water Sampling ─ 11am-5pm. First Wednesday. Sample alkalizing Oxy-Ionic. Buy 1 gallon, get 2nd gallon 15% off. All Natural Health & Beauty Center, 101 College St, Simpsonville. 963-2882. “Row-ga!” Fitness ─ 11am-12pm. See Tuesday 11am listing for details.

All Levels Yoga ─ 6:30pm. A yoga routine of breath and postures. $15 per class. It’s Yoga! Studio Inc, 120 Halton Rd, Ste. 1, Greenville. 354-2882.

Dynamic Vinyasa Flow Yoga Class ─ 6:30-8pm. See Tuesday 12:15 listing for details.

thursdayAll Levels Yoganize® ─ 6am. See Monday 7pm listing for details.

All Levels Yoga ─ 9-10am. See Monday 8:30am listing for details.

Balanced Life Yoga ─ 9-10:30am. Increase bone density, flexibility and stamina through yoga. $7/class or $30 for 6 classes. St. Francis Millennium, Healthy Self, 2 Innovation Dr, Ste. 200, Greenville. 675-4656.

Advanced Beginner / Intermediate Vinyasa Flow ─ 9:15am. Yoga movement synchronized to the breath. $13. Yoga East, 2105 Old Spartanburg Rd, Greer. 244-6478.

Toning Class ─ 9:30-10:15am. See Tuesday 9:30am listing for details.

Senior Yoga ─ 10-11am. Gentle stretching and strengthening class for anyone 55+. $2 per class. Mauldin Senior Center, Corn Rd at 699 Butler Rd, Mauldin. 419-4204.

Yoga for Cancer Survivors – Beginners ─ 10:30 and 11:45am. See Tuesday 9am listing for details.

All Levels Yoga ─ 11am. Class for energizing, stretching and rejuvenating mind and body. $15 per class. It’s Yoga! Studio Inc, 120 Halton Rd, Ste. 1, Greenville. 354-2882.

Beginner Yoga Class ─ 11am–12:15pm. See Tues-day 11am listing for details.

“Row-ga!” Fitness ─ 11am-12pm. See Tuesday 11am listing for details.

Yang Tai Chi Forms ─ 11am-12pm. See Tuesday 11am listing for details.

Community Acupuncture ─ 12-9pm. See Tuesday 12pm listing for details.

Family Dinner Night ─ 4-8pm. One adult spends $5 in the café and up to six kids eat free. Kids fill out their own healthy menu. Earth Fare, 3620 Pelham Rd, Greenville. 527-4220.

Qigong ─ 5:30-6:30pm. See Tuesday 5:30pm list-ing for details.

Yoga for Every Body ─ 5:45-7pm. Yoga class that is welcoming to all body shapes, sizes and fitness levels. $10. Integrative Yoga Therapy, 633 Saco Lowell Rd, Easley. 444-5523.

All Levels Yoga ─ 6:30-8pm. See Monday 6:30pm listing for details. It’s Yoga! Studio Inc.

Parent Talk on Children’s Brain Function ─ 7-8:30pm. Discussion on brain function in children struggling with AD/HD, Autism/Aspergers, Sensory Integration Disorder, Dyslexia, learning disabilities and the Brain Balance Program. Free. Brain Bal-ance of Greenville, 2531 Woodruff Rd, Ste. 113, Simpsonville. 329-9933.

Aerial/Swing Yoga Class ─ 7:30-8:45pm. See Tuesday 7:30pm listing for details.

friday

Indoor Rowing Classes ─ 6am, 7:30am and 9:15am. Full-body and cardio workout; any age and fitness level. Rates vary. Greenville Indoor Rowing, 576-A Woodruff Rd, Greenville. 281-1505 or 901-3776.

Toning Class ─ 6:45-7:30am. See Monday 6:45am listing for details.

Tai Chi for Arthritis ─ 9:30-10:30am. See Monday 9:30am listing for details.

Vinyasa Flow Class ─ 11am. Energize, increase flexibility and stamina. $15. It’s Yoga! Studio Inc, 120 Halton Rd, Ste. 1, Greenville. 354-2882.

Yang Tai Chi Forms ─ 11am-12pm. See Tuesday 11am listing for details.

Restorative Yoga Class ─ 12:15pm. Perform gentle poses before dropping into deep content-ment from the sequence of supported postures. It’s Yoga! Studio Inc, 120 Halton Rd, Ste. 1, Greenville. 354-2882.

saturdayCommunity Acupuncture ─ 8:30am-12pm. See Tuesday 12pm listing for details.

