AgniYogaSociety,Inc.,NewYorkwww.agniyoga.org

©1933,1977byAgniYogaSociety.

Firsteditionpublished1933.Thirdedition1977.

ReprintedNovember2016.

SignsofAgniYogaMerging into the waves of the Infinite, we may be compared to

flowers torn away by a storm. How shall we find ourselvestransfiguredintheoceanoftheInfinite?

Itwouldbeunwisetosendoutaboatwithoutarudder.ButthePilot is predestined and the creation of the heart will not beprecipitated into the abyss. Like milestones on a luminous path,theBrothersofHumanity,everalert,arestandingonguard,readytoleadthetravelerintothechainofascent.

Hierarchyisnotcoercion,itisthelawoftheUniverse.Itisnotathreat, but the call of the heart and a fiery admonition directingtowardtheGeneralGood.

Thus,letuscognizetheHierarchyofLight.

How to transmute the most bitter into the most sweet? Naught

saveHierarchywilltransformlifeintoahigherconsciousness.It is impossible to imagine a bridge into the Infinite, because a

bridgeis inneedofabutments.ButHierarchy, liketheabutmentsofabridge,bringsonetotheshoreofLight.Andimaginetheentireeffulgencethattheeyesbehold!AndunderstandtheSongofLight.

LetuslaborforLightandHierarchy!

HIERARCHY1.Somuchhasbeensaidaboutdoctrines;yethumanitydoesnot

know how to accept the doctrine of the Brotherhood. How manydistortions have been accumulated about the Truth! How manyprinciples have been destroyed! They will ask, "On what is theStrongholdoftheBrotherhoodbuilt?"Answer,"Onthedoctrineoftheheart,thedoctrineoflabor,thedoctrineofbeauty,thedoctrineofevolution,thedoctrineoftension—themostvitaldoctrine."

We are Votaries of the Infinite. Where the all-encompassingstrivingcannotpenetrate,theBrothersofHumanitydonotaffirmtheir manifestation. We suffuse space with the flux of evolution.TheBrothersofHumanitywillinglyrenounceParanirvanafortheaffirmation of human evolution, in their desire to lay thefoundationforabetterstep.Thegoalisnotdivestedoflabor.Thegoalisnotdivestedofsacrifice.Thus,pointouttheclosenessofthemanifestationofMaitreya.

According to the prophecy of the most ancient Teachers, whenhumanity loses the foundation of the Teaching and sinks intoobscurity,theEpochofMaitreyawilltakeplace.

Our pillars of the foundation are sent to regenerate the spirit-understanding. Thus say to those who do not understand, thuspointoutthedoctrineoftheHeart!

2.WhenwepointedouttheurgencyofregeneratingOurDecrees

concerningtheequilibriumoftheOrigins,humanitydidnotacceptthis assertion and inaugurated transgression. Thus, one sidetransgressedagainstthecosmicbalance.

We know the tread of the Mother of the World. We know themanifestation of the Mother of the World. We intensify thecompleteflowoftheMagnettorestorethedoctrineoftheHeart.

IdesignatetheTaraasthesymboloftheassertionofOurDecree.Yes,yes,yes!TheTaraandtheArhatbringtohumanityaCovenantof utmost striving. Thus is the future built. Thus We affirm Ourstriving.Wondrousisthefuture!

3.TheheartofanArhatisliketheHeartofCosmos.Theheartofan Arhat is like the fire of the sun. Eternity and the motion ofCosmosfilltheheartoftheArhat.Maitreyaiscoming,radiantwithall fires. His Heart is aflame with compassion for destitutehumanity. His Heart is aflame with the affirmation of the newCovenants.

AmongpeoplethereexiststheconceptofbenumbedArhats;thepoor yogis feed the imaginations of men with their own images.But when humanity shall realize that the Arhat is the highestmanifestationofMateriaLucida,itwillunderstandthatthereisnodifference between Materia Lucida which emits Light, and theMatter of Love enveloping all with Light. Humanity invests theArhatwithanaustereimage,butMateriaLucidaradiatesLove.

The sublime is bestowed upon the sublime; and the sublimedwells in the sublime; and the sublime will hold sway in thedimensionsofthefar-offworlds.

4. Our Hierarchy lives and grows by the fiery law. We Arhats

rejoiceatthefireoflife,andevenmoreatthegrowthoftheflameof evolution. Future Arhats, completing their earthly accounts ontheplanet,areco-workerswithUs,theArhats.WhenHierarchyisenriched,thereisacosmicfestival.Thelawisoneandeternal.ThelawisconfirmedbyCosmos.

Weseetheradianceoftheworlds.Weseetheaccomplishedandendlessmarch.WeseetheradianceoftheMotheroftheWorld!Letusconcludeinthejoyoftheendlessmarch.

5.TheuniversalEyeofShambhalabringsBlisstomankind.The

universalEyeofShambhalaisaLightonthepathofmankind.Theuniversal Eye of Shambhala is that star which has guided allseekers.

For some, Shambhala is the Truth. For others, Shambhala is autopia. For some the Ruler of Shambhala is a venerable sage. Forothers, the Ruler of Shambhala is the manifestation of riches. Forsome, the Ruler of Shambhala is a bedecked idol. For others, theRuler of Shambhala is the Ruler of all Planetary Spirits. But Weshallsay,TheRulerofShambhalaisthefieryImpellerofLifeandoftheFireoftheMotheroftheWorld.HisBreathisablazewithflame

andHisHeartisaglowwiththefireoftheSilveryLotus.The Ruler of Shambhala lives and breathes in the Heart of the

Sun. The Ruler of Shambhala is the Invoker and the Invoked. TheRulerofShambhalaistheSenderoftheArrowandtheReceiverofallarrows.TheRulerofShambhalabreathestheTruthandaffirmsthe Truth. The Ruler of Shambhala is invincible, turningdestructionintoconstruction.TheRulerofShambhalaistheCrestof the Banner and the Summit of Life. Accept the Ruler ofShambhala as the manifestation of life; thrice I say—of life! ForShambhala is the guaranty of human aspirations. Ourmanifestation is guaranty of the perfecting of humanity. OurmanifestationistheaffirmedpathtotheInfinite.

6. All creation is contained in the call of the heart. The entire

cosmicexpanseispermeatedwithacall,andtheHeartofCosmosandtheheartofanArhatarepermeatedwiththecall.Thecallandtheanswercomprisethecombinationofthecosmicfires.Unionisverily the manifestation of our cycle. Many cycles are created bythecall,andthese,expandingintensely,embracedifferentspheres.Theaffirmationofcreationismanifestedasunion.

I,RulerofShambhalasay,"TheprincipleoflifeistheaffirmationoftheexpanseofcosmicenergyandthewayofcreativeFire!"

7. The Ruler of Shambhala reveals three Doctrines to humanity;

the Teaching manifested by Maitreya summons the human spirittoOurcreativeworld;theTeachingofMaitreyaordainstheinfiniteinCosmos,inlife,andintheattainmentsofthespirit;theTeachingof Maitreya guards the knowledge of the Cosmic Fire as theunfoldment of the heart that embraces the manifestation of theUniverse.

TheancientlegendthataffirmsthemanifestationofMaitreyaasa resurrection of the spirit is correct. We will add that theresurrection of the spirit as the conscious acceptance of theTeachingofLordMaitreyamaybeprecursortotheAdvent.Verily,theresurrection!

8.Maitreyawishestohastenall.Maitreyawishesthatallshould

be successfully accomplished. Maitreya wishes you joy. Maitreya

wishestogranttohumanityagiftthroughthefieryexperienceofAgni Yoga. Maitreya wishes to transform life on Earth in theradianceoftheMotheroftheWorld.Yes,yes,yes!Thebeautyoflifeislimitless!

AnArhatseeswiththeeyesoftheheart.AnArhatseeswiththeeyesoftheheartthebeautyofreality.AnArhatseeswiththeeyesof the heart, and the essence of the future calls Us. Verily is thatcreativenessaffirmedbyUs.

9. Ruleress, I pronounce Thee the great Co-worker of Cosmic

Reason. Ruleress, thou, beyond all cosmic powers, bearest withinthyself the sacred seed which provides radiant life. Ruleress,affirming all manifestations of the Great Reason, thou art thebestowerofjoyofcosmiccreativeness.TheRuleresswilladorntheaspiring realm with creative fire. Ruleress of thought, thou whoinvokest life, to Thee We make manifest the radiance of Our Ray.Mother, venerated of the Lords, We carry in Our Heart the fire ofThyLove.InThyHeartlivestheordainingRay.InThyHeartlifeisconceived, and We shall affirm the Ray of the Ruleress. Yes, yes,yes!

Thus the Cosmos lives in the greatness of the two Origins. Yes,yes,yes!ThustheCosmoscrownsthetwoOrigins.ThustheMotherof the World and the Lords build life. Yes, yes, yes! And inboundlessstrivingtheCosmicMagnetweldsitssacredparts.Thus,WeveneratetheRuleressbeyondallspheres.

10.VastisthefieldforthemanifestedapproachingTara.We,the

Arhats, ascending to the Fire of Space, prostrate Ourselves beforethe entire Fiery Bosom of the Mother of the World. The Bosom ofthe Mother of the World finds all reflections upon Earth. One ofthemthemostpowerfulandthemostintense,istheadventofthecomingTara.TheMotheroftheWorldcarriesvisiblyandinvisiblythe manifestation of those ineffable threads—the affirmation oftheworld'sthreads.

LetusfindthereflectionoftheCosmosinthegreatprincipleofconstruction and fusion. When the Brothers of Humanity feelsorrow over the Image in which they are held by the humanconsciousness, they can only say, "You are building your

hypotheses upon apparent phantoms. We are only phantoms forhumanity! When the spirit affirms Our Flaming Existence, then,insteadofphantoms,WeshallbecometheFieryWarriors."

11.TotheBrothersofHumanityisassignedtheconstructionof

thelifeoftheplanet;andtheymaintaintheCommandofthegreatMotheroftheWorld.Themusicofthespheresresoundswhenthecurrent of joy is in motion. The music of the spheres fills spacewhentheheartisstirredtotremorbythecosmicforce.TheHeartof Our Brotherhood safeguards for humanity the path to theGeneralGood.

12.HumanityhasneverdeliberateduponthelifeoftheArhat.It

is customary to think of an Arhat as a dweller of the clouds. Therecords of the drift of thought are dreadful and grotesque. Verily,WeBrothersofHumanitydonotrecognizeourselvesashumanityconceivesUs.TheimagesofUsaresofantasticthatWedeemthatif people applied their fantasies precisely conversely, Our Imageswouldassumetrueform.

The karmic tie apparently disappears when human thoughtpictures an Arhat. Everything takes on a new dimension.Everything becomes improbable. Everything becomesuncorrelated to reality. Let us say, in proceeding to the higherworlds, that an Arhat is limitless in all manifestations. Inascending,anArhatelevatesalongwithhimselfallthehighestandmostsubtleenergies.

We can show Our true Images only to near ones. We can sendOurRaysonlytonearones.Yes,yes,yes!

13. If it were possible to impart Our Image to humanity, the

striving toward knowledge would be established. Of course itwould be necessary to impart the Image over a span ofmillenniums. The "Book of Life" is beautiful in its completeaffirmation.Assuredly,whenitispossibletoimpartthecompletepictureoftheCosmicMagnet,thenthemanifestationofthebeautyofExistenceisaffirmed.

IfitwerepossibletoimparttheentirepictureofthewholepathofanArhat'scourseoflives,thenOurImagewouldtakeonitstrue

aspect.The"BookofOurLife"resoundsmightilyandcementsOurstep.

Each Lord has his keynote. The Epoch of Maitreya proclaimswoman. The manifestation of Maitreya is linked with theconfirmationoftheMotheroftheWorld,inthepast,present,andfuture.The"BookofLife"issobeautiful.

14. Much has been spoken about Man-God aspiring toward

deification. Many are the memorable records citing the Imagesstrivingtowardhigherworlds.Buthowdimlyaretheyformulatedin the human consciousness! Man-God is to man only one whodeparted to other worlds! But We Brothers of Humanity seek andproclaimMan-GodonEarth.WerevereallImages,butnonemorethat the great Image of Man-God, who bears in his heart the fullChalice, ready for flight, but bearing his full Chalice on Earth.Renouncing his destiny, he strains his fiery being. In thefulfillment of his destiny man confirms the Cosmic Magnet. Man-Godisafierycreator.Man-GodisthecarrierofthefierysignoftheNew Race. Man-God is aflame with all fires. Thus, inscribe in therecords about Man-God: Arhat, Agni Yogi, Tara—so shall Weinscribe.

15. Man-God advances as an evident aspiring Redeemer of

Humanity. We guard this sacred truth about Man-God. I affirmthat the Tara, carrying the flaming Chalice of aspirations for theredemption of humanity, can proclaim Our manifestation amongmen. The origin of the power of the Cosmic Magnet bestowsstriving toward the consummation. We Brothers of Humanitypoint out that the change will take place through the fieryprinciple.Verily,Ournewstepissobeautiful!ThecurrentsofthehigherspheresimpelthecurrentstowardtheconstructionofOurCosmic force. Great is the attraction! When striving hearts aspiretowardconsummation,theimpetuosityincreases,andthecurrentof oneness is affirmed by the tension of the Cosmic Magnet. Thustheunionresounds.

16. The prayer uttered by Christ when leaving Earth remained

unheeded by men. The prayer uttered by Buddha remained

unheeded by men. The prayer that Maitreya shall pronounceknockslikelightningatthegatesofthehumanspirit.ThusisEarthstratifiedandtheconsciousnessofthespiritcreated.

When the dates draw near, the work of creativeness may beenteredupon.ThecreativenessoftheOriginsmaintainsarhythm,neither retarding nor hastening. Parallel with the planetary lifeproceeds the construction for higher spheres. The sweep of theconstructiveness of the spirit completing its planetary life is socomplex that one may truly say there exists a two-foldconstructiveness, and the spirit is manifested as the guide of life.Onthelaststepthespiritcannotaffirmitselfintheexistingforms;for the striving toward new forms greatly suffuses theconsciousness and the spirit. The appearance of existing formscorrespondsverylittletothebeautyofthefuture.

I bear witness that there are many mysteries in the life of himwhoapproachesArhatship.

17. How little does humanity ponder over the idea of

responsibility, when the concept of Shambhala is regarded bypeopleasalandordainedforrest.Ifpeoplewouldonlyrealizethatthe Brothers of Humanity bear all the burden of man'sconsciousness! If people would realize that We carry theresponsibility for their schemes! If people would realize that, inessence, Shambhala is the Source which creates a new and betterstepforhumanity!

When I say that the suffusing of the earthly crust is Our task,manshouldunderstandthatOurplanetmustarouseitself.Cosmosawaits!

PeoplepleadforGood.TheCosmosaffirmshumanitynotasthemanifestationofonewhoreceives,butasareceivingcreator.Thusisthesteplaid,andthespiritofacreatorcanconstructpowerfullywhenthemightoftensionreachestothesummitsofCosmos.

18. The comprehension of Our Image by humanity is entirely

contrarytoreality.WhenOurImagesliveintheconsciousnessasThosewhoareresponsibleforhumanity,WecanacceptthisspiritasonewhounderstandsthetensedheartofanArhat.CertainlyWemust say that in Our creative work We are moved by the one

feelingoflaw.Buttheconceptionsoflawaresovaried!WhenWeBrothers of Humanity speak of law as the stimulus of Ourexistence, We definitely speak of the great law of the Magnet. InOurlawtheentirecosmiclife,premiseduponthegreatattraction,is transformed. The attraction has, in its striving, the greatestheart.Yourlawisbasedonhumancruelty;OurlawisbasedupontheHeartoftheMotheroftheWorld.

19. Upon this planet exists a manifestation closely approaching

the constructiveness on the far-off worlds. For millenniums Wehave been cultivating this manifestation. And thus are WeBrothersofHumanitystrivingtoOurpowersofHierarchy.Bythesame Magnet We are striving to the very Power which exalts Ourcreativeness. Wondrous is the predestination of Our existence!UpholdingtheChaliceofmanifestations,onecanbemanifestedasapower;bothhandsareoutstretchedtotheChalice.

20. One may understand that page of Our constructions as the

intensified Magnet. Humanity, in accepting the Magnet and itsintensified action, must also accept the ever increasing power ofthe Magnet as the evidence of the Lord's Hand. Of the act ofcreativeness,Imaysaythateachspiritcreatesindividually.Spirit-creativenessissopowerfulthat,evenwhenthememorydoesnotrecall itsactions, itcancreateanaffirmationofthemostdifficulttask.

21. We say "the arc of consciousness," because We term the

consciousness of an Arhat a complete circle. But there is a stillhigher step of cognition; We call it "full affirmation." The CosmicMagnet is Our Sacred Power. Boundless is the immensity of thisPower. If only the spirit would manifest understanding,fearlessness would suffuse all hearts, and the spheres wouldresoundwithrejoicing.

TheArhatproceeds,carryingthepoweroftheCosmicMagnetinhisheart!Cosmoscreates;itcreatesthebeautyofBe-ness.Icancallstrivingacosmicmagnet.

22. In the creativeness of an Arhat the heart manifests that

striving which is attested by the Cosmic Magnet through educingintensified combinations. The actual creative tension of thestrivingheartofanArhatissoaflamewiththeFireofSpace!

To bring about the advance of evolution, to bestow affirmedtruth and knowledge, and to link humanity with the currents ofevolution—this stimulus inspires each move of an Arhat. Thistension sets into motion all feelings and subtle energies. Thusproceeds the manifested Friend of humanity. These spatialstrivings are the foundations of Our cooperation. Similarlysustained are the centers of the fiery Agni Yogi as a friend ofhumanity.Yes,yes,yes!ThusWeservetheprogressofhumanity.

23. You heard correctly about sovereign power. Verily, the

Hierarch uses the power for cosmic progress. We Brothers ofHumanity possess this power of acting in step with the CosmicMagnet.Iattest,verily,thatWecreatebyastrainedheart.Thusletus understand unity. The cosmic creativeness also achieves inbeingstrainedbytheHeartofReason.Yes,yes,yes!ThislawistheattestationofReason.OnlythusdoesCosmoscreate.Yes,yes,yes!

To Thee, Mother of the World, the law of Existence is mademanifest. To Thee, Ruleress, We Brothers of Humanity payreverence. Thee, Thee, Thee! Thus the unified heart rules theUniverse.Yes,yes,yes!

24.Manismercilesstohimself.Bewailinghisfate,heforgetsthat

he inflicts upon himself a severe penalty. It is difficult for Us tomake people assimilate the thought of karma; but in a still moreintractablestateistheconsciousnessofamanheadedstraightforthe abyss. People prefer self-destruction and self-deception to theenlightenmentofconsciousness.

The quest for Shambhala varies widely in the spiritual domain.And is it possible that people believe they will attain theCommunityofShambhalathroughinvasionorthroughfasting?TohimwhoisawareofthepathtoUs,letussay,"Walkbythepathoflove. Walk by the path of labor. Walk by the path of the shield offaith!"TohimwhohasfoundOurImageinhisheart,Weshallsay,"WalkbythewayoftheheartandtheChalicewillaffirmthepath!"Tohimwho,throughconceit,thinkshehasattainedthepath,We

shallsay,"Goandlearnfromthespiritwhoknowsconsummation."The little girl carrying the heavy volume of the Bible in the

chambersofluxuryappearsasacreatorofanewworld.Thelittlegirl who perceived the Teacher of Light under the blue sky is thedestroyerofthedungeonsofdarkness.Whenthespiritofasmallgirl could feel the Brothers of Humanity, then the name of thisspirit is a light-bearing sword. When, since childhood, the spiritcould sense that the Brothers of Humanity regenerate that whichexists,thenthisspiritholdsthelight-bearingname.Wecherishthespiritualleadersamongchildren.

The evidence of enlightenment is the best gift to evolution. TheCommand of cosmic life is a summons to light-sustainingachievement,andthismissionisaffirmedonlybyLight.