“Full-on” Yoga ─ 10:45-12pm. Steady flow of Hatha/Kripalu inspired yoga - no rowing involved. $10/class; discount class packages available. Greenville Indoor Rowing, 576-A Woodruff Rd, Greenville. 281-1505.

New DayPhysical Therapy

Alternative & Conventional Therapies


communityresourceguideConnecting you to the leaders in natural healthcare and green living in our community. To find out how you can be included in the Community Resource Guide, email [email protected] to request our media kit.

indicates NAN (Natural Awakenings Network) Provider

AcuPuncture

ACUPUNCTURE OF GREERRuth Kyle, L.Ac.

106 Memorial Dr.864-877-0111•Greer

Great results with acute and chron-ic pain, migraines, frozen shoulder, sciatica, stress. Specializes in ortho-pedic issues and more in an educa-tional tranquil environment. See ad, page 27.

AFFORDABLE ACUPUNCTUREJoan Massey, L.Ac.

3100 Grandview Dr.864-406-3800•Simpsonville

We offer affordable community-style acupuncture. Individual private ses-sions also available. See ad, page 8.

GREENVILLE NATURAL HEALTH CENTERMarina Ponton, D.A.O.M., L.Ac.1901 Laurens Rd, Ste. E864-370-1140•GreenvilleGreenvilleNaturalHealth.com

Dr. Ponton specializes in tradi-tional Chinese medicine (TCM). She offers natural healing methods such as acupuncture, herbs, fertil-ity and pain management, auricu-lar therapy, gua sha, electrical stimulation, cupping and magnets to help you meet your health goals. See ad, page 18.

HONG ZHANG, L.AC.111 Doctors Dr.864-797-7100•GreenvilleGHS.org/Acupuncture

More than 23 years experience practicing acupuncture. Some con-ditions treated include joint pain, neck and/or back pain, fibromyalgia, stroke rehabilitation, infertility, and menstrual cramps.

SAM HWA DANG ACUPUNCTURE & HERBS CLINICHwang K. Lee, Ph.D., L.Ac.26 Orchard Park Dr.864-408-8270•Greenville

Korean Traditional Medicine helps to balance the energy flow in the entire body. We specialize in certain conditions, but have treated with success other health concerns such as allergy and skin, infertility, menopause, pain con-trol, cardiovascular, urinary, di-gestive and sleep disorders.

AllergY/nutrition

GREENVILLE FUNCTIONAL MEDICINE301 Halton Rd, Ste. A864-558-0200•GreenvilleGreenvilleFunctionalMedicine.com

Consider our gluten genetic testing and consultation to identify and heal allergy and autoimmune reactions that is making your life miserable. See ad, pages 2 and 3.

TRINITY ALLERGY RELIEF & WELLNESS CENTER

110 Montgomery Dr.864-760-1006•AndersonTrinityAllergyRelief.com

Guaranteed relief as sensitivities and intolerances are cleared from the body using a proven method known as BioEnergetic Intoler-ance Elimination (BIE) that liter-ally clears annoying symptoms within minutes. No needles. No pain. No drugs. See ad, page 49.

AnimAl reHAb

ANIMAL REHAB & CONDITIONING CENTERDr. Kennedy, DVM109 Monroe St.864-962-0101•SimpsonvilleAnimalRehabGreenville.com

Advanced training in pain management, canine rehabili-tation, and acupuncture. ARCC has hydrotherapy, pulsed sig-nal therapy, laser therapy along with a multitude of exercise equipment, including an un-derwater treadmill.

AromAtHerAPY

GARNER’S NATURAL LIFE27 S. Pleasantburg Dr.864-242-4856•GreenvilleGarnersNaturalLife.com

Improve your level of stress, depression and mood with natural products from a lo-cally-owned family busi-ness, supporting the com-munity for over 40 years. Our friendly and knowl-

edgeable staff will guide you through the use of aromatherapy for pain and anxiety reduction, en-ergy enhancement and much more. See ad, back cover.

GOOD TO GO5000 Old Spartanburg Rd.Beside Pivotal Fitness864-244-2733•TaylorsGoodToGoJuiceBar.com

Take i t a l l i n and enhance your wel lbe ing . We carry G2™ 100% pure therapeutic

essential oils in single and custom blends. See ad, page 39.

bio-energetic testing

AUGUSTA STREET CLINICDr. Roger Jaynes, DC, DNBHE

1521 Augusta St.864-232-0082•GreenvilleAugustaStClinic.com

Bio-energetic testing shows energy imbalance, vitamin or mineral de-ficiency, and identifies environ-mental allergies. We use German manufactured drainage remedies and offer services at affordable rates. See ad, page 47.

bio-identicAl Hormone tHerAPY

BALANCED SOLUTIONS420 The Parkway, Ste. JThe Village at Thornblade864-343-8352•GreerBalancedAgain.com

Don’t accept fatigue, weight gain, depression or low sex drive as NORMAL. Feel great again with Bio-identical Hor-mone Therapy. Complimentary Blood Analysis. ($250 value) Call today! See ad, page 16.

Write it on your heart that every day is the best

day in the year.~Ralph Waldo Emerson


Stop Itching Within Seconds!

Introducing DermaClear,TM the Amazing New Skin Repair Salve from

Natural AwakeningsOur all natural personal skin care product brings comforting relief to sufferers of many skin irritations. DermaClear has proven to be effective against:

• Shingles • Psoriasis • Eczema • Insect Bites• Allergic Rash • Jock Itch • Burns • and more

DermaClear will simply feel good putting it on. Cooling and soothing, the Calcium Montmorillonite/Calcium Bentonite clay penetrates pores and open areas of the skin and pulls out toxins and inflammation.

The proprietory blend of homeopathics go even deeper, address the root causes and assist to bring even deeper toxins to the surface.

Order Online Today atNAWebstore.com

or call 888-822-0246

4-oz jar-$29.99+ $5 shipping-up to 5 jars

Wholesale Pricing Available to Stores and Practitioners


Say “Goodbye” to fatigue, poor sleep, loss of sex drive, night sweats, poor memory, and depression. We are patient-specific, meaning each treatment is specifically designed for the individual. See ad, pages 2 and 3.

LIVING WELL INTEGRATIVEHEALTHCAREClif Caldwell, MDCheryl Middleton, PA-C838 Powdersville Rd, Ste. G864-850-9988•EasleyLivingWellHealthcare.com

We help women and men who suffer symptoms of hor-monal imbalance such as low libido, weight gain, hot flash-es, fatigue and many other symptoms. Call for your personal consult today! See ad, page 8.

boArding/kennel

MAUI MEOW RESORT FOR CATS158 New Harrison Bridge Rd.864-409-1011•SimpsonvilleMauiMeowResort.com

Exclusively for cats! Spacious 60x30 condos, quiet atmosphere, 14’x 21’ play area, panoramic views, and two kitty towers. Live-in owner; no extra fees for medi-cations.

brAin trAining

BEACON(Eastside Professional Court)4501 Old Spartanburg Rd, Ste. 7864-292-5154•GreenvilleBEACONslps.com

A HEALTHIER BRAIN & A HEALTHIER LIFE WITH

SENSORY LEARNINGGET STARTED ON OUR 30-DAY PROGRAM.

• ADD / ADHD / Focus & Memory Concerns• Autism / Asperger’s• Stroke / Parkinson’s / Alzheimer’s • Brain Injury• Sensory & Learning Concerns• Speech-Language Disorders• Stress / Emotional / Behavioral Concerns• Athletic Performance / Wellness

BEACONslps.com864.292.5154/BEACONslps™

SENSORY LEARNING CENTER™ & SPEECH-LANGUAGE PATHOLOGY

WE CAN HELP WITH:

30+ year private practice is cele-brating five years of our sensory learning program.

This intensive multi-sensory, foundational, non-cognitive approach has given hope to all ages with improvements in their quality of life. BEACON also offers Speech-Language Pathology, OT, and life coaching. See ad, page 5.

cHildbirtH services

CAROLINA WATERBIRTH915 South St.864-329-0010•SimpsonvilleCarolinaWaterBirth.com

Offering attentive, personal, one-on-one care for you and your family. Contracted with United Healthcare, Aetna, and most other health insurances. See ad, page 35.

DOULA DU JOUR915 South St.864-735-7270•SimpsonvilleCarolinaWaterbirth.com/DoulaDuJour.html

Doula Du Jour is your affordable on-call doula service for hospital, home and Carolina Waterbirth needs. See ad, page 35.




cHiroPrActor

AUGER FAMILY CHIROPRACTIC1315 Haywood Rd.864-322-2828•GreenvilleAugerChiro.com

It’s not normal to live with neck/back pain, headaches, IBS, aller-gies, ADHD, insomnia, and more. Chiropractic care will get you back to normal. Call us now! See ad, page 51.

ENHANCED LIVING CHIROPRACTICNina Kennedy, DC 140 Sage Creek Way864-848-0640•GreerEnhancedLivingChiro.com

We use a variety of unique treat-ments like Sacro-Occipital Tech-nique (www.SORSI.com) to bal-ance the body’s nervous system, exercise rehab to maintain that balance, and functional medicine to jump start sluggish systems. Free consultations and gentle care for your entire family.

FRANZ FAMILY SPINAL CARE 205 Bryce Ct.