25.Thestreamofkarmarusheslikeatorrent,andconsciousness

maytransformthistideintoarepeatedsacredunionofbeauty.Butthewayinwhichpeopleunderstandthekarmicstreamisattestedin human deeds. The evidence of the affirmation of karma and ofunionisattestedbyUsasthegreatestTruth.

26. The subtlety of Our Indications to humanity is not yet

comprehended.WhenwillitbepossibletoilluminemanwithOurImage?Thetendencyofthoughtcomprehendsonlywithdifficultythepurityofthehighersphere.SacredlyWeguardtheSacramentofLife.Thewheeloflifebreatheswithbeauty.Thewheeloflifeissuffused by the grandeur of Cosmos. The wheel of life is directedtoward the greatness of Materia Lucida. And equally light-sustaining are the rays of each manifestation of life that mergesinto the immensity of Cosmos. The sacred bonds of spirit arecomparabletothemostlight-sustainingrays.Theatomicenergyofkarma,consciouslywoven,comprisesthemostpowerfullever.

27. Verily, the tortuous line of the spirit retards its growth. A

spasmodic striving induces an explosion which rends space. Eachstriving wave leads to creativeness. Each descending actioninducesanexplosion.Themostawfulactionistherejectionofthegiven Decrees. On the way to the Brotherhood one mustunderstand that the highest Hierarch has his entrusted ones.

Therefore, none should deny that which is given through Ourentrusted ones, otherwise the higher steps will be inaccessible.ThereforeIwillrepeatthisuntiltheconsciousnessisimbuedwiththe greatest principle. Hence you, denying ones, guard thistreasurethatisgivenyouforascent!

28. Wondrous is the thought of a Brotherhood on Earth. Each

discipline of the spirit produces striving. Only the will can givediscipline to the spirit, but when thought roams about in obviousegoism, then, verily, there is no channel for a correct and vitalaction.Thus,eachappliedthoughtwillaffordgrowthtothespirit.Thus,eachappliedthoughtoftheTaraandtheGuruwillaffordanexpansionofconsciousness.Thus,onlytheChainofHierarchywillafford the possibility of ascent. Complete obedience leads to truecreativeness, for when obedience guides the action, powerincreases,andthepledgestrainsallforces.

29.HewhoadherestotheTeachingofInfinitygainsfreedomof

action first of all. He who fears to adhere to the Brotherhooddeprives himself of the Highest. He who dreads dogma canstrengthen himself in the Teaching as in flight to the far-offworlds. He who dreads such communion can remain at thethreshold. Incessancy of striving affords affirmation of OurTeaching.

The Arhats, who bestow on humanity the concept of the fullChalice,cannotdeprivehumanityoffreedom.NotinrenunciationorinseclusiondoestheBrotherhooddwell.Eachsparkthatkindlestheconsciousnessisrecorded;eachstrivingarrowisrecorded.Notabstraction, but fiery striving endures. Those who know theattainmentofcosmicstrivingsmayverilysay,"Wecreatewithfire.We strive with fire. We live in fire. Not miracles these, but thetransmutationoflifeintothegarmentofMateriaLucida."

HowdoestheBrotherhoodlive?HowdoestheBrotherhoodact?From Our Abode the threads of Our creativeness are stretched tothehearts,asinspirationstohumanity.

30.ThethoughtofobediencetoaTeacherisalientopeople.How

can a spirit be the loser when the Teacher is the leading Beacon?

How can the disciple lose his fire when the Teacher kindles allfires?HowcantheShieldoftheTeacherholdbackthediscipleifheis already inspired by the Teacher? Thus, in the consciousness ofhumanity dwells only a faint desire to strive for mutualcooperation.Buthumanitymustlearntoactindependentlyandtoembody all the thoughts affirmed by the Teacher. Thus CosmicMind achieves evolution. Thus humanity must learn to constructby a higher way. Verily, by emulating the Teacher you assimilatehisImage.

31.Therealizationofgoal-fitnessisatokenofcooperationwith

Us.HowelsecanonegainanunderstandingoftheMagnetssenttodifferentcountries?Howelsecanoneapproachthemanifestationof the magnetization of human consciousness, which in silenceattracts the eyes of an entire nation to itself? Thus one can tracehow Our commissioned Sisters and Brothers have attracted andrevolved around themselves the consciousness of entire nations.Butforthisonemustvigilantlyunderstandthevalueofeachstep.

32. How can we achieve a comprehension of the Magnet if we

doubttheIndicationsoftheLord?Howcanweconqueranenemyif we doubt the power granted to us? How can we expect to buildanythingstrongifwedonotaccepttheirrevocableIndicationsofHierarchy?

33. How to approach closer to the Source? How will a higher

understanding be affirmed? Only by the law of Hierarchy. TheGuiding Hand is the Uplifting Hand. The Indicating Hand is theHandrevealingthepathtotheHighestLaw.Verily,thusiscreatedthegreatstepofthelawofHierarchy!

34. Only matured spirits can burden themselves with the

knowledge of exact dates. It is impossible to imagine how manystringshavebeenbrokenbythepresumptionofdates.Theeffortsof even valiant spirits have often been impeded by the barrier ofdates.Itisusefultoknowthedirection,butalimiteddateimpedesthecosmicconstructiveness.HowcanonespeakofMagnetswheneachdatewilldividethethreadofaprogressivemovement?Only

vigilanceandgoal-fitnesswillleadwithoutwastingenergy.35.HowdomenunderstandthelawofHierarchy?Howdothey

fulfillallthelawsoflife?Howdotheyintensifyinthemselvesthebest strivings? Verily, the law of Hierarchy is understood as one'sownright;itisforgottenthataHierarchisalinkofachainandOnewhofulfillstheWillofaHigherOne.Onlythuscanonerespondtothe higher assignment. Only thus can one fulfill the trust andaccumulatethefiresintheChalice.

36. Thus the appointment of a Hierarch is the appointment of

OnewhofulfillstheHigherWill.Whenthespiritassignstohimselftheaffirmedright,hecanachieveonlythroughthefulfillmentoftheHigherCommand.

37. Remember the law of gravitation and counteraction.

Steadfastness issues from gravitation and tension fromcounteraction.GravitationalongthelineofHierarchyleadstoMe,and counteraction from the enemy to glorification. Thus, theTeacherandtheenemyarecornerstones.

Thetrainerofwildanimalsfirstexcitestheirrageinorderlaterto demonstrate their taming. No motion can take place withouttension;thereforeeachprogressiveTeachingisinneedofenemiesandofaTeacher.Onemustrememberthephysicallawinordertounderstandtheimmutabilityofthespirituallaw.Idirectthatthesignificance of the Teacher, and the need of enemies must beunderstood. Certainly, only the Teacher will lead the enemy tomadness.Thefullmeasureofevilmustbemanifestedinorderthatonemayriseregeneratedfromouttheflamesofwrath.Theknotsof the path cannot be avoided, but know that no tension willremainwithoutitsusefulness.Perhapsitwillserveentirenations!

Ifahermitisablewithhisthoughtalonetodestroyastrongholdof evil, then the tensity that was permitted by the Higher Forceswillbelikeabatteringramagainstthehostileforces.

38. Each growth of spirit requires burdening through

circumstances. There exists an ancient legend that out of humansufferings are created precious stones. Thus it is, and when I say,

"Burden Me," it does not mean that I bring a sacrifice, I am onlymultiplying the power of the spirit. Likewise, people must realizehowmuchcloserthelatestdiscoveriesbringthemtothesolutionof cosmic problems. For every call flashes throughout the worlds;and as the ordinary photographic apparatus can make a print oftheastralworld,soeverywaveofanycurrentcanunitethethreadsofthefar-offworlds.

It is time to understand the responsibility and the privilegeafforded by earthly incarnations. Yet people often avoid listeningtothewavesofspaceandcatchingtheechoesandanswerswhichcomefromvariousstrataoftheUniverse.Wearerepeatingaboutthe privileges of spiritual development, but the matter is sodistorted that a well-meaning denizen even fears to mentionanything that is linked with the radiant region of spirit. Try tospeakofthelightofrealizationandtheblissofspiritandyouwillbe feared like robbers and murderers. But even robbers weredisciplesofChristandBuddha;hencedonotfearhumanepithets,butharkentotheVoiceofEternity,whichleadstoBlissandLight.

Fearnot,fearnot,fearnot!39. The creativeness of Cosmos is always built through the

tensionofallenergies.Forallachievementsthequalityofenergiesshould be affirmed. Therefore, the higher the tension, the morepowerful is the manifestation of victory. Our creativeness issaturatedwiththequalityofpower.Therefore,havinggatheredallenergies, we can rely upon success. Only the quality of energiesgivestheneededstandardoflabor.Thereforeitissoimportanttohaveanexpandedconsciousnessandtoembraceallthatisneededforconstructiveness.

40. In fulfilling My Will, thou givest Me the possibility to fulfill

thy will. Where is the boundary line between the wills that strivetowardLight?OneshouldrememberthatWeleadthosewhohaveentrustedthemselvestoUsalongthewaysoftestedMagnets.Onemaytrustthehelmsmanwhohascrossedoceans."Crossthebridgeandtestthyself.ButMyStarhascognizedages."Letfearnottouchthetestedheart!

41.Thequalityofactionisaffirmedinstriving.Whenworldsaretransformed into action, the highest energy is affirmed. Hence,only in life can one manifest all the highest energies. Not words,but actions are considered as the affirmation of the highestenergies.Onlywhenthepotentialityofthespirit ismanifestedinaction is the higher concordance affirmed. Thus, a striving questgivesthekeytoInfinity.

42.ThereforeOurPlanissomighty.ThereforeOurMandateisso

powerful,becausewordsenterintolifeaswondrousaffirmations.Therefore Our Word lives, since the impulse of creativeness is sosaturatedbythemightofFire.OnlywhenOurMandateisadoptedinlife,canthehigherstepbeaffirmed.

Why,then,iseachofyourmissionssovital?Becauseitcarriesinitself the warrant of Our cooperation. Thus We affirm Hierarchyupon the law of succession. Therefore, when the Cosmic Law isrealized, the understanding of the Chain of Hierarchy isestablished. Thus, the best executor will be the closest to theHierarch. The Hierarchy of Service is but the fulfillment of theHigherWill.

43. Through what is the spirit transformed? Through the

creativenessoftheimpulse.Throughwhatdoesthespiritascend?By the creativeness of striving. How, then, shall the spirit not besaturated by fire, if only thus can one adhere to the CosmicMagnet?TheconsciousnessoftheHigherSpiritisfierilysaturated,thereforeonlytherealizationoftheHigherWillcanleadthespirittowarditsdestination.Thuseachconsciousmeasurelendsbeautyto action. Creativeness that adheres to the affirmed fire ismagnetizedconsciouslybyfulfillmentoftheHigherWill.

44.Therefore,eachthoughtfulfilledislikeadepositinthefiery

creativeness. Therefore, each fulfilled thought is linked with Ouractions. How carefully should the disciples define the quality oftheirthoughts!Wasnotthewormofselfhood,conceit,orself-lovehiddensomewhere?Honestyofavowalisaqualitythateachspiritmust develop within himself. Only thus can one fulfill the designof the Plan of the Lords. The manifestation of the Chain of

HierarchyisbuiltbythefulfillmentoftheHigherWill.45. The quality of thought is so powerful that the Fire of Space

responds to the tension of thought. The cosmic affirmation cantake place only when a corresponding harmony is established.Thuseachcorrespondencebringsitsconsequences.Thewarrantofthe broadening of consciousness lies in the development ofsensitiveness.Hence,thequalityofstrivingisthetruestindicatorofthegrowthofthespirit;andconsciousnessismanifestedastheaffirmedpowerofcreativeness.

46.Thus,thequalityofthoughtis intensifiedbytheimpulseof

search.Thecreativenessofspiritisintensifiedbythepoweroffire.Therefore, Our workers must realize the entire power of creativethought and kindle their fires. Thus, only the quality of thoughtcanbroadentheconsciousness.ThusletOurworkersremember.

47. One yogi won the reputation of being a practical joker,

because he would unnoticeably rearrange various objects inhomes, and when asked why, he answered, "I am observingwhether you have become blind." Verily there are few who noticechangesintheirsurroundings.Butthefirstsignofan"eagle-eye"isto notice the minutest changes, since on them depends thevibrationofthewhole.

48. Certainly the power of Hierarchy is the most vital, and only

bythisbridgecanonebuild.Thus,inthefoundationofeachgreatbeginningislaidtheenergyimbuedbythelawofHierarchy.Onlyupon the law of closest coalescence can one build. Only upon thebasis of the affirmation of the principle of Hierarchy can oneaffirm the highest possibility. The Creative Will proclaims that ablendedconsciousnessprovidesthesolutionofconcordance.

49.Attentivenesscanbetestedbyaverysimplemethod.Placean

objectinanewplace;ifitremainsunnoticed,enlargethesizeoftheobjectandobservewhatelephantfinallyattractsthe"sharp"eye.Ingeneral,testyourselfandothers.Applytestsforfear,forirritation,and for negligence, and in all cases where the litmus paper may

blush from shame. There is no need of complicated invocations,simpleattentivenesswillpermitonetoadvancemanysteps.Thusoneshouldbegintodevelopthe"eagle-eye."

50.Unitedsendingsbringmuchusefulnesswhenonetonecanbe

maintained, as in a musical key. One may even sound a leadingnotewithatuningfork.Amagnet,atuningfork,aring,andmanyothercommonadaptationseasilyenterintothedailylifeofyoungyogis.Theclearingawayofaccumulationsofdustrequiresashoveland broom. One should not avoid common objects—as above, sobelow! It is wise to become accustomed to there being no rest orend.ButasinglerealizationofOurBrotherhoodandofHierarchy,alreadydirectsthetraveleralongtheshortestpathtoInfinity.

51. The orbit that attracts conscious strivings will always bring

the spirit to Our Gates. The creativeness of spirit resoundsthroughout all space, and only acknowledgment of Higher Mightimbues the spirit with creative searching. Thus, each orbit thatattracts one to higher creativeness is imbued with all the highestenergies.OnlythepathofconsciousquestaffordsstrivingtowardOurOrbit.Thusonemayattaintheuppersteps.

52. Do not accustom the young ones to expect great

manifestations according to their human measure. Such anoutworn measure does not correspond to reality, for even in aphysical sense people have greatly distorted the concept ofimmensity. The mind cannot comprehend that only the resultdefines the true grandeur. Each action can be measured only inaccordancewithitsrelationtoHierarchyandInfinity.Thus,theseconcepts will be like signs leading to reality. Hence, teach theyoungonestothinkfirstofInfinity,remembering,moreover,thatno one should compare himself to a minute grain of sand as isusually the way of hypocrites. Our measure is guaranteed by animmense responsibility. We shall not err in measuring accordingtoresponsibility.

53. During the construction of the designated undertakings it

should be remembered that construction always progresses

onward. During a construction in the name of the Lord there isonly one way that brings us the Creative Source—the way of themightyHierarchy,thepathofthepowerfulguidanceoftheGreatService. Therefore, adhering to the creative principle impels thespirittotheaffirmedlawofHierarchy.Eachconstructionrequiresthe realization of upward striving. Hence, only the law ofobediencetoHierarchycangivealegitimatetensity.OnlythuscanonerealizethepathleadingtothemightyInfinity.

54. The legend about the giant supporting Earth is not a

superstition, but a memory of Him who assumed the burden ofresponsibilityforEarth.Thus,ineachactionthereisonewhohastakentheresponsibilityuponhisshoulders.Theoneincooperationwith others constitutes the balance. Like a spinning top, therhythm of motion should be kept; thus mechanics is transformedintoart.Thedisplayofsimpleattentiveness,whichWepointedoutfirstinlegendsandsymbols,InowordaininasimpleCommand—merelyopenyoureyes,becausetherearemanysignsaround.

55. The filling of the Chalice determines the quality of action.

Each thought leading to the mighty understanding of Hierarchyuplifts the spirit. Therefore, as striving grows, the broadening ofconsciousnessleadsthespirittotheunderstandingoftheOrigins.Creativeness of the spirit can build a bridge to higherunderstanding only through the subtlest energies. Therefore, theaccumulation in the Chalice gives the best possibilities andattainments. Man must strive to fill the Chalice and expand theconsciousness.Thus,thesubtlestenergiesarewithinreachofonlythe subtlest receptivity, and limitless striving opens the Gates toBeauty.

56.Certainly,whenthespiritisaccustomedtorespondinService

in conformity with higher predestinations, the link of the spiritwiththeHigherWillisestablished.Hence,oneshouldapplyone'sstrivingtoperceptionoftheHigherWill.OnlythuscanaHierarchserve Our task. Verily adoption and fulfillment are the valor of aHierarch. Therefore, I affirm that the power of creativeness is inthe blending of consciousnesses. Thus We create the predestined

future.Iaffirmit!57. Mean thoughts have been compared to crawling reptiles.

Nothingismoreanalogoustothisscumoftheconsciousness.Canone sit calmly in an armchair, knowing that beneath him crawlpoisonous snakes and scorpions? One must free oneself fromreptiles,andprimarilyonthepathtoHierarchy.Condemnationofand blasphemy against the Lord are irreparable. Thus, each onewho condemns the Hierarch must remember that his levity andcrime will infect his karma for many ages. Verily, if there is onlyone way—through the Lord—to the one Light, then only extremeignorance will allow destruction of this single path. One mustassert striving to the Highest as the essence of life and assume areverent attitude toward this salutary striving. By belittling theHierarch one may condemn oneself and inflict perilous harm onmanynearones.Itistimetorememberthis!

58. When space is being clouded by the mist of non-

understanding,thenitiscertainlydifficultforthecreativeraystopenetrate.Eachlayerispermeatedinconformitywiththecomplexof its striving. Therefore, the earthly layers are so impenetrable.Hence, all quests of the spirit must proceed in a tense tempo. ThequestsofthespiritmustattractittotheMagnetofHierarchy,sinceeach power has its correspondence upon Earth. Thus the law ofHierarchymustbeappliedvitally.

59.SomepeoplepouradailygruelovertheImageoftheTeacher

and imagine themselves to be in the Great Service. The TeachingandServicepresupposefirstofalltheexpansionofconsciousnesson the basis of adherence to the Teaching and reverence for theTeacher. In studying Infinity one should first of all realize thelimitlessnessofloveanddevotion.Itisnotwisetosaythatlovehasoverflowed and devotion has withered, because the consequencewillbethedisintegrationofone'sself.OneshouldunderstandthelimitlessnessofloveanddevotionasthefirststepstowardServiceand Yoga. One should set oneself this task, at least as a means ofone'sownprogress.OneshouldadvanceonlyinthedirectionoftheTeacher. Then, only, does relief come. But making a daily onion

gruel out of the Teacher will not lead to success. Sacredly,limitlessly,letussustainourloveandreverencefortheTeacher,asahealingmeansofregeneration.

60.Theprayeroftheheartistheexpressionofloveanddevotion.

Let us fill our vessel of experiences, because inevitably we mustcome to it. Let us not waste precious time in demeaning and indissolution. Each dissolution evokes unbridled elements, in otherwords, it opposes the manifested Cosmos. The growth ofconsciousnessisverilyOurfestival.

61. When thought comprises striving toward the fulfillment of

theHigherWill,adirectconnectionwiththeShieldoftheHigherWill is established. Can one reach an understanding of Cosmoswithout striving to penetrate into the Higher Spheres? Onlysuccessiongivesfoundationtoallstrivings.Allthatexistsproceedsby the law of succession. Hence, each isolation results only in thelossofthepredestined.Thus,thoughtisgeneratedasthecarrierofthe law of succession. Thus the law of the Higher Will createslimitlessly.

62. In all religions the one departing from Earth has been

accorded an accompanying Intercessor in the aspect of a saint,angel, or departed relative. Thus was affirmed the existence of aworld beyond the grave and the need of a Guide. One shouldbecomeaccustomedtothisthoughtoftheneedofaGuide.ThusinallreligionstheGuideandtheTeacherwereaffirmed.HencewhenWe speak of the Teacher, We remind of that which is inevitable.The Teaching can live, or turn into the embrace of death. But it iseasytoenhancelifebyturningtoLight.

63.Theassertionofacorrectdecisionisthepropertyofpsychic

energy. Then how greatly must men develop this property inthemselves! Without this property one cannot assimilate the FireofSpace.Withouthispropertyonecannotreceivethepreordainedtreasure. Only contact with the Higher can give the direction;thereforeitisnecessarytostrivetoanunderstandingoftheHigherPrinciple.OnlythusshallweapproachthelawofHierarchy.

64. Only the reflex of the reflexes of psychic energy can be

perceived through physical sensations. The same may be said ofsubtle energies and the remote bodies of Cosmos. But that shouldnot discourage researches, because by the shadow and the sourceoflightonecandefinetheheightofanobject.AllWesternmethodsofascertainmentcanalsobeapplied,forIdonotseeanydifferencebetween the West and the East when we are at the summits ofresearch. It is necessary by every means to dissolve all theconventional divisions of ignorance. Let us not be afraid toinvestigatebyallmethods—onlylearntoknow!

65.Thequalitiesofactionstestifytothedecisivenessofstriving.

Eachactionisimbuedwithitsownessence.Theimpulseofmotioncompels one to ascertain the impetus of an achievement. Thequality of the action determines the quality of affirmation. Thenhow must the spirit strive to the refinement of the essence andquality of action! The entire pledge of creativeness and thedirectionofactionarecontainedinthetrendofthought.ThereforetheapproachtotheChainofHierarchydirectsthespirittowardthetruth of creativeness. Thus one should seek to fulfill the HigherWill.

66.Humanity'salienationfromtheunderstandingoffulfillment

of the Higher Will has placed humanity in a position that hassegregated it. Therefore Our disciples have to apply their wholestrengthforfulfillment,inordernottoisolatethemselves.HenceitissoimportanttounderstandthelawofHierarchy.

67.Youcanperformoneofthemostusefulpsychicexperiments.

IfyouacceptallOurCounselsanditseemstoyouthatsomethingindicated was not fulfilled or was not transmitted in accordancewithyourexpectations,thenimmediatelystudytheCounselitself,applying the words in accordance with the customary humanunderstanding; then recall all the circumstances that have takenplace and consider all your own thoughts, worries, irritation, andall accompanying hazards and blunders. It is very significant toobservetheeventsthathaveinfluenceoverthecosmicwaves.One

may see that however ponderous is our human burden, it cannotbecomparedtotheminutestthought.Inthiswayyoucanobserveto what degree the psychic sphere has its own laws, beyond ourthreedimensions.

Beginning with such observations, one can arrive at valuableconclusionswhich,whenaccumulated,willbringgreatbenefitstohumanity. Because the time has now arrived for especially keenapplicationofthepsychiclaws.Itistimetogatherintothechaliceof patience all the designs and to remember that each fluctuationofclimateandatmosphericpressuresalsoexertsitsdeepinfluenceupon the psychic laws. Let us apply the most precise scale forweighingourthoughts,andletusrememberthateachoxidizationof metals exerts influence upon the character and quality ofthoughts. Smoke, and also the odor of burning refuse or meat, isalwaysharmful.Letusnotforgetthatdust,likeparticlesofdecay,penetratestheporesofthebody.Letuscalmlydiscriminateinallthedetailsoflife,notforself-vindication,butfortheinvestigationofournatureandacceptanceofthemeasuresofperfection.

68.Onemoresignificantexperiment:Accustomyourselvestosee

withoutlookingandtohearwithoutlistening.Thatis,youmustbeabletoaimyourvisionintothespiritualrealmstoadegreethat,inspiteofopeneyes,youwillnotseethatwhichisbeforeyou,andinspite of open ears, you will not hear evident noise. Through suchphysical tests one can greatly progress in psychic vision andhearing. For this, it is useful to hold constantly in imaginationbeforeoneself the Imageof the Teacheras thatwhich is themostprecioustobindyouwiththeSupreme.

Now, imagine for a moment that you have succeeded, with thehelp of chemical reactions, in creating a complete microcosm; forthismicrocosmyouarethecreator!ThenwhyisitsodifficultforpeopletoimagineanendlesschainofCreatorsfromthelowesttotheHighest,uptotheInaccessible?

Therefore, in speaking of the Infinite, we will not imagine it assomething void or measureless, but as something integral in itsincessant ascent. And is not the entire Infinite expressed in yourconsciousness, for where are the measure and boundaries of yourconsciousness?Thus,fromthesmallesttotheGreatest,proceedby

steps, each link being visible and tangible. There the indicatedexperiment will serve you in seeing through the physical,impenetrable forms which stand before you. From the evidentproceedtotherealitythatwillenrichyourpath.

69. Another useful exercise: Try to write different things with

both hands at the same time. Or try to dictate two letters orconducttwoconversationsatthesametime.Trytodriveamotorcarandcarryonaconversationaboutcomplicatedproblemsatthesametime.Trytorefrainfromquarrelswhenthechangeablemoodofyourcompanioninvitesyourirritation.Trynumerousexamplesofdividingyourconsciousness.Trytopouryourenergyinseveraldirectionswithoutlosingitsvalueorweakeningitsflow.

A one-sided effort is related to Kali Yuga. But the streams of allenergies,likeasalutarycurrent,willenrichthediscoveriesofSatyaYuga. In past centuries we have had examples of the successfuldivisionofconsciousness.ButnowweshouldespeciallyaffirmtheactionofallchannelsofBrahmavidya..

Payattentiontotheflowofthoughtsandaffirmtherightwavesofrhythm.Peopleshouldnotbecomelikeanimals,whocanthinkonlyinonedirectionatatime.TheSonsofLightandFlameshouldsparkleinfullfreedomandkindlethefiresofspace.Verilythetimecomesforthekindlingofthefiresofspace,inotherwords,fortheirmanifestation even in the nearest physical sphere. It is a difficulttime when fires can flash out and, if undisciplined, can burn andannihilate.

Accepttheseremindersasthelessonoftheday.Donotconsiderthat in heaven there are different laws and that we are stillpreserved through ignorance of lower matter. Indeed not. Youknow,andyouwillbegintoapplyallcounsels.

70. Aerolites are not sufficiently studied, and still less attention

isaccordedtothecosmicdustupontheeternalsnowsandglaciers.However,theCosmicOceandesignsitsrhythmonthesummits.IfwebegintothinkofInfinity,weshouldpayattentionprimarilytoallthatcomesfrombeyondandlinksusmateriallywiththefar-offworlds.How,then,canoneventureuponadistantvoyagewithoutpaying attention to the guests from afar? Also, symptoms of life

upon the eternal snows should be compared with those upon theplains.Perhapstheexcessivegrowthofcertainglandsiscausedbytheuseofwaterfromthesnows,whichcausesadisorderresultingfrom the action of the particles of cosmic dust. So many usefulobservations are diffused around us, one must only stretch outone'shand!

Youhavealsocorrectlyremarkedthatthemajorityoftubercularcasesarenothingelsebutthekindlingofthecentersofthelungs.Certainly the fires that have been stored up by karma, but notrealizedorapplied,maybecomedestructive.

71. One may prosecute ignorance, but one should especially

chastise superstition and hypocrisy. Like a leprous film,superstition covers weak brains. We are not against laboratoriesandWesternmethods,butWeaskthathonesty,efficiency,andthecourage of impartiality be added to them. How can one think ofcooperation when birdlike brains impede each experiment? Onecanproducethemoststupendousmanifestationifthehornsofthedevildonotimpedeinthetesttube.Peoplebelievemoreindevilsthaninsaints!

72. Each striving is saturated with the fire of spirit. The

creativenessofthespirittakespartinthefieryconstructivenessofthe Cosmos. How can one be isolated from the entire cosmiccreativenesswhenmanisthecreativefulfilleroftheCosmicWill!One should therefore develop in oneself consonance with theHigher Forces, for without striving to consonance there is nocreativeness. Thus, humanity must be affirmed in theunderstandingoftheHigherForcesandadheretotheHigherWill.

73. Certainly one can attain only through adherence to

Hierarchy. Only the understanding of the great law will open theeyes of humanity. How, then, not to penetrate into the might ofconstructiveness? Therefore, Our disciples must be imbued withan understanding of the affirmation of Hierarchy. Therefore, onecan build only when Our Carriers of Fire carry Our Will and thedisciples accept that which is sent. Each builder knows the law ofHierarchy.

74. Upon investigation, the quality of thought belongs to the

category of subtlest energies. It is impossible to measure thefluctuation of thought, therefore We have established theprobation of disciples by the refinement of thought. Every threeyears We give the disciple the possibility of expressing himself inregardtothesameevent.Onlyaccordingtothesedatescanoneseethe fluctuation of selfhood, cooperation, patience, and devotion.Similar experiments can be applied to other manifestations ofenergies;themoresosincepeoplehavecompletelyforgottenaboutprobations. One can also test oneself, directing one's attention toold objects and observing the reaction of the influence ofremembrance. Likewise one can test oneself upon flowers, music,upon a book read long ago. One can scientifically observe theinfluenceofsurroundingsuponanobjectlongsincefamiliar.Howmany steps could be counted forward or backward! Besides, onecanponderwhyastepcrossedforthesecondtimeisalwaysmuchmoredifficult.

75. Certainly, an experiment upon oneself is always useful

because it reminds one of probation. Probation is the sign ofcreativeness. One must get accustomed to the thought that mencreateunceasingly.Witheachglance,witheachbreath,witheachmotiontheychangethecourseofthecosmicwaves.Sincethereisnovacuum,how,then,aretheworldslinked?Thecellsoflifegrowliketheleavesofatree.Butweforgetthatthemoldofeachofourmotionsremains.HowbeautifulitmustbeinordertobeworthyoftheGreatBuilder!

76. Cosmic creativeness is based upon conformity. Without the

law of conformity it is impossible to affirm creativeness and thedevelopmentoffieryreceptivity.Henceitissoimportanttoapplythis essential law to life. Verily, without the power of conformityandfieryreceptivityitisimpossibletobringaboutthepredestined.

77.Eachsteprequiresnewcircumstances.Eachnewstepbrings

its affirmed power. Therefore in the midst of the difficult time amightystepinconformitywiththedifficultiesisbeinglaid.Hence

thecreativeactivityofOurco-workerswillbringthemanifestationofsuccesswhenthoughtsshallbeaffirmeduponthemightofthefuture.ThusWebuildawondrousstep!ThusWebuildamidstthedissolution of the countries! Thus Our Power enters into life! Themanifestation of a new step is so close, but the world decides itsfate.

78.Nothingisneglectedintheworld.Sometimeswemeasureby

great scales, but often experiments with small units should beperformed.Thetrendofthoughtshouldlikewisebeobserved.Thegiantsofthoughtareasinstructiveasthesmallleeches.Onemayseesomeonewhohasovercomeatremendousobstaclestumblingover an insignificant puddle. Rancor, offense, thought of selfdestroy the possibilities just as do treason and fear. One mustdiscriminate the circumstances; where is the new touchstone?Thus, with sharp-sightedness we reach the realization of joy foreach probation. We shall say, "Lord, send Thy Will—give or take.Together with Thee, we shall examine my pitfalls. Together weshall deliberate my decisions of yesterday. Today I am satisfied,and Thou, better than I, knowest the quantity of nurture neededforthemorrow.IshallnottransgressThyWill,becauseonlyfromThyHandcanIreceive."Thus,onemustwatchoneselfinthegreatandinthesmall.

79.Alreadyyouknowhowtenseisthetime;andtothosewhoare

seizedwithfear,saythatwhentheLordliveswithintheheart,nohairwillfallfromone'shead,andtoeachoneapalaceforbodyandspirit is allotted. But preserve your heart in purity, in order that Imay enter there and surround you with armor. Remember that ifyougiveinspirittotheLordwhathasbeentakenfromyou,Hewillreward you a hundredfold. Thus, direct your thought to the Lordand let the Lord enter your heart. Without the Lord it will benarrow in the empty heart, and, like peas in a dried sheepskin,wrathwilljarwithintheemptyheart.FillyourheartwiththeLordsofullythatnoenemycanforcehiswaythrough.Peaceuntoyou.

80. The attraction of corresponding forces is saturated with

strivingwhichunitestheforces.Theaffirmationofallshiftingsis

intensified by energies which function according to the law ofcorrespondence.Thereforeeachcreativeforceissubjecttothislaw.Cosmiccreativenessdependsonthesecorrespondences.HenceWeintensify all forces and affirm the highest correspondence. ThustheChainofHierarchybuildslawfullythestepsofcorrespondence,and each striving is saturated with a subtle response. Onlyconcordancecanaffirmalimitlesscreativeness.

81. It will be asked, How must we direct our prayers to the

HighestOne if theImage of theLord is constantlybefore us?Say,Precisely through Him address yourself to the Highest One.Besides,ifyouhavereachedthestateofkeepingaconstantImageof the Lord before you, this question cannot disquiet you at all.Whenwereachaconsciouscommunionwiththesubtlestenergies,muchofthatwhichdidnotfinditsplaceyesterdaybecomesfullycomprehensible today. Thus we learn to rejoice and to be calm,where yesterday we sorrowed. It is useful to observe how ourconsciousness is purified through everyday labor. Now especiallythe tempering of these swords is timely, because the air is filledwith fire. Only the Image of the Lord can rotate all centers andserve as a Shield. Let us not be afraid to repeat about swords andshields,becauseWedesirepeaceandthereignofspirit.Asvictorsceasetoremembertheirenemies,soWedonotcountthem;andaforestwillnotsufficetolikenthemtotrees.

82. The Sons of Reason—We proclaim them as Hierarchs upon

Earth. The Daughters of Reason—thus, also, We proclaim themupon Earth. Those who strive to the evolution of the spirit mustfollow in the steps of Hierarchy in order to progress. Who, then,willnurturethespiritofstrivingdisciples?Who,then,willaffirmthe path of ascent? Only the Daughters and Sons of Reason. Inwhomarecontainedthefiresofattainment?IntheDaughtersandSons of Reason. Thus We proclaim Our Carriers of Fire. Eachrealization of Our Will proceeds, revealing the fiery law ofHierarchy. Only the conscious adoption in life of the law ofHierarchy affirms the right path. Verily, space resounds with theaffirmation of Hierarchy. Thus the wondrous life is being built.Thus the predestined enters into life. The Sons of Reason, the

DaughtersofLightcanmakemanifestthepowerofthehigherlawsonly by obedience to the Hierarchy. Thus Our Hierarchs manifestOurPowerofReasonandHeart—thusuntoInfinity.

83. Thus the Higher Reason creates upon Earth through the

power of Hierarchy. Our creativeness requires the affirmation ofHierarchy in its entire scope, in its entire understanding, in itsentire beauty. The understanding of Hierarchy reveals allpossibilities. It is correct to view the law of Hierarchy as thesummit of cosmic creativeness. Light pours from it, thoughtsstrivetoit;thusoneshoulddirectthebeststrivingstotheSummitof Hierarchy. Only when the highest affirmation entersconsciously into life, can the highest be given. The fierymanifestationapproaches!

84.HowtoaffirmoneselfintheTeaching?Howtoapproachthe

higherlawofHierarchy?Onlythroughrefinementofthoughtsandexpansionofconsciousness.HowcanoneassimilatetheCommandfrom Above if there is no affirmation of correspondence? Oneshould display receptivity to each energy. One should be able toadopt the vastness of the Teaching. Only correspondence canpermitthesaturationofthevessel.Therefore,themanifestationofbreadthisworthyofabroadconsciousness.OnthewaytoUsonemayattainonlythroughHierarchy.

85. All religions have introduced special movements and

positionsofthebodythataidtheaccumulationoftheenergyandimpelonetotheHighest.WhenfollowingUs,achievementmaybearrivedatthroughthesaturationofone'sheart,withoutfatiguingmovements. He who succeeds through this means has anadvantage, because the source of the heart is inexhaustible. TheImage of the Lord, impressed upon the heart, will not grow dimandatanyhourwillbereadytohelp.Thiswayoftheheartisthemost ancient, but it requires a considerable expansion ofconsciousness. One should not speak of the heart from the veryfirstconversation,forthenonemayover-burdenitaimlessly.Itislikewise aimless to speak of love if the heart does not yet containtheImageoftheLord.Butthehourstrikeswhenonemustindicate

thepoweroftheheart.Iadviseaddressingoneselftotheheart,notonlybecausetheImageoftheLordisalreadyclosebutforcosmicreasons. It is easier to cross an abyss if the link with the Lord isstrong.

86.Thus,itisnoteasytobewithouttheLord.RepeattheName

oftheLordnotonlywiththelipsbutrotateitinyourheart,andHewill not leave it—like a stone pressed into a crevice by themountain waters. We say Cor Regale when the Lord of the Heartentersintothepredestinedchamber.OneshouldshieldoneselfbytheLord.

87. The omnipresent Fire imbues each vital manifestation. The

omnipresent Fire intensifies each action. The omnipresent Fireimpels each striving, each undertaking. Therefore, how is itpossible not to be imbued with the omnipresent Fire? The cosmicmight, which underlies each impulse of man and each creativeforce, is directed to a conscious constructiveness. How carefullyoneshouldgathertheseidenticalenergiesfortheconstructionofabetter future! Only a conscious approach toward mastery of thepower of co-measurement can manifest creativeness worthy of abetter step. Therefore, each one on the way to Us must strive tocreativeness,consciouslydirectinghisperceptions.

88. How greatly, then, must the disciple realize the power of

perception and the comprehension that there exists only one lawwhichgovernstheentireCosmos—theHigherWill;alongthislinetheevolutionofthespiritiscreated.Thislawunitesallrelatedandmanifestedmagnitudes.StrivingtowardfulfillmentoftheHigherWill leads to sensitiveness of perception. Only this path affords adecisionincorrespondencewithrealizationandfulfillmentoftheHigherWill.Thus,WealsoofferOurcreativestrivingtotheHigherWill,andthusthearcsofconsciousnessblendintheOneFlamingHeart.Yes,yes,yes!Thusthegreatcosmicstepiscreated!

89. When your consciousness prompts you to the necessity of

possessing the constant Image of the Lord, retire to a quiet placeand direct your sight upon the chosen Image. But remember, one

must decide irrevocably, because in case of treason the constantImagewillbeaconstantreproach.AftergazingintenselyupontheImage,closeyoureyesandtransmitittothethirdeye.Exercisingthus you will attain a vivid Image, and you will feel a specialintensified tremor of the heart. Soon the Image of the Lord willremaininseparablywithyou.Youcantestyourselfbeforethesun,andyouwillstillseetheLordbeforeyou,sometimeswithoutcolor,butafterwardvividlyandeveninaction.Yourprayerwilllosetheneed of words and only the tremor of the heart will suffuse yourunderstanding.Thusonemayreachinlifemuchthatisuseful,buttheconsciousnessmustbeinconformitywithit.

90. One more useful exercise: Become accustomed to not being

astonished or surprised at anything. But this should not beunderstood as the stifling of the spirit. On the contrary, in thecomplete readiness that gives birth to foresight, stand vigilant inthe entire tremor of realization. Many wondrous things areapproaching. One can understand them in accordance with one'sown desire and one's own consciousness. But it is still easier toreceivethemthroughtheImageoftheTeacher.Ifyoucanvisualizethe Image of the Teacher in your consciousness with the mostcompleteclarityyoucantransferyourconsciousnessintoHis,andthus act, as it were, through His Power. But for this, one mustvisualize the Image of the Teacher with utmost precision, even tothe minutest detail, so that the Image may not falter, or sufferdistortion, or change its outline, as frequently happens. But if,followingtheexerciseofconcentration,onesucceedsininvokingaconstant Image of the Teacher, through this one may gain thegreatest benefit for oneself, for one's nearest ones, and for thework.

Such is Our warning when waves rise upon the ocean. I deemthat the present time demands such concentration, because thereisavastsuccessintheatmosphere;butsuccess,likeamagnet,alsoattracts unsuspected metallic fragments, and needles and nailsmay be poisonous. Understand this correctly. Do not be divertedfrom the conception of the Teacher. Do not be astonished orsurprised,becauseitisgoodwhenonecandisclosethenextstepofunderstanding.