(off Woodruff Rd in Woodruff Place)864-987-5995•SimpsonvilleFranzFamilySpinalCare.com

A health and wellness center focusing on providing the NUC-CA procedure for the whole family. Long-term relief with none of the cracking or popping; all adjustments done by hand. The only NUCCA practitioners in the Upstate. Also provides

whole food supplementation, nutritional testing, weight loss programs, and more. See ad, page 30.

SMALL SPINES PEDIATRIC CHIROPRACTIC996 Batesville Rd, #7864-558-0516•GreerSmallSpines.net

Does your child suffer from ADHD, allergies, asthma, ear infections, headaches, digestive troubles, or pain? We may be able to help! Call for a free consultation. See ad, page 20.

WICKISER FAMILY CHIROPRACTIC

122 E. Beltline Blvd.(Behind Grady’s Great Outdoors)864-226-8868•AndersonWickiserFamilyChiro.com

Focusing on quality chiropractic care for the entire family. We also provide nutritional counseling, muscle and soft tissue rehabilita-tion, and Exercise With Oxygen Therapy (EWOT). See ad, page 22.

coAcHing

INSIGHT TRANSFORMATION LIFE COACH TRAINING

Dianne Greyerbiehl and Certified Coaches25 Woods Lake Rd, Ste. 207864-282-8989•GreenvilleLifeCoachingInstitute.net

Coaching creates easy, positive, powerful change from the inside out using proven tools and meth-ods. Our certified life coaches help you dis-

cover the power to manage change in your life. See ad, page 33.


colon HYdrotHerAPY

BRIDGE TO WELLNESS, LLC 607 NE Main St.

864-963-4466•SimpsonvilleYourBridge2Wellness.com

Angela Toplovich, certified colon hydrotherapist offers detox ser-vices that include ionic footbath, thermotherapy (Bio Mat), and ear-candling. Lighten your toxic load! See ad, page 12.

INTERNAL FITNESS117 Fairview Pointe Dr.864-757-1269•SimpsonvilleInternal-Fitness.net

Phyllis is certified by I-ACT and has been assisting clients for over 9 yrs. The center uses the open system of colon hydrotherapy. Other services include ion foot detox, and infrared sauna. $55 colon cleanse with a 10-min.

body vibration session when you mention this ad. New clients only. See ad, page 24.

comPounding PHArmAcY

COMPOUNDING SOLUTIONS115 Pelham Rd, Ste. 12864-558-0507•GreenvilleMyCompoundingSolutions.com

The best medical solutions often arise from compounding. We specialize in building a relation-ship with you to provide the best possible solution for your indi-vidual needs. Bio-identical hor-mones and women’s health is our specialty.

CUSTOM-MED PHARMACYJohn Holland, Pharm.D.

838 Powdersville Rd, Ste. D864-855-2323•Easley

Specializing i n c u s t o m compound-ing, includ-ing thyroid

medication, bio-identical hormone replacement, pediatrics, and pets. Professional grade vitamin brands like Xymogen and Designs for Health also available. Serving the community since 2006. We are your problem-solving specialists. See ad, page 33.

SKRIP SHOPPEJim Greene, R. Ph.

406 W. Poinsett St.864-879-2325•GreerSkripShoppePharmacy.com

We compound (create) individu-alized medicines for your unique needs, perfectly suited to your body. We also offer natural medi-cines, vitamins and herbs. Local-ly owned and operated since 1982. Visit our website for a 10% off coupon. See ad, page 9.

concierge medicine

eDOCHOME864-406-2055Web-based BusinesseDocHome.com

Talk to a doctor without leav-ing home. eDocHome introduces TELEHEALTH. Access to qual-ity healthcare anytime, any-where. Speak with a doctor via online video or telephone. Get a

diagnosis and prescription if appropriate.




counseling services

BEYOND TALK THERAPY™520-320-6366•GreenvilleBeyondTalkTherapy.comSleepApneaSolution.org

In 3-4 sessions, Dr. Damaris Drewry helps clients resolve dif-ficult/long-standing symptoms of sleep apnea, depression, anxiety, emotional eating, repeating rela-tionship patterns, chemical sensi-tivities, allergies, asthma, frozen shoulder, adoption and other com-

plex issues. Ethical, innovative and solution-fo-cused alternatives to psychotherapy. Free 15-min-ute phone consultation. See ad, this page.

dentistrY

PALMETTO PERIODONTICSDr. William Bohlen1130 E. Butler Rd.864-987-9700•GreenvillePalmettoPerio.com

We can meet your total needs from treatment to recovery. We honestly and respectfully educate you, so that together, we can reach your optimal oral health. We offer exceptional service in a clean and modern facility. In our warm and calming environment, your comfort and care are our priority. See ad, page 6.