91.IftheclarityoftheImageoftheTeacherbringsusintoclosest

cooperation with him, then each clear and vivid conception of anobject in our third eye makes it near and attainable. One of theconditions of ancient magic was to teach the vividness of objectsevokedbyourinnerconception.Iftheobjectiscalledforthwithallcompleteness of line and color, one can apply it for the mostimmediate reaction; one may, as it were, possess it. Withoutlimitations of space, one can regulate and bring closer itspossibilities;fromthemostcustomaryobjectstothefar-offplanetsone can utilize this force. There is nothing of the supernatural inthis;buttheduplicatebecomesseeminglytheidentical,andavitalunifyingthreadisdrawntoit.Onecangraduallydevelopinoneselftheseabilities,uponhabitualobjects,noticingtherebythatwhenaclear image is created, a peculiar tremulous vibration occurs,similar to a magnetic reaction. Thus, in studying the Infinite onecanapproachitbybeginningwiththemostcustomaryobjects.

92. Likewise you will begin to notice that you see your own

imageasifinfrontofyou.Youmustnotwonder,becauseitistheincreased development of the divisibility of the spirit. Theprojection of one's own image, and the sending of parts of one'sspirit,imparttothedevelopedthirdeyetheimagethatissent.Oneshould know that simultaneously someone sees this image andreceiveshelp.

93.Howimportantitistoguardthefieryimpulse!Withoutthis

impelling force an undertaking cannot be saturated with the bestpossibilities.Forcesappliedtoanundertakingaremultipliedbythefireofimpulse.Thereforestrivingissonecessaryforincreasingtheforces given from the Primary Source. In all constructionsharmonyandco-measurementshouldbeobserved.Hence,forthesaturationofOurundertakingsonemustco-measurewhatisgivenwiththemeasuresapplied.Thefireandtheimpulsesustainthelifeforce in each inception. Without these the inception loses itsvitality. Thus, let us strive to the confirmed fire bestowed by theLord.Thuswecanattainthefierysaturation.

94.Asheembarkeduponaship,apurseofgoldwasstolenfromatraveler. Everyone became excited, but the loser smiled andrepeatedlysaid,"Whoknows?"Astormoccurred,andtheshipwaswrecked. And only our traveler was cast ashore. When theislanderscalledhissalvationamiracle,hesmiledagain,saying,"ItissimplythatIpaidmorethantheothersformypassage."

We never know when the good seeds sprout and how long theharvest of poisoned thoughts ripens. They also require time toripen,thereforebewareofpoisonousthoughts;nonewilldisappearwithoutatrace.Butwhereisthatcountry,whenisthathourwhenthe ear of poison will ripen? Even though small but thorny, therewillbenopieceofbreadwhichwillnottearone'sthroat.

95.Isitpossiblenottoharvestone'sownsowing?Lettheseedbe

good,orelsepoisonwillgeneratepoison.Muchcanbeavoided,butthe treasury of thought will be the strongest. Thought, as thehighest energy, is indissoluble and can be precipitated.Experimentswithplantscanprovethepowerofthought.Likewise,ascientist,ifhisthoughtistensed,maytakefromtheshelfjusttheneededbook.

96. If we say, "Do not have desire," it does not mean to be

insensate. On the contrary, replace desire with the irresistiblecommand of a pure thought. In this command you invoke all thepowers of Light, and you make their currents act in correlationwithyourpurestriving.

Be,be,bejoyous;notthroughdesire,butthroughthestrivingofspirit. Be joyous; not through ancestral desires, but through thecommand of the entire consciousness, in order to create thatluminousthreadwhichunitesallworlds.Bejoyous;notbecauseofthe success of works already decayed, but in knowledge of thepredestined and of that already inscribed in the scrolls of thefuture. Be joyous; not in the desire for repose, but because of theagitationoftheelements,sinceonlytheagitationoftheelementswill serve you; for one cannot command the dead to revivify theliving. Thus, understand that joy is a special wisdom, and do notabandonthefiresoflightabovethecrumbsofthefeast.

Thatwhichisfeltbytheearthlysensesisnotsignificant;butlet

us apply the co-service of all the particles of Light. You await me.You await the manifestation of help. But you do not know whenhelp is needed and when the final hour of battle rings out. Yet,fixinguponUsyourentireconsciousness,awarethatWeshallnotdelay, you are building an indestructible bridge, and you aregatheringthetreasuresofMight.

Perhapsthehelpisgreatlyneeded.LetUsjudge,becausethetimeisripe,andbeyondtheseathepillarsofLightalreadyarise!

97. The fiery impulse gives life to the entire Cosmos. Each

creative spark gives the impulse of motion to the striving of thespirit. How, then, not to affirm in each manifestation the fieryimpulse that nurtures all tension and imbues each action?Therefore, one should develop the wondrous impulse of fire thatgives life to everything. Thus the saturated fire can attract allcorresponding energies. In the culture of thought, the fieryimpulse should be developed above all. As the creative impulseassembles concordances, so thought attracts correspondences.Thus,guardtheimpulseoffire.

98.Howwondrousarethesparksofspiritthatmanifestfireand

striving!ThefieryServicewillbringtohumanitysomanysignsofnew evolution. Hence, Agni Yoga has so vitally entered life, andmanysignsregenerateandthreatenourplanet.Oneshouldacceptall that is sent to humanity. Therefore the sensitive organism ofthe Mother of Agni Yoga responds to all Our sendings. Thereforethe health should be guarded. Verily, fires are raging! Much isattested,muchispropelled,muchisahead!

99.Thechieferrorofmenisthattheyconsiderthemselvestobe

outsideofallthatexists.Fromthisissuesalackofcooperation.Itisimpossible to explain to the one who stands outside that he isresponsible for what happens inside without him. The father ofegoism has sown doubt and self-deception in order to sever thecurrentwiththetreasuryofLight.NobodywantstoconsiderthatLight is the effect of thought, but the multitudes that inhabit theinterplanetary spaces will willingly acknowledge the power ofmental cooperation. They realize cooperation and understand

responsibility. One can enroot oneself in a universal thought andthusacquirewingsinheavenandonEarth—thefoundation.Manyvaluable reminders about the link with far-off worlds are spreadeverywhere.

100.Thesparkofthespiritkindlestheheart,henceOurTeaching

isinneedofspreadingthroughthefireoftheheart.Howcanonekindlethetorchesofspiritwithoutthefireoftheheart?Onlyfireuplifts creativeness and imbues each action. The energy thatimpels to the vital impulse must possess vital fire. Hence, in thislawarecontainedcreativepowers.Thetensionofeachenergycallsto life the surrounding energies. Thus all materializations takeplace,gatheringaroundthemallenergies.Therefore,thekernelofthespiritisamightyaccumulator.

101.HowmajesticisthelawofHierarchy!Howconstructiveare

alllawsofHierarchy!Verily,theladderreachesHeaven.Thus,eachonestrivingtoHierarchycanfulfilltheHigherWillthroughataskgivenfromAbove.Thus,WebuildthroughHierarchy;henceeachIndication should be fulfilled as given by the Hierarch. Only thuscan one fulfill the Higher Will. Therefore one should truly guardthe wish of the Hierarch. As pearls of the spirit one should guardtheentireaffirmedSource.

102.Theself-sacrificingheartofanAgniYogicontainsthepain

of the world, but it is a rare manifestation. As is said in a mostancient psalm, "I shall encompass within my heart the sorrow oftheworld.IshallincandescetheheartasthewombofEarth.Ishallsaturate it with lightnings. The new heart is the shield of theworld. I shall inscribe upon it the sign of the Earth-Mother. TheCross of the Mother will be the sign of My fire." Thus knew theancients.

AndagainaloyalheartisintheServiceoftheworld.ThereforeIsay—health must be guarded. A vessel filled to the brim must becarriedwithcaution.

Onemayrejoiceatthekindlingofthefireoftheheart.Letusnotforgethowunexpectedlynewfiresarekindled.

103. Controversies are the carpet of the father of lies. The one

who treads on it cannot see a man without maligning. Thecontroversies in science usually stand upon the same carpet. It isamazing to what an extent people fill themselves with

interpretations in which they do not believe. The contemporarychurches are the best example of why the highest manifestationdoesnotalterlife.Therefore,letusprotecttheall-embracingheart.

104. For the evolution of the spirit the fusion of consciousness

and heart is needed. When the forces are disunited, the spiritcannotact.Thereforestrivingforfusionofthesubtleenergiesissoneeded. In the entire cosmic constructiveness forces are incorrelation, and by dissociation one can only suspend thepreordaineddevelopment.Therefore,theblendedconsciousnessisbeingaffirmed.Eachforceisinneedofmanifestationofastrainedaction,themoresaturated,themorepowerful.Hence,thefusionoftheleversofheartandconsciousnessshouldbeintensified.

105.Thewordthatissuesfromtheheartsaturatesspace.Hence,

thoughts that flow in an impetuous torrent form a sphere whichbecomes a defense against the poisonous gases of the planet.Thoughts become a defensive net for humanity. Only theseluminousemanationsgivethestrengthtowithstandthedarkness.Henceit issoimportanttostratifyspacewithwordsoftheheart,they contain light. Thus humanity is uplifted upon the wings ofthought.Thusevolutionisbeingbuilt.

106.Whatisthetreasureoftheheart?Notonlybenevolence,not

only compassion, not only devotion to the Hierarchy butconsonance with the Cosmic Consciousness when the heart,besidesitsownrhythm,evenpartakesinthecosmicrhythm.Suchaheartcanbetrusted;itpossessesstraight-knowledge,itfeelsandknows,andasamanifestedlinkwiththeHigherWorlditexpressestheindisputable.Themanifestationofthetreasureoftheheart isalso very important for the formation of the subtle body. Try toimagine how important is the experiment with the subtle body.The densifying of the subtle body can give that of which theTeaching of Shambhala so sacredly speaks. One may have anunconquerable host, one may have irreplaceable co-workers, true,onlytemporaryones,butbeyondtheconditionsofcorporeallife.

107.ThecosmiccurrentspassthroughtheheartofanAgniYogi.

"The saturated heart senses all perturbations," thus the AncientWisdomspeaksoftheheartfilledwithEther.Thatthroughwhichthe Cosmic Space breathes, the sensitive heart breathes throughalso. That with which the Cosmic Heart breathes, the heart of anAgni Yogi breathes with also. Each vibration resounds upon thesubtle strings of a sensitive heart, therefore one has to guard sogreatlythiscosmictreasure.Thecurrentsfilltheheartandexpandthe sphere of its action; thus the cosmic correspondence isestablished.

108. Certainly, when wailing is borne through space, the

saturated heart feels many reverberations. So great is the spatialbattle and so tense are the waves of light! The Great Epochapproaches.How,then,nottoovercomeevil?Hence,thedarkonesare so much on guard! When the great laws of Be-ness enter intolife,how,then,shallthedarkonesnotbefrightened?ThusIaffirmOurMight!

Verily, it was rightly said about the significance of thefundamental principle of Our Work. Beauty has been proclaimed,thereforeletussafeguarditsfoundation.Pearlsmustbeguarded!

109.Whyarethemanifestationsusuallyunexpected?Thereare

twoconditions—firstly,expectationalwayscreatescounteraction;even a conscious expectation can provide an energy superfluousfor the manifestation. Secondly, in the case of an announcement,theblacklodgemayincidentallybeinformed.Thepresenceofevenone outsider can serve as an intermediary. The entire world isdividedintoblackandwhiteones.Someserveconsciously,othersaccording to their nature, and the third present a jelly-like massunfit for anything. The black lodge is strong, because for thecombatwithLightapowerfulpotentialityisneeded.Itisunwisetounderestimatetheforcesoftheadversaries,especiallywhentheirbelovedKaliYugacomestoitsend.Certainlyitisadecisivebattleand one should take care that temptation and seduction do nottouchtheweakones.Thelocationofthemainseatofthelodgeofthedarkoneswasindicatedlongago.

110. In former days black masses have been celebrated and

statues to Baphomet have been erected. Now the dark ones havebecomemoredangerous,becauseintryingtoimitateUstheyhaveeliminated many rituals and turned to the power of thought. Thestruggle against Us is difficult for them, but if the disciple's trendofthoughtisseveredtheycandoharm.WhenIindicatedtounitecloselyaroundtheLord,Iadvisedtheveryurgent.Altogether,oneshould take My Indications as most urgent advice. It is time tounderstandthat Igivethe Teaching notas asoporific, but forthesaturationoftheentirelife.

111. When all the cosmic forces are strained, there can be no

retreatwithoutdestruction.WhentheForcesofLightaregroupedaround the Light and the black ones around darkness, there is noretreat. Therefore, if the workers wish to conquer, they mustgather as a mighty force around the focus. Yes, yes, yes! If anordinaryphysicalformiskepttogethermerelybythecohesionofitsparticles,howmuchmorepowerfulistheforceemanatingfromthe Hierarch! Hence, those who wish to conquer must adhereclosely to the protecting Shield, to Hierarchy—only thus can oneconquer.Onlythus,duringthisthreateningtimeofreorganization,can one live through the manifestation of turmoil. Thus, let usremember!

112. After having chosen the Lord and the Guru no retreat is

possible. The path lies only onward, and sooner or later with easeor difficulties you will come to the Teacher. When the black onessurround you and close their circle, there will remain, only thepath upward to the Lord. Then you will feel that the Lord issomewherenotfar-offandthatthesilverthreadisaboveyou.Youhavebuttostretchoutyourhand!Wecanmeetwithoutthehelpoftheblackones,butmoreoftenonlyhewhoispressedfromallsidesreachesouttothesilverthread,andonlyindistressdoeshelearnthelanguageoftheheart.OneshouldfeeltheLordandtheGuruintheheart.

113. They say, "We love and revere." But they remember it only

likelastwinter'ssnow.Sleepistheirlord!Butthehourstrikes,andtheLordwillbecometheirlifeandnurture.Aslightningpiercesthe

darkness,sobrightwillbetheImageoftheLord.Asatreasuretheywill guard each word from Above, for there will be no other wayout for them. And few will be those who, having perceived Light,will be polluted by darkness. There is much of darkness around,andthepathtotheLordisone.RememberabouttheLord!

114. When the cosmic tension is so great, one should gather all

strengthforthedefenseofLight,becauseeachuncertaintyinLightgives access to darkness. Therefore, each foundation should beprotected.WhentheforcesarecollectedaroundLight,howcanonenot adhere to the Leading One? Only in this lies strength andvictory. When the Cosmic Magnet is being shifted, certainly thecourse of Light must be followed, because only upon this crest ofthe wave can one swim over the manifested torrent. Thus thethoughtofLightwillbeliketheImageoftheLord.

115. If people would only remember that they are always

walkingupontheedgeoftheprecipice!Forsoitis.Atanymomentthey may be carried off by a successful or unsuccessful change ofcoarse. Therefore, is it not possible to have in mind this link withthe cosmic course, in order to look into the precipice without atremorwhilehourlyrememberingitsexistence?

116. Certainly the sensitive organism of an Agni Yogi contacts

the cosmic current. Each wave is reflected upon the centers, andthe receptivity of a sensitive Agni Yogi affirms the cosmic waves.Thatiswhyallcosmicandearthlywavescontactthefierycentersinthisway.Hence,thehealthmustbesoprotected.Certainlyitisdifficult,butthecosmicconsciousnessissowondrous.

Who will decide better and who knows better? Only theHierarch. Therefore one has to guard every pearl. Thus, let themguard the treasures. Verily, I affirm that only thus can oneconquer.

117. Earthquakes, volcanic eruptions, storms, fogs, shoaling,

changes of climate, sicknesses, poverty, wars, revolts, heresy,treason—what other signs does humanity expect of thethreateningtime?Prophetsarenotneeded,themostinsignificant

scribe may testify that never as yet have so many dreadfulforerunnersofEarth'sdisintegrationbeengathered.Butdeafistheearandobscuredthevision.Therehasneverbeensuchanhourofdisintegration as this planetary year! It is as if a path were beinglaidforthewavesoffire,andtheobsoletemonstersofotherdayscreep away unwillingly to realize the price of that which takesplace.Verily,theworldissustainedbyMagnetsasimperceptibleasthe air and the flame of space, and just as indispensable as light.TheMagnetssentbyUsforOurmanifestationareliketheanchorsofashiptossedinthestorm.

118. Thus one can see the end of Kali Yuga. It depends upon

humanity where will be the beginning of Satya Yuga. We knowthatSatyaYugaispreordained,butitslocationandconditionsmaydiffer.Mywarriors,Icanassembleyouaccordingtousefulnessanddevotion.

Manhasfallenintoadarkpitandclosedtheoutletwithablackcover.

119. Thought controls the vital impulse. How, then, can one

displaysolittleofstrivingtowardpurificationanddevelopmentofthought? Consciousness attracts all vital expressions, and thecreatorofthoughtsaturatesspace.Thereforeitissoimperativetostrive to broad thoughts and to the understanding of thefoundationsofLife.Eachlifeisbuiltuponitsownorbit,andeachlife has a foundation upon which all actions must correspond tothe Highest. Hence each thought must be directed to trueachievement and must guard the highest striving. The quality ofstriving depends upon the impulse. Therefore one should developallthoughtsleadingtotherefinementofconsciousness.Thusonecanbuildahigherstep.

120.Hence,whenthehigheststrivingtowardtheLordisoffered,

the manifested orbit and focus should be guarded. Therefore, allOurAbutmentsshouldbeprotected,becausecloudsareallaround.Victoryispredestined,butallfoundationsshouldbeprotected,andthe highest striving can bring all possibilities. The time is severebutwondrous.Itisatimeofconsummationandconstruction.Itis

a time of highest tension and of earthly battle. It is a time whichinscribes a great page and which is building a great future.Thereforetheenemiesrage,fortheHighestLawentersintolife.

121.OurShieldisone,thereforeWevaluefullrealization.Partial

glimpses are often extinguished. Hence one should be able todiscern complete devotion. Only thus can one attain and broadentheconsciousness.Oneshouldproceedbythehigherpath.

122. Chiefly, do not become dwarfs. For a dwarf even the

thresholdofadoorismoredifficulttoovercomethanamountain.The thoughts of a dwarf will lead to shallow-mindedness andafterward to disintegration. It was correctly remarked that oneshould observe the influence of the basic aura. Those who haveaccepted it can cooperate, but its denial will be an actual sign ofunfitness.Onedoesnothavetobepersuadedaboutfoundations;iftheyarenotwithintheheart,nothingcanexplainthem.Therefore,donotobservethemotionsoflifeasdwarfs.Likewise,theTeachershouldnotbeadoptedbythebrainofsubterraneandwarfs.

123.InKurdistanthereisaruincalled"thecastleoferrors."Itis

said that the castle was build by error, its location was chosen byerror, the owner married by error, conducted wars by error, hadcouncilorsbyerror,gambledbyerror,fellillbyerror,andperishedbyerror.Onlyacertainamountoferrorscanbetolerated!

124. When various currents are gathering, measures should

certainlybetakenagainstthem.Variouscurrentsaregovernedbycounteractivemeasures.Allhostilecurrentsrequirebridling.Thuseach arrow aimed at the Shield will be turned against the enemy.Thustheboomerangacts,andthecurrentsofOurreactionswillbepowerful.Thusonemustact,protectingallfoundationsandallthehighest indications of the Hierarch. Verily, only thus can oneattain.

125. Observe how people read the Teaching. Observe which

passages they avoid and try not to notice. People especially oftenclose their eyes to everything referring to betrayal and psychic

murder.Theydonotevenwishtoconsiderthattheycanharmatadistance by their thoughts. Thus people avoid that in which theyaremostoftenguilty.Onedoesnothavetobeagiantofthoughtinordertoharm.Evenamediocrethoughtpoisonedbythecrystalofimperil will be very effective. To conceive treason means toaccomplish an evident half of the whole, because an alreadypoisoned shell will be receptive to the slightest impetus. Verily,poisoning by thoughts is even more harmful than narcotics.Likewise, one can remind about infection through thought-transmission. One may be weakened to such an extent that eachinfectioncaneasilyapproach.Thoughtislikeakeywithwhichtoopen.

126. How can one avoid harm from the thoughts sent? Follow

the one and same advice—intensify the striving toward the Lord.Alongthisdirectiononecanacquireimmunity.Therefore,IadviserealizingHierarchyfromthehighestspiritualstrivingtoeventhesmallest bodily requirements; the silver thread is neededeverywhere.Obstinacyandtheblacklodgewillseekineverywayto divert the thoughts from Hierarchy. Although subservience ishighly developed among them, they keep it for themselves,knowingtheimmutabilityofthislaw.

127.TheSpatialFiredissolvesallaccumulations.Butwhatadam

people build, and how they encumber space with non-understanding and a consciousness which so little comprehendsthe cosmic constructiveness! How can one create withoutacknowledging a Higher Leader? How can one build withoutsensingthethreadthatbindsonewiththeHierarch?HowcanoneexpectsendingswhenthespiritdoesnotunfoldtomeettheLight?Only through adherence to Hierarchy and by fulfillment of themanifestedWillcanonebetrulysuccessfulandattaineverythingthatisaffirmed.Yes,yes,yes!

128. Therefore each striving leading to the unification of the

disciple with the Teacher leads to cognizance of the higher laws.The disciple in rejecting the Teacher acknowledges his ownignorance, because he arrests his development. Each force

attracting the spirit upward is a force of development. How shallwe broaden our consciousness and uplift the spirit if we do notaccept the Hand of a Hierarch? Conceit very harmfully retardsprogress! Hence it is urgent to point out to all those who speakagainst extreme devotion to the Teacher that only by the force ofdevotioncanrefinementofconsciousnessbeachieved.Thecultureof the spirit and thought are to be followed, thus manifesting anunconquerable devotion to Hierarchy. Only thus is the spirituplifted; only thus can one be affirmed in the evolution of thespirit.Hence,thebeautyofServiceiscontainedintheblendingofconsciousnesses. When the arcs of consciousnesses are blended,Lightreigns,andthehighestordainmentisaffirmed.OnlythusisthehighestLawattained.ThusWecreate!

129. Let us write down questions for a disciple: "Dost thou not

serve darkness? Art thou not a servitor of doubt? Art thou not atraitor? Art thou not a liar? Art thou not ribald? Art thou not asluggard? Art thou not irritable? Hast thou a tendency toinconstancy? Art thou not negligent? Dost thou understanddevotion? Art thou ready to labor? Wilt thou not be afraid ofLight?"Thusaskdiscipleswhenpreparingthemforprobation.

130.Duringconstructiononeshoulddevelopallstrivingstoward

synonymousunderstanding.Eachtaskcarriesequivalentstrength.One should strive toward finding this key. One cannot demandthat a great manifestation be gauged by small measures. A smallthought cannot be embellished. Small thoughts cannot make ahero.Onlyasubtleidentityaffordscorrespondence.Thereforethehighest to the highest. The higher, the more affirming; only thuscanonegrowandintroducethepredestinedintolife.TheHighestPlanrequiresapplicationofthehighestmeasures.

131. Therefore, when We proclaim Hierarchy We are aware of

thespatialbattlewhichsummonstotherealizationofthehighestlaw. Creativeness requires the affirmation of the consciouslyacceptedprincipleofHierarchy.ThusWebuild,thusWesummontothesubtleunderstandingofHierarchy.Verily,therevealedLawenterslife!Thusisaffirmedthehigheststep.

132.Icallattentiontothesaturationoftheheartandtheprayer

oftheheartfortworeasons:firstly,itleadstoablendingwiththeHigherWorld;secondly,itdoesnotrequireaspecialtimeandcanbe performed during any labor. One may easily become used to aspecial sensation within the heart without fearing any ill effect.The heart will not be overtired by the Lord, on the contrary, onlysurroundingthoughtscanill-affecttheheart.Thus,somedaymenshall finally realize the significance of thoughts, at least for thesake of their own hearts. Let them ponder upon the poison ofsendings! It is time to pay attention to the amount of sicknessesgeneratedbythoughts.Duringeachsicknessitisnotbadtomakeasuggestion against negative thoughts. Magnetic passes over theaffectedorgancanalsobemade.Nothingspecialisneededbeyonda prayer of the heart, which creates a magnetic link with theHighest. During the laying on of hands one should not think ofsickness,butshouldtrytouniteoneselfwiththeHighest.

133. What benefit can be derived from small experiments and

observations!Withoutwastingtime,thedisciplecanpayattentionto a multitude of small manifestations. Every day amidst yourusual occupations pay attention to the various sensations of yourorganism. Each one in his own way reflects the cosmicmanifestations, but one should fearlessly notice each sensation.Similarly one can even observe the life of the usual householdobjectsundertheinfluenceofadefinitehand.Repeatthistothosewhoforgettheimpactofpersonalityandcontact.

134.TheCosmicMagnetattractsallenergiesthatareshiftedtoa

new center. Thus all outworn energies are shifted, yielding theirplacetothenewones.Therefore,atthechangeofforcesalldividedforcesarelostinthecosmicprocess.OnlyLightanddarknessareinopposition and are intensified in the cosmic conflict. Hence,striving should be saturated precisely with the fire of attraction,and one should seek Light against the black lodge with the entireimpulse. It is necessary to shield oneself with devotion to, andrealizationof,Hierarchyandtodareagainstthedarknesswithalltheleversofspiritandheart.

135.Thuseachattemptofthedarkoneswillbeanewpossibility

forUsandaboomerangfortheadversaries.Onlythuswillthepathbecleared,andeachstepoftheenemywillturnintoatrapforhim.ThusWeconquer.Thetimeisgreat,thetimeistense!

136. Only by the tension of all strength will you conquer. This

must be remembered and applied. We have decided on completesuccess, it depends upon you to accept it. The entire garden ofdoubts, suspicions, fears, offenses, condemnations must be castaside. If you desire to accept victory, every treason must beavoided,becausetheconsequencesofdoubtsandlackofrespectforHierarchywilldisruptallthreads.Whentheshipisholdingbyonlyoneanchorduringthetempest, it isstupidtobegintochangethechain.Guardthefoundation,andascendonlythroughitsgrowth.IshallbetirelessinrepeatingaboutHierarchyuntilyourealizeit.Itis not enough to nod your head, it is time to think and to apply. Ihavereasonsforrepeatingthis.

137.Thepurplestaristhesignofthehighesttension,fortension

andthecontinuoustransmissionofenergyisthemanifestationofco-creation.

LetnoonetakelightlyMywarning;whenvictoryisweighedanddefined, there can be no excuses or haphazardness. Remember,there is one Anchor, there is one Light! And when the greatestbattletakesplace,itisunforgivabletodisturbtheformation.Ishallbe very severe, because the time is at hand, and already somesuccesseshavebeenpostponed.Theburdeniscausedonlybyyou.Guard the foundation! Many fires are introduced into action.Remember,thepurplestarindicatesthehighesttension.

138. Let us become accustomed to that which can be a true

preparation for significant actions. Already, decisive datesapproach each day. Wings are growing for the ascent that wasalreadyforetoldinsmallcoincidencesaswellasindecisiveevents.Again, the words of the Command shall be pronounced. It meansthatthefruitsareagainripe.Againthedreams,thevisions,andthehopes shall be gathered into a knot which will mark the next

immutablestep.Outofcoincidences,imperceptiblyminute,againare woven the tangible facts, and that which seemed unrealizableorpostponedisagainmoldedintoabonfireofevents.Recallmuchthatwastoldandapplyitforthepresentday.

"Idonotfear,fortheenemiesareserving,andouradversariesarebringing precious values into the treasury of the spirit." Thus,think benevolently, and aspire to the new step, to the newattainment.

139.ThethreadbindingtheTeacherwithhisdiscipleisthemost

powerfulcurrentandprovidesanevidentdefense.How,then,canone manifest one's striving without the Teacher? Those faint-hearted ones who say they will go alone do not know thesignificanceoftheprotectingnet.Hence,thenon-acceptanceoftheChain of Hierarchy gives a result equivalent to destroying theprinciple of construction. Thus, only with a powerful Hierarchycanonebeaffirmedinconstruction.

140. The sparks of causality fly in space, and each spark brings

itseffect.Thus,thenon-acceptanceofaTeacherleavesthedisciplewithout guidance, and each action of such wandering spirits hasno constructive importance. Thus, each spiritual striving mustlead to the search for a Guide. Causality produces its wonderfulsprouts when the disciple understands the significance ofHierarchy.

141. Certainly you do not doubt that I shall reiterate about

Hierarchy.Weshallinsist,untilWeestablishafirmunderstandingofthispanacea.ButeachtimeWeshallstressanewfeature,forWedonotrepeat.

Someonemaysay,"IaddressmyselfwithallmystrengthtotheLord, but it does not reach the Lord." Ask, "Was it sincere?" ThisqualityofinvocationisasnecessaryasLight.Eachonemaycasthiseyeintohisheartandinspectthesmallcornersofadecrepitworld.Without sincerity there will be no current. Therefore strain allyourforcesandelectpurestrivingoftheheart.

142. You often hear about the battle waged by the powers of

darkness. Now you are in its very midst. Truly the Hierarchsthemselvesparticipateinthecombat.Themoregloriouswillbethevictory. But hold My Hand as an anchor. I would not speak of theterrible danger without reason. Therefore, let us not lose themoment to unite, and, rejecting the past, let us strive into thefutureandholdfastinbattle.Itshouldberememberedthatgreatisthe honor of confronting the giants of evil. I know your tension,butacceptitasasacredascent.Driveawayallthatisevilanddark.Invoke Me often whenever the manifestations of Light arethreatened.RememberHierarchy!

143. When the intensified Magnet convokes all forces, each

energy should be discriminated. Therefore, one should knowwhichforcesareadmissibleforconstructionandwhichcanbringharm.DiscriminationcanbeattainedonlythoughadherencetotheHighestconsciousness,becauseonlythescopeofpurestrivingcanrevealtheaffirmedCovenantofService.Hence,oneshouldlearntoacknowledgeallthehigherlaws,constructinglifeuponthem.

144.Certainly,thecosmicmanifestationsreverberateagainstthe

feelings of a tensed Agni Yogi. Obviously the course of humandeeds evokes subterranean storms and supermundane fires.Similarity is evidenced everywhere, and all that occurs has a likeconnection.Therefore,oneshoulddiscloseasacredfeelingtowardHierarchy and the manifested heart. Hence, one should clearlycomprehendtheanchorofsalvationandadheretoitwithintensestrength.

145.Unfortunately,thepresenttimefullycorrespondstothelast

period of Atlantis. The very same psuedoprophets and apseudosavior; the same wars, the same treasons and spiritualbarbarism. We take pride in the crumbs of civilization; theAtlanteans likewise knew how to fly across the planet in order tospeedily cheat each other. The temples likewise became defiled,and science became a subject of speculation and dissension. Thesame occurred in construction, as if they did not dare to buildsolidly!Likewise,theyrebelledagainstHierarchyandwerestifledwiththeirownegoism.Likewise,theydisturbedtheequilibriumof

the subterranean forces, and by mutual efforts a cataclysm wascreated.

146. When the link with the Lord is strong, mountains can be

moved. Striving to Hierarchy creates that culture about which somuch is spoken. Dead are those who presume that by means ofearthly Maya they can create strongholds. It is as unwise aschildrendreamingtobuildafortressoutofmud!Onlytheworldofspirit istrulystrong,forit is indestructibleandinvincible.Itmaybe pointed out that the first sign of culture is the absence ofpersonaldiscords.

147.Whenthefateoftheplanetisbeingdetermined,theforces

are distributed along the poles of Light and darkness; therefore,each spirit must guard itself from faint-heartedness. To side withLightmeanstowalkwithUsundertheBannerofHierarchy;tosidewith darkness means to walk under the yoke of the black banner.Thus, in time of battle one should fierily realize Our Might andbuildalawfulaffirmationoflife.Onlythuscanthechallengeofthedark ones be accepted; for when the spirit is immune to faint-heartedness and treason, victory is manifested. Thus, let us beaffirmeduponHierarchy.

148.Certainly,whenthebattleproceeds,thecreativenessofthe

forces is strained, and each loyal action adds a strong link to thechain of defense. Each heart manifesting devotion to Hierarchyservesasasmitingflameagainsttheenemy.Therefore,onlyapurestriving to Hierarchy assures a right decision. Thus We conquer.True,whenthebattleistense,therearemanydesiringtoharm.Yettheplanisinvulnerable,andonlytheevidenceofcompletestrivingtoHierarchygivesvictory.

149.ItwasneversaidtorelyupontheLord.Onthecontrary, it

wasrepeated,"BeimbuedwiththeLord!"Thereisagreatdifferencebetweentimidandinactiverelianceandimbuingtheentirebeingwith the consciousness of the Lord. As an invincible sword, theconsciousnessidentifiedwiththeLordsmitesallobstacles!Doubtcannot find shelter where a flaming consciousness is kindled.

TherewillbenofatiguewheretheinexhaustibleSourceofForcesisadmitted. Fear cannot penetrate into the temple of invulnerablearmor. Thus, I advise acceptance of My Shields, not throughrecourse to a saving protection, but by conquering through theblendingofconsciousness.

150.Attentionshouldbepaidtothekindlingofthecentersofthe

knees. Even spots upon the skin reveal the very same stigmata asdoes genuflection, which means that the prayer within the heartmay be evidencing the same signs. Thus one may gathersignificantsigns,forinstance;therhythmofcosmicenergiesintheheart or a strong swelling of the abdomen near these centers isattested, as are those of the larynx, the back of the neck, and thecrownofthehead.

IvouchforsuccessifyouareimbuedwiththeLord!151. During a conflict of forces one should always observe the

maximumofcentralization.Thereforethepowerofthefocusissogreatlyneeded,andeachoneinhisturnmustconsiderhispositionasboundwiththecenter.Thus,thecentralpowerwillemitallrays,and shadows will have to disappear. The radiation of the focusuponthespiritualplaneismostinvincible!Thereforeimmunityofthe spirit can be attained through striving to the Spiritual Focus.Hierarchy is so wondrous in that it represents this mighty Focus.Therefore,oneshouldstrivelimitlesslytothelawofHierarchy.

152. Thus the might of the Spiritual focus is manifested by Us.

ThusimmutablearethelawsofHierarchy,andthosewhoadhereto that affirmed might will find the right path. Hence it is soimportant to approach Us in the sole striving to fulfill thepredestined.ThusvictoryisaffirmedbyUs.Therefore,oneshouldgatherallthebeststrivingstoadheretotheSpiritualFocus.

TheFocusradiatesthroughtheblendingofconsciousnesses.OurFocus is powerful through the blending of hearts. Our Focus isinvincible, so I affirm! Thus, let the Spiritual Focus radiate in theheart of each co-worker. The creativeness of the spirit isinseverably linked with the corresponding striving. Hence,concordanceisalawfulmanifestation.

153.DangerousisMayawhenhumanitythinksthatitcancreate

entirely identical objects. They forget that even the difference inthetimeofcreationalreadyeffectsasubstantialdifference.Thus,astandard can satisfy only an inferior consciousness. The mentionof conventionalities of understanding corresponds to theunderstandingofMaya,butthefoundationscannotbewithinthelimits of Maya. Therefore, let us turn to the immutable, in otherwords,tothespirit'sblendingwithHierarchy.Havingsearchedallcorners of the planet we shall find the sole path upward.Thousands of hymns may be composed to this ascent, yet at itsfoundation will be the same identical striving of the spirit to thesamesphereswhereitsgranulationtakesplace.Onemaystudytheidiomsofallpeoples,butnowherewillaworddaretoexpresstheimmutableandunutterableFoundationofBe-nessandthepathtothe Father of all Existence. However, the heart in the hour oftensionknowstheUnutterableandfeelsthehigherpath.

154.Inthedarkthewatchfulvoiceofthewatcherdirectsoneto

theTowerwheretheLordholdshisvigil.Hewhowatchescannotcarry out his service if he does not feel the Lord. And the worldcataclysm is only the result of transgression against Hierarchy.Transgression against Hierarchy means the shattering of allcausality,alllawfuleffects.

155.TheconsciousnessnotblendedwiththeLordcannotstrive

to the law of accumulation in the Chalice. Only the power of theCosmicMagnetcanbringthespiritclosetotheTeacher.Verily,theonewhoadherestotheHigherConsciousnessreceivesthepowerofthought.OnlywhenaspiritacceptsalltransmissionsfromAbovecan he broaden his consciousness, otherwise the power concealedwithin the Chalice cannot be awakened. Thus, the thread of thebond is the ladder of spirit upon which the power of the spiritascends.Creativenessisaffirmedbywayofthiswondrousthread.Thus, the ascent of the spirit proceeds through its bond with theLord.

156. This bond unites Us and creates the best results. Thus, the

most wondrous thread is the silver one uniting the heart of theHierarchwithhisdisciple.Thelightofthespiritisnurturedbythismight. Therefore, when We speak of a united aura, We have inmind the actuality of the bond! Thus, the Counsels should beguarded as the Source of Light. Thus one can attract the bestopportunities. Hence the sacred union of the Hierarch with thedisciple is evidenced when the disciple's consciousness is strivingtowardtheconsciousnessoftheHierarch.Thusawondrousstepisbuiltbyablendedheart!

157. You understand what each apostate inflicts upon the

Teacher.Ifaspecialrayisassignedtoeachdisciple,theseveringofthisthreadmusthaveareaction.ItisnotwithoutreasonthattheTeacher insistently questions the knocking ones, "Art thou not atraitor?" The severing of the thread between the Teacher and thedisciple can be achieved only by a slow process, but impetuousbetrayal is usually very painful to the Teacher and to the traitor.Verily, the traitor's reason becomes obscured, and through thewoundcausedbythebrokenthreadobsessionoccursmosteasily.Oneshouldconsiderthisprocessofbetrayalasaphysicaldanger,nottospeakofthespiritualconsequence.Oneshouldponderhowcautiously one must select disciples in order not to contribute tocosmic harm. Hence, each Teaching gives strong examples ofbetrayal.ForbetrayalthereisnoneedtobepreciselyaDevadattaora Judas. Even without these prototypes space is filled withfracturedrays.

158.WithoutthebondwiththeTeacheronemaygiveaccesstoa

darkdwellerevenbyonepinprickofdenial.Levitydoesnotdwellfarfrombetrayal.Thusonemayimaginetheconsequencesofthedisciple's severing himself from the Teacher. It is time to payattention to insane asylums and to verify the causes andconditions of such illnesses, especially now when this scourge ismoredangerousthantheplague.

Learn how to guard the thread with the Teacher and to fill theheartwiththeLord.Itmustnotbeforgottenwhatisessentialforan unswerving ascent. Neither works, nor circumstances, norcharacter, nor diverse reasons may erect barriers between the

disciple and the Teacher. The manifestation of the Teachersignifiestheinitiationoftheshortestpath.TorejecttheLordistobetrayoneself.

159.Onecanseetheunityofallmanifestationswhenthespirit

canreflectthebeststrivings.Spacerequiresobservations,andeachmanifestationisinneedofconsciousassimilation.Onlywhenthefoundationsofcreativenessarefirmcanonebuildforevolution.

Akbarusedtosay,"Across-eyedpersondoesnotseethecenter."Thus, each vital action requires stability. Before looking at twoparallellines,oneshouldknowwhichtochoose.Hencestabilityisso indispensable, and only the closest approach to Hierarchyprovidesthecorrectpathandthehighersolution.

160. Thus, each disciple must approach Hierarchy and must

affirm himself with the entire spirit on the closest approach.StrivingtotheLordwillgiveafullunderstandingofHierarchyandwillrevealtothespiritthesilverthread.ThecenterisoccupiedbyHierarchy. From the center emanate all rays. To the centerconverge all rays. Therefore, the stability of the spirit can attractpositive manifestations. Thus, the power of blending lies in theheart.Verily,intheheart!ThusWecreate.Thusthehigherstepisaffirmed.