TRINITY DENTALDr. Robert A. Berkowitz1221 N. Fant St.864-224-4736•AndersonTrinityDentalCenter.com

Along with holistic dental practices, we also offer non-drug treatment for TMJ pain, ozone/oxygen therapies and a home sleep study to overcome sleep apnea. See ad, page 43.

eYe nutrition


A holistic vision program that suc-cessfully treats eye conditions in-cluding macular degeneration, cata-racts, glaucoma and more. This program is considered the standard in alternative therapies for the eye. See ad, pages 2 and 3.

Feng sHui/ interior redesign

FINE REDESIGNSMichele Senac, CFSP

Redesign/Feng Shui Certified864-631-9335FineRedesigns.com

Have a whole new look for your home or business using what you already own. Have a home or business that reflects who you re-ally are. Transform and love your space with Interior Redesign and Feng Shui. Experience a de-sign transformation that you can see and feel. See ad, page 19.

FunctionAl medicine


We identify the causes of disease rather than treating the symptoms and teach patients about the core principles of health maintenance and prevention. See ad, pages 2 and 3.



Dr Emu’s Rx for Pain, STOPS PAIN PLUS is known to clear brain fog, restore a positive mood, regenerate energy levels and increase circulation because it works faster, penetrates deeper and lasts longer than any other topical product or your money back!

STOPS PAIN PLUS has beenreported to give relief from:

• Diabetic Neuropathy Foot Pain• Arthritis Pain & Stiff Joints• Tired, Sore Muscles• Knee, Neck & Back Pain• Inflamation & Swelling

Enjoy a Comfortable,Pain-Free Winter

You’ve tried the rest, now try the best!

FREE 1-oz trial size included with each order to share with a friend or family member. SPECIAL SHIPPING - $5 for up to 8 bottles

FREETRIALSIZE

Shop online for this and other natural products at:

NAWebstore.comor call: 888-822-0246

4-oz Spray Bottle just $19.99

HAir sAlon/sPA

ALL NATURAL HEALTH & BEAUTY CENTERAlice Caston, Cosmetologist101 College St.864-963-2882•SimpsonvilleNaturalFarmacy.net

Over 20 years experience in li-censed cosmetology. We special-ize in multicultural hair care, color, facials and waxing services. We now offer a chemical-free hair straightening program. Free con-sultations.

NANCY LEE’S HAIR ARTNancy L. Minix, MC, BS, RA – 20+yrs Exp.

Operating in the Greer area864-320-2359•Greer

More than hair care. Natural/organic/ammonia-free color and products. Formaldehyde-free keratin treatments. Aromather-apy consultations and personal-ized products. ION footbath detox.

HeAltH Food stores

ALL NATURAL HEALTH & BEAUTY CENTER

Bobby Caston, Preventive Health Consultant101 College St.864-963-2882•SimpsonvilleNaturalFarmacy.net

We offer health/wellness programs and natural products that are effec-tive. We also carry many name-brand vitamins and supplements at affordable prices. Exclusively, we offer Oxy-Ionic Water, an alkaline ionized water that supports wellness in many specific ways. Free consul-tations. See ad, page 22.

EARTH FARE − THE HEALTHY SUPERMARKET3620 Pelham Rd.864-527-4220•GreenvilleEarthFare.com

Earth Fare offers a fantastic selection of products includ-ing local organic produce, naturally-

raised meats, seafood, supplements, natural beauty products, and an eat-in café, deli and juice bar. Check out our event calendar for upcoming happen-ings.

MARKET FOR LIFEMargaret Griffin2801 Wade Hampton Blvd, Ste. 15864-268-9255•Taylors

Natural foods, bulk foods/herbs, nutritional supple-ments, homeopathic reme-dies, books, health and beau-ty aids, pet supplies. We specialize in customer ser-vice! Special orders wel-come.

THE WILD RADISHJody Harris & Gigi Perry

161 Verdin Rd.864-297-1105•GreenvilleTheWildRadish.com

Vitamins and women’s products, raw goat’s milk, goat cheese, local, free-range eggs, Sami’s wheat/gluten-free products , Webb’s chicken sausages, local, grass-fed ground beef, and monthly healthy living classes. See ad, page 10.



WHOLE FOODS MARKET1140 Woodruff Rd.864-335-2300•GreenvilleWholeFoodsMarket.com/Stores/Greenville

Imagine a farmers mar-ket, fresh produce, meats, a fish market, a gourmet shop, a Euro-pean bakery, the corner grocery store, and eat-in café, all rolled into one.