161. Not only the direct link with the Lord but even an

unconscious striving toward Hierarchy gives a glimpse of thecommunionwithcosmicforces.Wherecoloredsparksappear,thedoor is open to the chain of Benefaction. True, people seldom payattentiontoobvioussigns,howeverinmergingintothelifeofthespirit one can not only understand the significance of these firesbut may even perceive their interrelations. One may notice entirebattles between the black and the blue sparks, and be convincedthattheblueoneswillalwaysconquertheprogenyofdarkness.

162. The science closest to spirit is higher mathematics, if

correctly understood. Thus abstraction becomes reality. The mistofknowledgecanbeilluminedthroughInfinity.Certainlywemuststrivetoallthatcanleadourconsciousnessbeyondtheboundaries

ofourplanet.Onlythuscanthetruevaluesbeunderstood.Hewhocan understand synthesis will understand Hierarchy. One mayreiterate much about Hierarchy, and We shall emulate thewoodpecker until the knots of the bark are broken through. Irepeat,ifyoudonotunderstandHierarchyinspirit,understanditatleastforthebenefitofyourhealth.Manifestreverence.

163. Conformity between an action and the factor that called

forth the action is powerfully evidenced in the entire Cosmos. Allsubterranean fires are called to the surface of the planet by theactions of humanity, which serve as a link between the worlds.Thus, the stifling gases call forth corresponding forces. Eachhuman thought creates its own correspondences, hence it isimpermissible to create without the action of the centers andattractiontothelawofHierarchy.

164.Incosmiccreativenesseverythingisbuiltuponsuccession,

since the roots of each structure are held by the law of HierarchyEachtaskandplanisbuiltingoal-fitness,andtheyareaffirmedbythe great plan of evolution. Thus, all Our affirmations bringbeneficent manifestations. Only attraction to the Chain ofHierarchy can reveal the path to Infinity. Thus, the power ofblendingverilyrulestheworld.

165. The physician who has an opportunity to study the sacred

pains and does not do it is guilty. In studying those pains andcomparing them with the actions that cause them, he couldprepare the steps for the coming evolution. In reality, during thespiritual development of the world, sacred pains should not exist,but the surrounding imperfections create these pains. Thus, incomparingtheconditionsandcauses,onecanforeseethedirectionof evolution. Certainly, much can be improved in the humanconsciousnessifweknowthatevenearthquakesarecalledforthbythe spirit of humanity. One can gradually gather manymanifestationsofwhichmanisthecreator.Thus,thesacredpainsare the indicators of the next race in the clutches of theunderdeveloped; hence, I say, Guard your health. I say, Do notburden others by unnecessary sallies and irritation. The echo of

errorsresoundsnotonlyaroundyou,butiscarriedalongtheentireChainofHierarchy.However,eachcautionisbeneficialnotonlytoyoubutitalsostrengthensspaceuntofar-offspheres.

166. Verily, humanity is a link between the worlds. One should

beusedtothatthoughtandtrytoapplyitinlife.Itisstrangethatphysiciansdonotavailthemselvesoftheopportunityofbecomingcarriers of health, applying the knowledge of nerve centers,because precisely these centers are the spiritual antennae andmagnets. Even a physical magnet is placed in a special vicinity inorder that it may not lose its strength. Do not the nerve centersdeserve similar attention? And must not people especially protecttherepresentativesofthenextrace?Thebridgebetweentheshoresis especially protected. One may demand of man, "Friend, do notevokeearthquakes."

167.ThecenterthatlightsallbeginningsofOurWorksisbased

upon the law of Hierarchy. The impetuosity of creativeness isfounded upon the center of Hierarchy. How obviously humanitydeviatesfromthehigherpathandhigherstriving!HewhoisafraidofthemanifestationoftheTeacherwillremainanignoramus.HewhorejectstheLeadingHandwillforeverremaininerror.Hewhois afraid to lose his individuality does not possess it. Thus oneshouldponderuponthegreatlawsofHierarchy.

168. There exists a misconception that the dark ones, being the

antithesis of Light, are therefore unavoidable—this is erroneous.Darkness, the antithesis of Light, is nothing but unmanifestedChaos.Thedarkonesdenigratethemanifestationofthecombatofthe creative Light against Chaos. It would be a sufficient task forhumanity to make Chaos manifest and in that great battle tocooperate with the Great Spirits. But the dark ones have reducedthemasteryofunbridledelementstotheegoismofrebelsandhavebeguntocallforthChaosinsteadoftransmutingitintoaworkingforce.Thiscrimeisgreat,andthedesiretoextinguishLightcannotbeconsideredanantithesis.ThecreativevanquishingofChaos,orthe "Dragon," is a constant achievement. But the battle with thedarkonesisonlyaconvulsion,impedingmotion.Thedarknessof

Chaos may be considered as a means for mental creativeness.However,thecombatwiththehierarchyofthedarkonesisonlyalost date, so needed for construction. Moreover, the dark onesconstantlyarousemightyelements,notknowing,ofcourse,howtomasterthem.

169.Itshouldberememberedthatitisnotthedarkonesassuch

that are dangerous, but the forces evoked by them. Verily, oneshouldcomparegreatLightwithgreatDarkness,butitisunfittingto consider as great those who build upon egoism. Thus, it isnecessary to co-measure even in great manifestations. Certainly,let us not forget the harm sown by the dark ones who are like abrood of serpents! Even during battle with reptiles Hierarchy isneeded, because everything disordered must be annihilated.Hence, let us remember where is great Darkness, and where thefierceenemywhoseekstheannihilationofLight,havingforgottenthatwithoutLighthecannotexist.

170. Construction requires intensified tension. Without this

impulseitisimpossibletobuildthestepsofevolution.Eachorbitissaturated with conscious striving, and each step requires its ownaffirmingstrength.Therefore,whencreativenessassemblesforces,identical energies are drawn to the focus. Therefore, the moreconscious the attitude toward the focus, the greater will be theaction of correspondence and the more powerful the attraction.Cause and effect are predetermined, and the creative impulse issaturatedbythefireofconsciousstriving.ThustheentireCosmosisbuilt.

171.Hence,whenunderstandingisnotfoundeduponHierarchy,

themanifestationsofthefocuscannotbesovitallydisplayed,andeach one who isolates himself cannot find his way to Us. Thus,therearesomanyroamingshadowswhocannotturntheaffirmedkey.Thussomanystrivingsarelostinspace.Therefore,upontheblendingofthearcsofconsciousnesses,Webuildthefuture.Thus,Our fiery law ordains the blending of consciousnesses. Thus, oneshould be affirmed in the realization of the focus. The spirit canapproach the realization of this fiery law. The manifestation of

Hierarchyisthebasisofconstructiveness.172. One more misconception: often, because of ignorance or

self-justification, people think that their thought is insignificantand can reach nowhere, whereas the potentiality of thought isgreat, and for thought there exists neither space nor time. Butthosewhothinkchaoticallyare,likethosewhowavetheirhandsinthe dark, unaware of the object they hit. Moreover, thoughtaccumulates in space. One can conceive of a mighty choir ofharmonious thoughts, but one can also imagine a flock ofchattering black jackdaws. Such congregations also fill space anddisturb the higher worlds. Dear thinkers, jackdaws, you are alsoresponsibleforthequalityofyourthoughts.Thus,evenyoucreateyourfuture.

173. Therefore there is no way by which one can escape

responsibility. Even the smallest thought enters into themegaphone of space and attracts to itself the same kind of locust,causing the smoky atmosphere of the planet. Thought can purifyby destroying the microbes of disintegration, but it can likewiseattract unbridled elements. Not without reason do the dark onesuse especially underdeveloped people for certain machinations.You often utter the word cult-ur; it means the cult of Light. IremindyouofhowgreatisthecommonresponsibilitybeforeLightif each thought can either obscure or purify space. Thus let usremember.

174. Certainly the path of Service can bring one to higher

knowledge. Only ignorance could bring the planet to its presentcondition. Humanity has lost the understanding of the beauty ofaspiration, and construction has been established upon thestupidityofisolationism.Forthisreason,unityofServicehasbeenrevealed as salvation for humanity. The entire power ofconstructiveness is based on Hierarchy. Thus the mighty threadunites the entire Cosmos. Verily, only in full realization of GreatService can the beauty of Spirit and the Might of Hierarchy beunderstood. Space summons to the fulfillment of the great Law.Yes,yes,yes!Thusthestepsoftrueevolutionarebuilt!

175. Therefore, only a full understanding of Great Service can

give disciples the aspiration to the Hierarchy. When thecreativeness of the spirit can encompass Great Service, then allpaths to Us are open. Therefore, striving to fulfill the Indicationscan be affirmed as an impulse leading to the highest Gates. Thus,letallthepearlsoftheGuruandtheTarabeguarded.Thusonecanfulfill all given possibilities. The time is pregnant and tense!Therefore, let the disciples strive to keep step with the rhythm ofevents; and consciousness should be strained in unison with allthatoccurs.Onlythusdoesoneconquer.

176. Verily, if you realize yourself as being constantly in the

solemnpresenceoftheLord,youarealreadyontheshortestpathtoUs.Peopleloatheespeciallytheroutineofdailylife;forthemitisthe symbol of weariness and descent, whereas for us the dailyroutine is perfectment and ascent; it opens the gates to Infinity.One can learn to love this daily routine, because it tempers thespirit and gives one courage to contemplate the endless chain oftheagesoflabor.Forsome,theseagesareamenace,butarefinedconsciousness will accept them as the source of endlesscreativeness. Beautiful cults become dulled on account of dailyroutine, but how wondrous is the realization that daily devotionand a flaming love are offered to Hierarchy. If I shall say, "I loveThee, O Lord, and I am devoted to Thee, O Lord, and I reverenceThee,Teacher," by whata mighty choirwill thissong of praisebetransformed on the far-off worlds! Thus, in each act of devotionone can open new locks; and how wondrous it is to feel theinexhaustibilityofgreatconcepts.TheOrdainmentcanbeconcise:"Beaflameinheartandcreateinlove!"

177. Learn not to count days and not to notice years, because

thereisnodifferencewhenyouareinthegreatexpanseofService.One should learn to feel oneself beyond trivial usualness and toadhereinspirittothemanifestedworldofBeauty.Letusproceedtogether to where there are no boundaries or end, where one cantransformeachbeneficentgleamintotheradiationofarainbowofblessingstotheworlds.

Through devotion one can reach all gates. Let us not forget thiseven for a moment. Precisely, let us be filled with the smile ofdevotion, and let us bless the daily routine. Each breath of Ourscontains a wondrous substance for the worlds in formation.Ponderuponthetreasureswhicharegiventousandwhichbelongto the One who brought us a tear and a drop of sweat for ourliberation.LetusalsodailythanktheHighestOne.

178. How necessary it is for everyone not to disunite his heart

and mind on the path to Us. Creativeness is affirmed by pureimpulses, and it is most necessary to unite all the fiery centers.Thus,itmustberealizedthatthematterofthoughtmustserveasalinkwithhighersubstances,becauseonlythesubtlestthoughtcanpenetratetothem,andtherefinementofconsciousnesscanimpelthat force which controls mighty levers. Thus, only a unitedconsciousness can fulfill the Higher Will. Thus the Chain ofHierarchy is affirmed. Thus a united consciousness rules theworld. The Higher Will is transmitted to the closest spirit. Hence,theWilloftheHierarchmustthusbefullyexecuted.Thereforeonemustactivelyacceptallthatisgivenbyaunitedconsciousness

179.Theonewhoreliesisdead,buttheonewhofollowsisalive.

Wedidnotpromisetotransportdeadbodies,Wevouchedtoleadcourageousfollowers.Onemustponderveryattentivelyinordertodiscern the boundary between courageous following and faint-hearted reliance. Also, Our Indications must be understoodwithout delay, for the sun shines differently at the morning hourandatnoon.Weshouldbeacceptedasdailynurture.Anddevotionwill receive its answer if all forces are applied. Such must be theonwardmovementofthosewhofollowtheLord.Ourhelp,asyouknow,comesatthelasthour,butthedoorshouldnotbeclosedtoOur messenger. Perhaps our influence acts beyond the seas,neverthelessthestrivingtowardUsmustnotbesevered.

180. Disunion from the Guide stops the evolution of the spirit,

becausethedisruptionofthechainleadstoisolationandimpedesthecreativenessofthespirit.Verily,onlyunionwiththeSourceofLight moves the spirit onward. Thus, striving to the Highest

Hierarchy gives all possibilities and saturates the spirit with thepower of Service. The orbits of Light are built by correspondenceandbythepoweroffulfillmentoftheHigherWill.ThusisthepathtoInfinitybuilt.

181. Hence it is most important to realize the significance of

fulfillmentoftheHigherWill.Therefore,thepowerofblendingissogreatlyaffirmed,foronlyintheblendingofconsciousnessesiscreativeness contained. The disintegration of humanity is so vastbecausethereisnobalance.AndtheeventsontheplanetindicatedisunitywiththeHighestConsciousness.Thus,itcanbeconfirmedthat disciples must strive to the realization of Hierarchy. One canattainonlythroughfulfillmentoftheHigherWill.

182. Gratitude is one of the main qualities of justice. Without

justice one cannot reach the path of Great Service. Therefore, inpointingoutthenecessityfortherealizationofgratitude,Weonlyassist the Great Service. How beautiful is gratitude! It so easilykindlesthefireoftheheart,and,asifinthepresenceoftheImageoftheLord,itfillsthespiritwithnobility.Theingrateis,firstofall,ignoble. We term nobility the benevolent accumulations fromformer lives, while upon Earth nobility is considered onlyaccording to one's birth. One should especially develop gratitude,because gratitude is the sister of loyalty. It is necessary to realizehow difficult it is sometimes for the Teacher to combine the bestpossibilities.Onemustknowhowtoassistbythefireofone'sownheart.

183. The blended consciousness affords striving to the highest

solution. Why, then, should such disunion take place when theentireCosmosisaffirmedupontheprincipleofblending?Howcanone be dissociated from the chain that holds the entire Cosmos?Livesmustbebuiltupontheprincipleofatensecosmicchain.Onlythus can Hierarchy establish the principle of fiery Service. Hence,onthewaytoUsonecanattainonlythroughHierarchy.

184. Truly, divisibility of spirit is attained when the centers

createflamingly.Thustheharmonyofcreativenessisimbuedwith

this flame of the spirit. Each creative impulse kindles spiritualtorcheswhenitimbuesspacewithitsfire.Thereforethetorchesofthe spirit can kindle auras. Thus the flaming centers kindlespiritualquestsatadistance.Verily,greatiscreativeness.Yes,yes,yes!

185. The words that comprise the concept of Good are in great

favorwithUs.ButoneofthemisutterlyoppositetoOurcustoms—that is comfort. Verily, investigate the history of humanity, andyou will be convinced that nothing great was ever created incomfort.ForalongtimeIhavespokenrepeatedlyabouttheblessedobstacles,buttherearefewwholovethestruggleforachievement.However, it is inevitable to become used to the struggle, becauseotherwise it is impossible to temper the blade of the spirit. Forearthlyprogress,aswellasforthefar-offworlds,obstaclesandtheability to conquer them are needed. To be at rest does not befit aHierarch.

186.Thus,Weadvisegivingmuskforstrengtheningactivity,but

We are definitely against narcotics which calm and deaden theintellect.How,then,willthequalityofthoughts,soneededforthefuture life be developed if we dull it with poison? But medicalscienceislavishinproducinglivingcorpses.

187. It is correct to understand the eternal struggle, and to

prepareone'sconsciousnessasiftofaceanexplosion,foronlythiswill correspond to reality. My Hand will not tire in leading thecombatants,butMyEyecannottoleratethesightoflethargyintheintoxicationofcomfort.HavingInfinitybeforeone,yetnotlosinganhourandvaluingtheuseofeachminute—isYogism.Whenthespirit naturally adheres to the Higher World and kindles a row oftorchesoftheheart,onecancallitarighteouspath.

188. Spatial Fire is attracted to the earthly crust, and many

subterranean manifestations fill the records of the planet.Certainly all events are tightly linked with humanity as well aswithensuingactions.Thusthemanifestationsevokedbythespiritof humanity create the Karma of the planet. How many of those

perturbationsareevokedbythespiritofhumanityandthequalityof thought! Therefore the coordination of the trend of thoughtwith the created affirmations stratifies space which is saturatedwiththemanifestationsofSpatialFire.Thusthelifeoftheplanetisforged, and the striving of humanity must be directed to thepurificationofspace.

189. Thus, thought can be commanded to direct itself to a

benevolent intention. Humanity dreams of a better future, still itdoes not know how to pierce the depths of darkness, because thebasis manifested by the Cosmic Fire is not observed in life. Thelawsofgravitationhavelosttheirsignificance,henceonlythelawof purification can provide that which the planet has lost. Verily,only purification can provide the essentials for efflorescence. Thekey is within the spirit, and only this key can vouchsafeachievement. Hence, on the way to Us, the entire beauty of spiritmustbeunderstood.

190. It is necessary to understand it literally when I say that a

considerablenumberofsicknessesshouldbetreatedwithpsychicenergy.Infectionofthenervesubstancewillalwaysbetheprimarycause of various diseases. In the infection of the nerve substancetheHigherWorlduniteswiththelower;throughagapinthenervesubstance any intruder can penetrate, beginning with obsessionandendingwithcancer.Yetthenervesubstancecanbeprotectedonlybypsychicenergy.Thistrainingofpsychicenergywillbethetrue prophylaxis of humanity. At least a pure thought can beapplied, thereby protecting the entrances to the nerve spheres.Even such a simple measure will be useful. Also, psychic energywillbethebestpurificationduringtheperiodofahiddendisease.Butterribleisthedecompositionofthenervesubstanceundertheinfluence of drunkenness and all kinds of vices. Ponder upon thestate of the subtle body, when the subtlest nerves assume thesignificance of a skeleton! Bones belong to Earth, nerves to theSubtleWorld,LighttotheSpirit.

191. But again I shall turn to Hierarchy. Nothing can so greatly

strengthenthenervesubstanceastheChainofHierarchy.Buthow

tostrengthenmanintheimportanceofacceptingHierarchy?Eventhose who hear about it do not accept it as a vital condition, andthusharmthemselvesandthegreatPlan.TheharminflicteduponHierarchy has no equivalent and cannot be expunged. I cannotevencallitanerror.Itisalreadyapostasy—notlevity,buttreason.

192. Striving toward constant abiding with Hierarchy can

providethenecessarysteps.Howcanatreestandpowerfullyifonetriestouprootit?Onlycontactwiththepurecurrentgivesbalanceto the forces. Hence, only the roots of Hierarchy can uphold astructure.Eachdigressionbringsharmtothemightygrowth.OneshouldbeconsciouslyaffirmedintheunderstandingofthePowerof Hierarchy. Through the clefts caused by disrespect to theHierarchy,blackforcescreepin.Hence,onemustunderstandunitywith the power expressed by the Higher Might. Thus can oneattain.

193. He who strives upward without Hierarchy may be

comparedtoanarcherwhoshootsarrowsheavenwardwithclosedeyes,expectingthatoneofthearrowswillreachabird.Allchancemust be eradicated from life. We know in which direction wemove, and we trust our Leader—only thus will no arrows beaimlessly lost; and the Leader knows how to guard againstpoisonoussendings.However,letusreverencetheLeadernotonlyinwordsbutwithinourheart,andHewillgrow,togetherwithus;because in approaching the great we grow, but diminution isunavoidable with retreat. This law can easily be representedgraphically. Let us imagine how out of the seed of the spirit twodiverging lines proceed toward Light into Infinity and how eachrightmoveverilymagnifiesus.

194.ConstantcontactwiththeHigherReasondrawsthespiritto

higher cognizance. Constant application of higher laws brings thespirittotheorbitoftheCosmicMagnet.Invincibleisthepaththatis built by the Command of the Higher Will. The Power ofHierarchy is the Might saturated with the fire of creativeness.SubmissiontothePowerofHierarchymeanstheofferingoffiretothe General Good. How dimly this concept burns in human

understanding! The consciousness that does not absorb thisunderstandingcanonlymumblethegreatwords,beingincapableof applying them to life, because only a heart saturated with thegreatness of Hierarchy can understand the entire majesty of thecosmiclaw.Thus,theattractiontotheMagnetcantakeplaceonlythroughtherealizationofHierarchy.