Monthly calendar of events. We want to be your neighborhood supermarket.

mAssAge/bodYwork

GREENVILLE HOLISTIC MASSAGETetiana Moise, LMBT #7688, ES #736241312 E. Washington St.•GreenvilleGreenvilleHolisticMassages.com$50 for 60 minutes sport massage. Best massage ever for athletes. Improves muscles tone and flex-ibility, and work out soreness from the last trip to the gym.

GREENVILLE NATURAL HEALTH CENTERMassage Therapy1901 Laurens Rd, Ste. E864-370-1140•GreenvilleGreenvilleNaturalHealth.com

Suffer from pain? Mas-s a g e i s a proven treat-ment to help

reduce the effects of chronic pain, such as low-back pain. Enjoy a Swedish, deep tissue, hot stone, aro-matherapy, sports, prenatal or dry brush massage. New GNHC clients: Mention this ad, and your 1st massage is only $35! See ad, page 18.

RESTORATIVE & REHABILITATIVE MASSAGE106 Memorial Dr.864-634-3019•GreerJune Lordi, SC Lic.# 4599

Pain and stress reduction and injury rehabilitation. Improve circulation, flexibility, athletic performance and posture. 30+ years’ experience. Member of AMTA & NCTMB. Located within Acupuncture of Greer. See ad, page 27.

PHYsicAl tHerAPY

NEW DAY PHYSICAL THERAPYDavid Taylor, PT, CST, CMT300 N. Main St.864-469-9936•GreerNewDayPhysicalTherapy.com

Patients recover faster by uti-lizing a combination of con-ventional and alternative thera-pies. Alternative approaches include craniosacral, myofas-cial, vestibular and visceral Manipulation, drawing on the body’s self-healing properties. See ad, page 45.

rAdio

EARTH FM 103.3The Greatest Hits on Earth864-509-1280•Greenville1033EarthFM.com

Listen to Love & Hudson in the morning at Earth FM 103.3, The Greatest Hits on Earth. See ad, page 48.

reiki-HeAling toucH

OMA’S HEALING GARDEN WELLNESS CENTEROma Sims150 Milestone Way, Ste. A864-354-4505•GreenvilleOmasLifeEssentials.com

Oma is a renowned spiritual healer, intuitive and empath. She is a certi-fied Usui and Karuna Reiki Master, Life Coach, and Integrated Energy Therapy (I.E.T.) practitioner. Over 25 years’ experience. Classes avail-able. See ad, page 45.

sPirituAl center

UNITY CENTER OF CLEMSON/ANDERSON7538 Highway 76864-646-6114•PendletonUnityofClemsonAnderson.org

Unity is an inclusive, progressive spiritual community emphasizing personal growth and liv-ing consciously. We offer practical teachings that empower abundant and

meaningful living. See ad, page 32.

tAi cHi/Qigong

QI WORKS STUDIO, LLCDr. Mary Powers, Instructor404 N. Pleasantburg Dr.864-420-9839•GreenvilleQiWorksStudio.com

Rebuild your body’s balance, flexibility, strength, memory and health with Tai Chi and Qigong exercises. Classes in Qigong, Tai Chi 24, and arthritis. Natural self-healing exercises.

tHermogrAPHY

THERMAL IMAGING OF THE CAROLINASDr. Lealand FaganMichelle Fagan, CCT900 E. Rutherford St. 864-457-2045•Landrum

Thermography is an FDA ap-proved, non-invasive breast screening with no radiation and no breast compression! It can help to detect very early physiological changes in your body. See ad, page 9.


veterinArY cAre

ALL ABOUT PETSJeanne Fowler, DVM409 Old Buncombe Rd.864-834-7334•Travelers RestHolisticVetSC.com

Over 30 years’ experience offer-ing holistic and conventional veterinary medicine, acupunc-ture, homeopathy, Chinese herb-als, orthopedic manipulation, prolotherapy, laser and stem cell therapy and pet boarding, too.

vitAmins & suPPlements

BELL LIFESTYLE PRODUCTS800-333-7995BellLifestyle.com

Formulated natural health supple-ments intended for pain control, urinary health, preventive illness, virility, stress relief, weight con-trol and other common condi-tions. See ad, page 7.

healthbriefsglobalbriefsecotipsgreenlivinghealingwayshealthykids

consciouseatingwisewordsfitbodyinspirationnaturalpet

departmentsthemes

JANUARY health & wellness plus: health coaches

FEBRUARY rethinking heart health plus: stress relief

MARCH food & garden plus: gluten-free foods

APRIL green living plus: healthy home MAY women’s wellness plus: bodywork

JUNE inspired living plus: men’s wellness

JULY food watch plus: natural medicine cabinet

AUGUST transformative education plus: children’s health

SEPTEMBER conscious caretaking plus: yoga

OCTOBER sustainable communities plus: chiropractic and acupuncture

NOVEMBER personal empowerment plus: beauty

DECEMBER awakening humanity plus: holiday themes

GARNER’S NATURAL LIFE27 S. Pleasantburg Dr.864-242-4856•GreenvilleGarnersNaturalLife.com

We have all of the natural products that keep you and your family healthy all year long with a friendly, knowl-edgable staff. Check out our immune-boosting vitamins, pet products, our extensive

line of natural cosmetics, and much more. Open 7 days a week for your convenience. See ad, back cover.

wHole bodY vibrAtion

CIRCULATION NATION®864-593-8217•Greenville/Greer864-558-4750•SimpsonvilleCirculationNation.com

$49 /mo.

free trainingfree measurements free use of far-infrared saunafree alkaline water

No Contract • No Hidden Fees10% Senior/Student Discount

Become a Member!

Experience Whole Body Vibration!

Discover the vibration sensation that’s sweeping the nation!

10 Minutes = 1 Hour Workout

Decrease cellulite

Massage muscles

Increase muscle strength

Reduce effects of stress

Accelerate weight loss

Improve bone density

Increase metabolism

Prevent muscle loss

Improve circulation

Improve flexibility

Improve mobility

Improve agility

Tone and firm

Low impact

Kind to joints

Our members agree it can help:

get on • get active

PERFECT FOR ALL

AGES!

423 The Parkway @ Publix, Thornblade Center

864-593-8217greenvillesc.gogastudios.com

Goga Studios Greenville2801 Wade Hampton Blvd. #114@ Publix, Hampton Village Center

864-663-1845taylorssc.gogastudios.com

Goga Studios Taylors

Shake your way to better health. Low impact, kind to joints, suitable for all ages, including seniors. Hydrate, vibrate, reju-venate and try the easiest 10 minute workout you’ll ever do! See ad, page 29.

wHolistic wellness center

COMPLETE HEALING AND WELLNESSDrs. Marylouise and Jack Wise, DC24 E. Main St.864-847-6020•WilliamstonCompleteHealing.net

Find many treat-ments under one roof. We offer chiropractic care, family medicine, massage therapy, p h y s i o t h e r a p y,

cold laser therapy, HCG for weight loss and help with peripheral neuropathy. See ad, page 42.

SOLUTIONS IN HEALTH CAREJeanne Petan, Ph.D.290 Enoree Trail864-862-4113•Fountain Inn

Offering Live Blood Cell Micros-copy. This internal view is key to understanding your body’s strengths and weaknesses. You actually see your white blood cells working and will observe any toxic interference in your system like yeast, fungus, bacteria, and parasites. Live cell analysis creates an understanding of

what you need to do to restore your health! See ad, page 13.



A Few Drops Can Change Your Life!

A study in the American Journal of Clinical Nutrition found that iodine deficiency in the developed world has increased fourfold in the past 40

years and now affects nearly three-quarters of all adults. Taking the right kind of iodine in the right dosage can rebalance thyroid function and restore health to the thyroid and the whole body.

Natural Iodine SupplementationA Must for Most Americans

Natural Awakenings Detoxifed Iodine is 100 percent natural, raw iodine in an ethyl alcohol solution. We thank all those that are benefiting from this product and enthusiastically telling us their great results.

Available only at NAWebstore.com My wife, who suffered from extreme fatigue and other symptoms, saw a dramatic increase in energy after just a few days of taking the natural iodine drops. Now if she misses a day, she’ll end up falling asleep in the middle of the afternoon, like she used to do before taking the iodine. It works!

~ AaronMy doctor told me that I had a hypothyroid condition, prescribed medication and was happy with the follow-up test results, yet I noticed no positive effects on my overall well-being. Within two weeks of using the Natural Awakenings Detoxified Iodine, I had more energy, felt more awake and enjoyed clearer thinking and greater peace of mind. People even comment that I look younger. I am a fan!

~ Larry

4-6 week supply ONLY $19.99Order Online Today at

NAWebstore.comOr Call: 888-822-0246

* SPECIAL SHIPPING $5•up to 8 bottles

Wholesale Pricing Available to Stores and Practitioners

women’s HeAltH

BALANCED SOLUTIONS420 The Parkway, Ste. JThe Village at Thornblade864-343-8352•GreerBalancedAgain.com

Don’t accept fatigue, weight gain, depression or low sex drive as NORMAL. Feel great again with Bio-Identical Hormone Therapy. Complimentary Blood Analysis. ($250 value) Call today! See ad, page 16.