195. The Chain of Hierarchy lawfully leads world-construction.

Verily, the creation of subtle bodies can be affirmed only by thesubtle matter of thought. The weaver of his own body does notsuspect what he introduces into the web of his body by severinghimself from the Highest. Therefore let us ponder upon the mostvital—theChainofHierarchy.

196. You may be asked how the entrance upon the path of

Service is defined. Certainly the first sign will be renunciation ofthepastandfullstrivingtothefuture.Thesecondsignwillbetherealization of the Teacher within one's heart, not because it isnecessary thus, but because it is impossible otherwise. The thirdsignwillbetherejectionoffear,forbeingarmedbytheLordoneisinvulnerable. The fourth will be non-condemnation, because hewhostrivesintothefuturehasnotimetooccupyhimselfwiththerefuse of yesterday. The fifth will be the filling of the entire timewith labor for the future. The sixth will be the joy of Service andcompletelyofferingoneselfforthegoodoftheworld.Theseventhwillbespiritualstrivingtothefar-offworldsasapredestinedpath.According to these signs you will discern a spirit ready andmanifested for Service. He will understand where to raise theswordfortheLord,andhiswordwillbefromwithinhisheart.

197. Do not strive to only a customary decision. One may

subjugatemanyheadsbycustomaryspeech.Butthisspeechwillbeunintelligible to the higher worlds. Earthly prosiness sounds likethe barking of a dog. No magnet will attract such a husk, and firecannot burn without oil. But let us discriminate betweencommonplaceness and daily labor, because many people seekcontradictionwhereitdoesnotexist.Noticesuchpeople;theyarenotsuccessful,becausetheirthoughtiswithyesterday.Letusnot

be bound by anything of the past. Also do not look for friendsaccordingtoyesterday,andknowatoncehowtotesttheirhearts.

198. With the growth of assimilation grows the feeling of

responsibility. Facing the Great Plan, understanding ofresponsibility must be made manifest, therefore with eachdecision the full feeling of responsibility should be realized.Complete responsibility imbues one like Spatial Fire. Fullresponsibility must imbue each action; for the feeling ofcontainmentcanonlybeaffirmedwhenthesenseofresponsibilityimpelsthespirittothefulfillmentoftheWillofHierarchy.Hencecosmic daring suffuses the Carrier of Fire. Therefore theaffirmation of the Higher Will can be realized when the spirit istrulyfilledwithresponsibility.Thus,victoriesareachieved.Thus,thoseareinvinciblewhofulfilltheWillofHierarchy.

199.ThefieryEnvoyoftheHierarchyactsasamightyfieryWill.

The Hand of a Hierarch directs as a Higher Hand. The Hierarchsaturates as a propelled magnet, hence one must act consciously.Thus, the spirit striving to the realization of the Teacher can beaffirmed on the path, but the spirit rejecting the concept of theTeachermaybetraytheHierarchy.

200.Thus,oneshouldfulfillallthatispreordained,applyingan

understanding of the best date. Thus, one should remember howgreatlythedesignofgrainsofsandischangedunderthestrokesofdifferent fingers. Even the fingers of one and the same handproduce different designs to one melody; still more diverse is therhythm of different people, but a fiery heart perceives the subtledifferencesinrhythm.Straight-knowledgeisthekindledfireoftheheart. It is difficult to express in words when this string of theheart will resound, but Hierarchy can point out this hour oftransfiguration.

201.Whentheworldisconvulsed,thesignofMaitreyaisgiven

as an antidote. When the foundation of Our Works was laid, theforces of the spirit were strengthened. Thus the sign of Maitreyahas been affirmed. And in Our Day, when the manifestation isaffirmed, one can repeat, How vitally the power of the spirit hasenteredintolifeandhowgreatlythisnewpowerhasbeenaffirmedin consciousness. Hence, the consciousness must be applied to amighty understanding of Hierarchy, which holds the chain of allstrivings. Thus, each manifestation of beauty placed by Us in thefoundationofOurWorksmustbeacknowledgedasavitalaction.Thusthepowerofthefoundationconsistsinbeauty,andstrivingto the fulfillment of the Higher Will, will lead to the predestinedvictory.ThusOurTowersshouldbebuilt,verily,inbeauty!

202. It is premised that around good deeds difficulties always

arise. What does this prove? Does it prove the weakness of Lightand the power of darkness? Let us remember, however, that withdeveloped vision many things are perceived. Similarly, a refinedspirit perceives much that is inaccessible to deadened senses.Besides, are we not in need of a counteracting force in order tobecome accustomed to withstanding the unmanifested elements?This benevolent force of resistance is apprehended only in actionand is accumulated as an armor of the spirit. Can one complainaboutthedevelopmentofresistancetoevil?No,certainlynot—thisarmor of the spirit is not only a defense it is also a magnet whichattracts allies. Therefore, bless everything that develops

counteractionandresistancetoevil.203.Youmaymeetpeoplehasteningwiththeirattainments,and

they may think that We are slow. But lead them under the nightsky and point out the radiance of the countless worlds. Say, TheLordleadsyoutowardthiscreativeness.Isitpossibletobeslowonthisgreatpath?Wemustprepareourselvestobeco-creators.It isnecessary to preserve and multiply the seeds of consciousness,because the entire world is sustained by the power ofconsciousness. There is no power to withstand a consciousnesspurified of egoism. One can prepare oneself to cross all bridgeswith a fiery consciousness which is atremor with the pulse ofCosmos,andwhich,intheseedofitsspirit,respondstoalltremorsof Earth and knows the truth of the peoples. One can apply allsacredpowersofthehearttobecomingco-creatorsoftheflamingLogoi by conquering death. But so long as such daring is notinstilled in the heart, the consciousness cannot grow infinitely inthisdirection.WecallitViaReale.Therefore,FiatRexiswherethespirit,reverencingHierarchy,dares!

204.Intothebaseofanaffirmedorbitthereisalwayssetasingle

will, which binds all manifestations. Therefore, the focus is theradiating source that imbues all with fiery creativeness. Beautifulisthewillthatimbueswithcreativenessandimpelseachenergyofthespirit intothe higher spheres. Hence,the orbitthat is builtbythe manifested will is expanded by the Spatial Fire throughassimilation of the saturated fires and by its correlation withhigher spheres. Thus, a great thought brings the spirit to greatattraction, and the Will that radiates the highest fire attracts thespirit into the highest orbit. Thus, wondrous is it to be attunedwiththeHigherWill.Verily,onlythusarerevealedtheorbitsoftheInfinite.

205. Therefore the powers of the Cosmos are so affirmed in

space. Each center feels each vibration; therefore, during thechangingcurrentsthefierycentersaresosensitive.Therefore,thehealthmustbeguarded.

206. The experiment with the densified astral body, insubstance, is not an attempt, but a plan-fitting inception of theSixth Race. It should not be thought that a densified astral bodywill remain unstable for a long time. The preparation that cansufficiently densify it has already been found. Thus, amidst theearthlyturmoilWeassembleanewrace.Certainly,meanshavetobe found which will purify the lowest strata of the earthlyatmosphere.Butalreadytherearesomepossibilities.Theemulsiongiven to you pertains to the remedies for purification, destroyingpoisonsthroughthepurefilmoftheskin.

207.Letusnotthinkthatthenextracewillfallfromheavenon

rosy wings. No, here also one cannot dispense with a laboratory.We welcome it if now thoughts about the transformation of therace are strengthened. For this, we shall not resort to the help ofmonkeys, but shall turn to the foundations of human nature andadd the accumulations of the vegetable and mineral kingdoms.Thus the human spirit will receive a regenerated garment.Precisely, man can and must think of the future, not withprejudices,butstartingfromthefactsoftheexistenceofbodiesofdifferent degrees. If such degrees exist, then no one can maintainthatintermediatestagesbaseduponmutualadvantagemaynotbefound.ItisdifficulttounderstandHierarchyifitscontinuityisnotcomprehended.Similarly,thevariousdegreesofbodiesexistwhentheyaremutuallynourished.

208. You can understand how the black lodges oppose

humanity'sperfectment,howtheypreferthefateofAtlantistothelight of a new body. Let us be on watch, let us be vigilant, let usfollowtheLord!

209.TheaffirmationoftheTeacherintensifiesallcreativeforces.

Without the Teacher there can be no link in the great chain ofcreativeness. Hence all the forces of Cosmos which manifest thecourseofevolutioncanbeaffirmedontheprincipleofHierarchy.Howcanonebuildwithoutthefocusofattraction?Eachforcehasits own tensions, which call forth creative strivings from thesource of cosmic fires that gathers Light and spreads Fire around

itself. Verily, thus is the Cosmic Focus affirmed, and life must bebuiltaroundafocus.Creativenessislimitless!

210. Therefore, only through broad realization of the focus can

the best manifestation be attained. When we cognize theaffirmationofHierarchy,theneachactionhasitsfocus.Hencetherealization of the focus is so important. The hand that hesitatesafter realizing the focus is in need of strengthening. Thus, let theconsciousnessexpandinthedirectionofthefocus.ThustheGuruandtheTarahavebroughttheentirecreativefire.

211. Thought is the basis of creativeness. It can be visible and

measured. One has to regard thought as the creation ofindependent action. From this understanding issues a correctattitudetowardtheconsequencesofthought.ItisoftenaskedwhyWedonotcutofftheconsequencesofathought.Butthoughtisanewborn entity of the spiritual plane. Notice, thought is not anabstraction, not a substance, but an entity with all the signs of aself-sufficient existence. As an entity of the spiritual plane,thought cannot be annihilated. It can be opposed by a similarentity of greater potentiality. In this lies the essence of TacticaAdversa, when a monster is permitted to attain its completeugliness in order that afterward it may be destroyed by a ray ofLight.HierarchywillbethebestpledgeofthetruemightofLight.

212. Call Hierarchy your touchstone, upon which you can test

theefficiencyofquality;forifyoudonotadmittheexistenceofthebestandthemostluminous,thenthereisnoneedtosafeguardandperfect your own Monad. The existence of Hierarchy is thefoundation of the entire life. Remember that Hierarchy actsthrough the legion of Service. Do not delay in assembling theselegions, for there is no task more successful than Service toHierarchy.

213.PowerdirectedfortheGeneralGoodisalwaysmultipliedin

space, and there results a link with the higher spheres. But thatforce which emanates from evil becomes a boomerang. Theformation of affirmed emanations gives power for the saturation

ofspace.Themanifestationofevilarrowstensestheloweststrata,whichbecomedensifiedtosuchanextentthatareboundingblowis inevitable. Thus, each thought that is attracted to Light drawsafter it a bright radiation, but an infected arrow can pierce thecrown of the sender's head. There are many such manifestationspointedoutuponthespiritualplane.Hence,spacemustbeguardedagainst infection, and the quality of thought must be kept high.Thus,onemaymanifestconsciouscooperation.

214. Certainly, when the black lodge directs its arrows against

theWhiteBrotherhood,theconsequencesareself-destructive,andthemanifestationofareboundingblowisunavoidable.Whatyouheard is a consequence of self-destruction, because the aimedarrow returned to the sender. Hence, let each one be affirmed inthe understanding of Our Power. Nothing can touch the one whoevidencesafullfaithinOurMightandintheHierarchy.OurRaysare always on watch and Our Hand is indefatigable. Thus the fullMightofHierarchymustbeunderstood.

215. Thought is a spatial entity. Much attention is given to

thought-forms, but, except superficially, little acknowledgment isgiven to the effect of thought, whereas it is precisely theconsequences of thought that most seriously strike thesurroundings with their effect. Sound reacts upon the mostunexpected objects. The reaction of thought is just as subtle. Hewhoindulges in self-pitymay lose money,or ifhe is wrathful,hemay be subjected to serious incrimination. Thus, various are theeffects of wandering thoughts. One should remember that nothoughtcanremainwithoutconsequences.Itmayaffectapersonwho is far away, but in this person the ball of fate will find itsgenerator.Certainlytherecanbenoaccidentinthis,yetthedesignoftheflightofthoughtissocomplex!Theconsequencesofthoughtshouldbeobservedasmuchaspossible.

216. All physical tension should be eliminated, for one cannot

playtheviolinwithabroom.Also,laughtercausesdisturbanceofthe closest strata of the atmosphere. When the heart is aflame, itresounds like a bell upon the far-off distance. It is rare to hear a

Yogi laugh boisterously, for his joy is not in loud laughter, but inthesaturationoftheheart.Precisely,"joyisaspecialwisdom"notonlyinitsessencebutalsoinitsexterior.

217. One of the mighty qualities of spirit is steadfastness. How

can one develop and expand one's consciousness whensteadfastness is lacking? How else can one verify intentions andactionsifthereexistsnosuchmightyimpulseassteadfastness?ForeachoneonthepaththereisbutoneimmutableMight—Hierarchy.Upon this sacred Principle one may construct; from this sacredSummitonemaycontemplatetheworld;uponthisStrongholdthespirit becomes winged; upon this Summit can be built a mightyevolution. Therefore, when the spirit tries to create an illusoryworld of selfhood, it is certainly difficult to advance. Thus, inlimitlesscreativenessthereisthebeaconfire—Hierarchy.Thus,bysteadfastness in Service one can broaden one's consciousness andencompassthelawofFieryHierarchy.

218. Hence, one must remember that disparagement of

Hierarchy is treason; that indifference toward Hierarchy istreason; that a negligent attitude toward all that pertains toHierarchy is treason. Thus, We affirm that responsibility must berealizedforeachspokenword,foreachdeedandeachaction.

How can one not be affirmed in a fiery transport to Hierarchywhen the most sacred fire is Hierarchy! Therefore, let each oneponderonhowbettertoserveHierarchy,eliminatingallevidencesof selfhood, disparagement, levity, and the standardized formulasof the crowd. One should cooperate more fittingly, consciouslyacceptingtheFieryHierarchy.

219. The language of the subtle body is expressed through the

saturation of the Brahmarandhra center; other than this, there isno need to strain oneself in pronouncing all letters. The sound ofthe first letter is sufficient, because the rest is understood by theheart.Likewise,themusicofthespheresdoesnotrequiremelody,but is based upon rhythm, for the rest resounds in the heart.Precisely the heart is the link between the worlds, and only theheart can respond to the heart of the Lord and to the entire

Hierarchy. One may be bereft of sight and hearing, but the heartwillbethebestsubstitute,andevenamoresubtleexpresseroftheessence.

220. During cosmic perturbations the spirit verily begins to

ponderoverthepagesofBe-ness.Whenfearovercomesthespirit,every constructive will is paralyzed, and construction is stopped.The more powerfully must that spirit build which knows that afiery striving leads it to mighty knowledge of the Cosmic Magnet.Therefore,thosewhofollowHierarchymustberidoffear,fortheheart that contains the greatness of the Plan is invincible; andunderthefieryShieldofthepowerfulHierarchythegreatfutureisbeing built. Hence, amidst all cosmic perturbations and vitalchanges there is but one anchor—Hierarchy. In it is verilysalvation!

221.WhenWeassertthatHierarchyistheShield,itmeansthat

upon it is based the principle of the fundamentals of creativenessofthesaturatedfire.Therefore,WehaverevealedtotheworldtheCarriers of Fires, and have given the manifestation of Beauty.Therefore,letthedisciplesspirituallyupholdthatprinciplewhichislifeitself.ThespiritualizedSourcewhichimbuesallworksmustbeaffirmedintheheartandconsciousness.

222.Unusualnessisahappyqualityofeachdecision.Letustake

the instance of an illness. The physician may give his bestdiagnosesandallhismedicines,butthisusualwaymaynotleadtoimprovement. But a Yogi gives advice, and this unusual decisioncreates a strengthening condition. The medicine of a Yogi is notfrom an apothecary and avoids narcotics, but it contains thesecretions of glands which, like food, strengthen the substance ofthe nerves. The same property is possessed by the secretions oftrees, the resins of which can carry through the pores of the skinthe same fortification for the nearest nerves. Certainly, purifiedresincanbetakeninternally.Thebestpurificationwillbethroughthesolar ray,but this requires a long time, becausethe processofsedimentationisveryslow.Eachoilmaybepurifiedjustasslowly,but this purification is not to be compared with any chemical

process. Thus the unusualness of the Yogi's advice has anadvantageovertheusualnessofthatofphysicians.Thusact.

223. All events collect around one focus. All signs point to the

one focus. One manifested fire exists in everything, the seed ofwhich attracts all corresponding energies. Thus all cosmic eventsare fulfilled. Hence, only a full realization of the one focus candirect the spiritual quests to the affirmed seed. The immutabilityof creativeness enters vitally when the focus is realized. For thus,verily,strivingentersintothechannelofaction!Therefore,onlyinthis way can we attain steadfastness of spirit. Thus can one beimbuedwithasubtlerealizationofInfinity.

224. Hence, so beautiful are the strivings to the single focus of

Hierarchy. Only thus can one assimilate all the Commands of theHighestForces.OnlythuscanoneapproachOurOrdainmentsandadhere to fiery creativeness. The fiery focus, all-illuminating, all-containing, gives life to each creative inception. Therefore it is soimportanttocomprehendHierarchy.Yes,yes,yes!

225. Pay attention to a special characteristic of all animals and

birdsthatexudesecretionssimilartomusk.Thefursandfeatherscontain an oily substance, as well as heat, as if a kind of resin ormountain oil had saturated them. The plumage of the birds takesonametallichue,asaresultoftheirfeedinguponrootsandgrainsthat contain much psychic energy of the vegetable kingdom, inother words, of resin. Minerals also give out psychic energythroughthevegetablekingdomorthroughtheair,wheretheFireof Space has the same properties as thought manifested by thespirit. One can now understand the ancient comparison thattermed thought a flame. What remarkable experiments could beperformed by linking a chain of reactions of the psychic energyfrom minerals to the subtle body! One could observe how variedwouldbethereactionsofthefursandfeathersofcertainbirdsandanimals. Is it casual that in the ancient palaces and templesmetallicpeacockswerekept?Onemayponderwhymuskanimalsandmonalbirdsbreedatalmostequalaltitudes.Aretherenotthesamesoilsontheheightsasintheplains?Whenweshallpurifythe

atmosphere of the plains we shall have to pay attention to thedepthsofEarth,invokingtheirpsychicenergy.

226.Thefocioflifeshouldbegathered.Thusisaccumulatedthat

quality which is called culture. Culture cannot be createdinstantaneously.Norcanthefocioflifemaketheirappearancelikecannon balls. Thus, the manifestations of life demand tuning likethe instruments of an orchestra. It would seem that I speak ofvarious subjects, yet they are all nothing but Fire, Energy,Hierarchy!

227.Thevitalityofalloriginsisaffirmedbythefieryprincipleof

Hierarchy. Only the principle of the Highest Hierarchy affordsbalanceandstrivingtoeachaffirmation.Therefore,inestablishingcosmicprinciplesthemainimpulseistheChainofHierarchy.Thecreativeness of humanity depends upon these affirmations, andonly adherence to the Highest Chain affords the necessary force.Thus,eachchainisalinkofagreaterchain,andthemightofthisChain reigns in Cosmos. Hence evolution intensifies each smallerchain,linkingittothegreat,limitlessChainofHierarchy.ThustheMightofthefieryHierarchysoarshigh.Yes,yes,yes!

228. How, then, can one be affirmed in the Chain of Hierarchy?

Only through the heart and endless striving toward Service, onlyby complete assimilation of the Plan of the Lords and throughcreativeness of the spirit. Thus, verily, each one on the path mustaccepttheServiceoftheheart.ThustheimmutabilityoftheChainofHierarchyisverilyaffirmed.