Say “Goodbye” to fatigue, poor sleep, loss of sex drive, night sweats, poor memory, and depression. We are patient-specific, meaning each treat-ment is specifically designed for the individual. See ad, pages 2 and 3.

Gestures, in love, are incomparably more attractive,

effective and valuable than words.

~ François Rabelais

YogA/PilAtes

INTEGRATIVE YOGA THERAPY633 Saco Lowell Rd.864-444-5523•EasleyLindaPattersonYoga.com

Small group classes and pri-vate yoga therapy sessions. We specialize in yoga therapy for depression, anxiety, chronic pain, fibromyalgia

and weight loss. Classes appropriate for all ages, body shapes and fitness levels. We also have aerial/swing yoga. See ad, page 52.

IT’S YOGA! STUDIO™ INC.Kristi Ried Barton, E-RYT, MAYT120 Halton Rd, Ste. 1864-354-2882•GreenvilleItsYogaStudio.com

Check our website for events, classes, retreats and workshops. Call for personal trainer ses-sions, therapeutic yoga, teacher training, life coaching and nutri-tion. Yoga Alliance School. See ad, page 33.


Share Your Vision And Make A Difference In Your CommunityPublish Your Own Natural Awakenings Magazine

• Meaningful New Career• Low Initial Investment• Proven Business System• Home Based Business• Exceptional Franchise

Support & Training

As a Natural Awakenings publisher, you can enjoy learning about healthy and joyous living while working from your home and earn a good income doing something you love!

No publishing experience is necessary. You’ll work for yourself but not by yourself. We offer a complete training and support system that allows you to successfully publish your own magazine.

To determine if owning a Natural Awakenings is right for you and your target community, call us at:

239-530-1377 or visitNaturalAwakeningsMag.com/mymagazine

Phenomenal MonthlyCirculation Growth Since 1994.

Natural Awakenings publishes in over 88 markets across the U.S.

and Puerto Rico.

• Birmingham,AL

• Huntsville,AL

• Mobile/Baldwin,AL*

• LittleRock/HotSpg.,AR*

• Phoenix,AZ

• Tucson,AZ

• EastBayArea,CA

• SanDiego,CA

• Denver/Boulder,CO

• FairfieldCounty,CT

• Hartford,CT

• NewHaven/Middlesex,CT

• Washington,DC

• Daytona/Volusia/Flagler,FL

• NWFLEmeraldCoast

• Ft.Lauderdale,FL

• Jacksonville/St.Augustine,FL

• Melbourne/Vero,FL

• Miami&theFloridaKeys*

• Naples/Ft.Myers,FL

• NorthCentralFL*

• Orlando,FL

• PalmBeach,FL

• PeaceRiver,FL

• Sarasota,FL

• Tampa/St.Pete.,FL

• FL’sTreasureCoast

• Atlanta,GA*

• ChicagoN.Shore,IL

• Indianapolis,IN

• Lafayette,LA

• NewOrleans,LA*

• Boston,MA

• Western,MA*

• AnnArbor,MI

• EastMichigan

• GrandRapids,MI

• WayneCounty,MI

• Minneapolis,MN

• Asheville,NC*

• Charlotte,NC

• LakeNorman,NC

• Triangle,NC

• Central,NJ

• HudsonCounty,NJ

• MercerCounty,NJ

• Monmouth/Ocean,NJ

• NorthNJ

• NorthCentralNJ

• SouthNJ*

• SantaFe/Abq.,NM

• LasVegas,NV

• Albany,NY

• CentralNY

• LongIsland,NY

• Manhattan,NY

• Rockland/Orange,NY

• Westchester/PutnamCo’s.,NY

• CentralOH

• Cincinnati,OH

• Toledo,OH

• OklahomaCity,OK

• Portland,OR*

• Bucks/MontgomeryCounties,PA

• Harrisburg/York,PA

• Lancaster,PA

• LehighValley,PA

• Pocono,PA/WarrenCo.,NJ

• RhodeIsland

• Charleston,SC

• Columbia,SC

• GrandStrand,SC*

• Greenville,SC

• Chattanooga,TN

• Knoxville,TN

• Memphis,TN

• Nashville,TN*

• Austin,TX

• Dallas,TX

• Dallas/FWMetroN

• Houston,TX*

• SanAntonio,TX

• Richmond,VA

• VA’sBlueRidge

• Seattle,WA

• Madison,WI

• Milwaukee,WI

• PuertoRico

*Existingmagazinesforsale

february 2014 greenville natural awakenings

Documents

upstate south carolina

natural health

natural awakenings publishing

healthy chocolatewhy

healthy restaurants

healthy lifestyle

special hearthealthy

n g h e