229. Origen reasoned, "Does Bliss emanate or is it sent?" Being

aware that Bliss is an absolutely real substance of the highestpsychic energy, one can understand that this reasoning had asoundbasis.Thus,heatemanatesfromlight,butaburningglassisneeded to produce fire. Psychic energy certainly emanates fromeach organism that possesses it, but in order to receive a directresult one must gather and focus it consciously. Thisconsciousnessislikeaburningglass.Itisnecessarytodiscriminatebetween an unconscious flow of psychic energy and a sharpened

arrowofpreciseconsciousness.Ifeventhehighestenergydoesnotreachthegoalwhensentunconsciously,thenhowgreatlyinneedofafocusishumanenergy!Destroythefocusandthefirewillnotbe manifested. Without fire, darkness and cold await us. Let usrememberhowthevivifyingheatandLightcanreachus.

230.Oneshouldlearntovaluethewarmthandlightofthefocus,

and remember that the rays of the One Light emanate from onedirection. Let us compare our position to a physical law and weshallseethesolefoundationforsuccesswhichisunshaken.Whatissuccessifnottheeffectofthecorrectapplicationofalaw?ThusonemustlearntosensethechannelofHierarchy.

Thus,oftenwillhebeheldresponsiblewhodidnotknowhowtorule, because weakness is not a justification. Where there is aburningglassthereisalsofire,foritisnotdifficulttowaitfortheray of the sun. We have been waiting for centuries; it is lessdifficult to wait for days. Remember often that Bliss is above youandnotbeneathyoursole!

231.Whenspaceissaturatedwithfires,eachclusterscintillates

inthecenters;therefore,asensitiveorganismfeelsallapproaches,and each change of cosmic currents is reflected upon the centers.The affirmation of consonance acts upon the centers, and eachvibration reflects on a particular center. Likewise, each planetaryeventisreflected;andduringrevolutionsandshiftingsasensitiveorganism resounds to each affirmation. Science will take up thequestionofconsonance,anditwillbepossibletodetermineexactlythe action of intuition in accordance with the sensations of thecenters. Only by such investigation of consonances will it bepossibletodeterminethecauseandcooperation.Hence,thestudyofconsonancesisthescienceofthefuture.

Thus, when the centers vibrate it means that the Spatial Fire israging. The energies propelled to the subterranean fire rushforward powerfully. The cosmic consonance intensifies allresoundingcenters;therefore,itissoimportanttocarefullyguardthehealthandtheresoundingcenters.

232. Even the best friends test each other with some ingenious

move at chess or through a dangerous hunt. Even in a besiegedfortressthearmycarriesonmaneuversinorderthatthehandsofits members may not grow stiff. And those defeated are notoffended,nordotheconquerorsboast,sinceitisonlyanexerciseinresourcefulness.

I remember how once "The Light of the Eyes," Jehangir, camerunning and complaining that his playmate, Jeladin, had pushedhim severely. We asked, "How did it happen?" "Jehangir was ahunterandJeladinthetiger."Isaid,"Itwouldbeamazingifatigerweretobetransformedintoadove.Thankthycomrade,whogavetheetheimitationofthefuryofabeast.Tomorrowweshallgotohunt real tigers; be resourceful with them. But remember that arulernevercomplains."ThusithappenedduringthetimeofAkbar,theunifierofIndia.

We must firmly remember to what the understanding ofHierarchyobligatesus.Onecanseehowusefularetests,otherwisethe light that is kindled only in battle will grow dim. The light ofbattleanddaringisthemostprecious.

233.Itisnecessarytobecomeasaccustomedtobattleastodaily

labor.Oneshouldunderstandabattlenotonlyasatestofexcellinginstrengthbutalsoasasourcefortheaccumulationofenergy.Wecannotthinkofmasteringtheelementswithoutabattle.Andhowreadymustwebeatacall,forotherwisewemaywastetheactionoftheHigherForces.Hierarchydoesnotmeanthesteadfastnessofrepose,butsteadfastnessinthemidstofbattle.Cansomethingelsebe substituted for battle, when Our Magnet is tense and eachvictoryisthejoyoftheentireHierarchy?Ifitisdifficultforsometo accept Hierarchy through love, let them accept it as afundamentalnecessity.

234.AllnationsknewaboutGuardianAngelsandhavepreserved

these traditions for millenniums. All Teachings knew about theMighty Protectors of humanity who guided nations. Why, then,has our time denied the Highest Leaders? When has the worldexistedwithoutProtectors?AndhowcanhumanitybeaffirmedbytheconceptoftheabsenceofaLeader?ThebasicprinciplesofBe-nessareintensifiedbythelawsmanifestedbytheLeaders;andthe

cosmic laws do not change, but grow with cosmic affirmation.Therefore, the Protectors of humanity and the almighty GoddessFortunacreatehumanity'sdestiny.TherealizationofthisgreatlawcanimpelhumanitytowardtheChainofHierarchy.

235. Hence, each spirit must understand the Hierarchy as

Protectorsofhumanity.Thusevolutionisbuilt,andcreativenessisfierilyaffirmed.Thusthelawisaffirmed;onlythusislifesuffusedbythegreatmightofunity.Thusislifecreated.

236. It is correct to investigate the importance of vitamins, but

one should also experiment with the reaction of psychic energy.Onecanseethataconsciousconsumptionofvitaminsmanifoldlyincreases their usefulness. Likewise, it can be observed that theabsorptionofvitaminswhileoneisirritatedmayincreaseimperil,since an unconscious energy is strengthened at a point whereconsciousnessisgathered.Onecanunderstandwhythepartakingof food was considered sacred by the ancients. It is easy tounderstandtowhatanextentrealizationmultipliesallenergies.Somany simple experiments can be performed with a minimum ofobservation.Inordertoincreaserespectforconsciousnessonemaycall energy Atma, or psyche, or life, or consider it sacred, but it isnecessary to study its significance. By this channel we approachFohat, or atomic energy. It is essential to observe the microcosmandtransfertheformulatotheInfinite.

237. It is necessary to find a few Western scientists who could

free themselves from prejudices and begin to investigate theconditions of psychic energy. Certainly, the heights of theHimalayaswillprovidethebestpossibilitiesforscientificresearch.

238. How powerfully is cosmic energy reflected in the human

organism! Each cosmic fire meets consonance in the humanorganism.Howmuchcanbelearnedthroughaspiritualapproachtotheinvestigationofallmanifestationsofthecenters!Ifonewereto consider the human organism as the reflection of themanifestations of Cosmos, many consonances could be perceived;and the centers would become a fiery manifestation for science.

Onlyaspiritualapproachwillrevealthesignificanceofallcosmiccorrespondencesandtheirhumanreflections.Thecentersmayberegardedasaccumulatorsofcosmicenergies.Itiscorrecttothinkaboutdirectnourishmentforthehighestcenters.Thesolarplexusabsorbseachenergythatissentandconsciouslyfeedsthecenters.Thus,comprehensionofthefierycentersisthemostessentialtask.Medical science will be able to diagnose a disease only when itknowsitscorrespondencewithcosmicenergies.

239. Only through a spiritual approach can one come closer to

Hierarchy. Consonance of the heart and understanding of thepower of Service must underlie the foundation of all beginnings.Each deviation from the focus will become a target for a hostilearrow. Therefore one can become a co-worker only by defendingthegreatFocus.Verily,onlythuscanoneattain!

240. When people shall investigate not only fires and rays but

alsohumansecretions,thenonemaythinkofachangeofthebody.It is strange that people understand the powerful chemicalprocesses that take place in their organisms and at the same timeconsidertheproductsoftheseprocessesonlyasrefuse.Onecanseehow powerful is the blood or saliva. One can see what unusualstrengththebloodofthevegetablekingdom,valerian,transmitstoaplant.Equallypowerfularesalivaandtheothersecretionsoftheglands.Butonemustobservethecausesofincreaseanddecreaseofthereactionoftheenergyoftheseproducts.Thesalivaofwrathispoisonous, and the saliva of benevolence is beneficial. Is it notimportanttoinvestigatesuchgenerallyknownmanifestations,forwhichmechanicalequipmentcannotbesubstituted?Thusweshallagain approach the lost knowledge regarding the substance ofpsychic energy, that mysterious Atma, which in ancient medicalsciencewasfoundinusingtheproductsoftheglands.OnemustbeabletoopposethefieryelementbyAtma,whichisincombustible.

241.Atmamustbeunderstoodastheenergyofspacepurifiedby

unceasing rotation, like a great churning. One must understandhow the spirit and Atma cooperate like electron and proton. It isnot Our custom to deliver a course on the chemistry and

biochemistry,butOurtaskistoprovidetheimpetusandtodirectattentiontothegreatestneedanddanger.Justnowisperhapsthemost dangerous time! One can withstand it not only by thestrengthofthespiritbutalsobymeansofone'sorganism.

242.Certainlythedarkforcefearsmostofalltheaffirmationof

Light. All servitors of darkness intensify their forces when theservitor of Light imbues space with the Decree of the Lords.Humanity knows great examples of such battle and victory ofLight.CertainlyeachonereceivesaTeacherinaccordancewithhisownconsciousness.Itisthesamewiththechainofthedarkones,who are filled with the consciousness of evil, setting up theirdecision against Light. Thus, the forces are strained in Cosmos bydiverse affirmations. Therefore one may affirm that Lightconquersdarkness.ThusthelifeofInfinityisbuilt.

243.ThelegendaboutSt.Christophercorrespondstothelegend

about the Burden of the World. People must feel a certain burdennear those boundaries where the spirit realizes the manifestationof Infinity. The other kingdoms of nature do not know thisanguish, because they have not reached the stage of a perceptiveconsciousness.Indeed,theconsciousnessesofmanypeoplearealsoasleep. But the Burden of the World is unavoidable for those whohavealreadyponderedaboutthefar-offworlds.

244. The same people will understand that silence is not

inaction. When I advise silence, it does not mean to merge intosleep, but on the contrary, to resound to the Might of Hierarchy.One must train all seven-year-olds to remember the Hierarchy,becauseaftertheseventhyeartheconsciousnessalreadyacquirestracesindeliblefortheentirelifetime.

245.Therearemanyshiftingsinspace,anditisnotastonishing

thatthecurrentsaretransmittedbynewrhythms.Theserhythmsare quite difficult because they arise from incidental vibrationsduringcollisionswiththecurrentsofspace;thewaveistenstrokestoo long and on account of this is fatiguing. Moreover, it isimpossibletoforeseethegenerationofnewnebulae,becausethey

are created by the shifting of the currents. One can perceive thenewlyformednebulaeonlyatthekindlingofthelastfires.

246. In cosmic creativeness the Spatial Fire approaches the

earthly firmament when all corresponding energies are tensed.Creativenesscanenterlifeonlywhenallleversareimpelledtowardshifting. Therefore each shifting of a nation is manifestedconformingly, and the old is replaced by a new course. Thereforethe karma of each shifting is ordained by an entire sequence ofcorrespondingaffirmations.Theearthlycrustcarriesmanytracesof karma, and they must be shifted for renovation. Thereforehumanity must strive conformably for renovation. The greatestandtruepathisHierarchy.

247. Thus, during cosmic shiftings a new keynote must

definitely resound. Each step has its own manifested karma. Forthe new Manvantara one must saturate space with the call toHierarchy. Only thus can the best foundations of Existence enterintolife.Hence,OurTeachingissovital;hence,OurHierarchyissomighty;hence,thegreatFocusisgiven,foreverythingisgroupedaroundtheseed,andeachstephasitsownsaturation.

248. Each ploughman will say that he wants the plough that

makesthelargestanddeepestfurrow.Indeed,whycrossthefieldtwice, and why not reach the fertile strata? Let the depth of thefurrow be reverence to Hierarchy and the width of the furrow besteadfastness of motion. Let us watch where there is a lack ofreverenceforHierarchyandwherenon-fulfillmentofCommands.Let us notice where there is readiness to retreat. Each harm mustbe eradicated. Rising in spirit one should watch where are theunprotectedspots.

249. Certainly, the evolution of the spirit requires refinement,

without which it is impossible to build. Each one who considershimself a server of culture must accept the affirmation of therevealed synthesis, for how are the steps of culture to be builtwithout a cautious attitude? Therefore, each foundation must beguardedforaffirmationtotheworld.Cultureisbuilt,notwithan

attitudeofcoarsenesstowardthesubtleenergiesandthought,butby a creative attitude of caution and responsibility. Hence, whileconstructing, one should remember about refinement and aboutstriving to the higher spheres. Thus the evolution of the spirit isachieved.

250.Forgetfulness,distraction,duplicity,curiosity,belongtothe

imperfections which must be eradicated. Any of these qualitiesmayberegardedastreason,foroutofthemissuesthelowest.Oneshould understand how unavoidable for oneself are theirconsequences. A small consciousness is engulfed in mistakes and,tryingtojustifyitself—inotherwordstolietoitself,actuallysinksto the bottom. It can be observed through many lives how thegardenofeffectsblossoms.Soonerorlateronemustbeconvincedoftheharmofmistakes.Themaintouchstonewillbethequestion,"Istherenotreason?"Onemustintheendrealizehowmanifoldistreason.Besidestheclassicalkiss,theremaybefoundmanysubtleaspectsoftreason.

251. Each stage of development requires its own tension. So

many manifestations affirmed through development are lostbecauseofnon-conformity.Therefore,fortheassimilationofgreatplans great measures should be applied. How can one instill in asmall consciousness the concept of Hierarchy! Each dwarfconsidershislaborthemostimportant,butintheServiceofGiantsthe measures must be affirmed by the spirit. Verily, one must co-measure between mighty measures and the kingdom of dwarfs.Hence, on the path it is inadmissible to apply measurescorrespondingtothekingdomofdwarfs.Greatwaysrequiregreatunderstanding.

252. Therefore, when striving saturates the spirit, the

understanding of the need for higher measures is establishedcorrespondingly. Thus, to advance one should understand withwhatcareHierarchymustberegarded.Therefore,onemustaffirmone's consciousness upon the great concept of Hierarchy. Thus,without the manifested focus there can be no attainment orconstruction.Creativenesscanbedevelopedonlybyaffirmationof

thefocus.ThusIordain.253. Many legends express the danger of having several Gurus.

Letusciteoneofthem."Onepiouswomanhadthreesons.Eachofthem had chosen a venerable Rishi as his Guru. But one of themconceived the idea of increasing his powers by asking two moreRishistobehisguides,thoughhismotherhadwarnedhimofthedanger of such a thoughtless action. The time came when theRishisbegantoteachthethreeyouthstofly.Thethirdyouthaskedthetwo otherRishisto strengthen hisflights, sothat he mightbeahead of his brothers. But the whirlwinds sent from three placescrossed and the light-minded fellow was torn to pieces in the air;whereas his brothers flew safely in the direction of the Rishichosenbythem."ThuspeoplerememberthelawofHierarchy.Onemightadoptthislaw.Fromeverystandpointofknowledgescienceconfirms other laws of life; however, one should not look with anobliqueeye.

254. Each shattering of the foundation spoils the entire web.

Striving loyalty is needed like oil for levers. For Us it makes nodifference why, despite loyalty, something is not done, but Weoftenseehowanalreadyripechemicalreactionisdissolved.Thus,one should sharpen the blade of the glaive, because success is notfarther away than the length of a spear. Guard the concept ofHierarchy.

255. Construction is in need of firm foundations, and only the

unwaveringness of the spirit can affirm the needed direction.Therefore, when the builders of life strain their forces forconstructivity, it is always with cosmic assertion. Thus thebuilders of life carry the Higher Will, and the might of the firedirectsthespirittowardtheCosmicMagnet.Thus,thebuildersoflife verily know the Higher Will. Creativeness is transmittedthroughtheaffirmationofHierarchy,andonlywhenthespiritcanstrive toward realization of the main foundations can creativecorrespondencebeestablished.Verily,Hierarchyaffordsacreativechain and constructivity in life. That is why We so often repeatabout Hierarchy. That is why We direct thoughts to the

foundationsofHierarchy.ThatiswhyWeintensifyallforcesforafull adoption of the focus. Verily, only thus can one conquer andattainthepredestined.

256.Itissaid,"Wherethyfoottreads,lilieswillblossom.Where

thy head rests, all the sapphires of the world will gather." Thus isthebenevolentMessengerspokenof.WhenWesendaMessenger,We do not lose time in repeating the entire Teaching. But theCommand will be contained in a few words, because the chosenMessengerknowstheTeachingandreverencesHierarchy.Tosucha Messenger the sapphires and the lilies belong. One should notreiterateatthelastmoment,forthesteedbeatswithitshoof,notknowingthelengthofthejourney.

257.Certainly,thesecretionsserveforthemostsacredacts,and

not only the substance itself but its emanations participate in thecreativenessoftheworld.WhatyourememberedaboutParacelsusand his homunculi is very characteristic, because this microcosmcanbeeasilymagnifiedtoMacrocosm.AndtheTeachingaboutthegreatspiritualsecretionshasagreatfoundation.Certainlyonecanimagine how greatly interested We are in those organisms thathavealreadytranscendedthedegreeofthe"LionoftheDesert."

258.Incosmicconstructivenessallshiftingsaretensed,andeach

nation predetermines its Karma and its place in evolution.According to each instance one can judge what step in ourevolutionwasoccupiedbythedepartednationandwhatstepwillbeoccupiedbythenationthatisbeingshifted.Thusthehistoricalstepsofourtimearediscerned,andonecantracehowdifferentlythetensionsoftheshiftingsofpeoplesproceed.Whatholdsbackanation in its historical progress? How can a nation preserve itsdrivetoascend?OnlythroughHierarchyandanunderstandingofthe Highest Will. These levers can propel humanity to thepredestined affirmation. With this consciousness one canapproach cooperation with higher spheres. Only thus can thenationalshiftingbeevidencedasanascent.

259. Thus, each spirit brings to a nation its accumulations and

actions.Thus,eachspiritstrainsitsconsciousimpulses.TheKarmaofanationcancomeclosertoascentwheneachspiritunderstandsits responsibility. Thus, one may affirm that personal, group, andnationalKarmadependuponthefullrealizationofHierarchy.ThecreativenessofOurCarriersofFires,whoaresentbyus,isaffirmedbyUsforthebettermentoflife.

260.Howoftenmustthegardenerwaterthegardenentrustedto

him? Certainly every day, except during a beneficent shower.Whenpeopleclosetheirshutters,thegardenerweavesbasketsforthe ripening fruit. Verily, the shower frees the gardener from thelabor of carrying water. Is it not the same with the Teaching?Certainly the foundations of the Teaching should be reiteratedeach day. Every hour, the Teaching should be protected from theleprosy of habit. But in the time of the whirlwind the Teaching isnot in need of protection, because in it alone will the sole hope ofmen be found. Then they will turn their heads from Earth andperhaps for the first time perceive the far-off worlds and theheavenly Fire. The gardener calls the shower a blessing. Shall wenotsaythesameofthewhirlwind,whichwillforceustothinkoftheFireofSpaceandoffutureexistence?

261. Let us not understand the cosmic whirl as do the animals,

who sense something incomprehensible and try to hide in thedarknessoftheirburrows.Anenlightenedconsciousnessdoesnotconcealthebattlefromitself,and,beingpreparedbytheTeaching,isabletobreakanyhostilearrowagainsttheshieldofillumination.Even the crashing of the destroyed hostile blow is heard. We pitythe one who receives a rebounding blow, which, according to thelaw, increases tenfold. Is it not wondrous to feel in life theapplicationofthegreatlawsofjustice?Onemayspeakofthematlength,buttheirapplicationinlifeisconvincing.

262. Our constructiveness can proceed in any circumstances of

life. Many times already you could have been convinced of thedistressfulconditionoftheplanet.Werepeatuntiringlyabouttheurgent renovation of life, but humanity is deaf. Cosmogony isserved to people at their meals with soup or desert, but not as a

foundationoflife.Thehypothesesofmanyexperimenterscouldbeadopted, but the Hierarchy will not be realized. Many blows arebeing prepared; one must adhere to the Hierarchy with allstrength! One must strain one's utter attentiveness to OurCounsels.Idonotspeakabstractly,butforapplication.

263. Each of Our Counsels was already given many times, but

people'slivesdonotchange.Yetspacemustbesaturated,fortherearemanylisteners.Whatdoesitmatterinwhatbodytheyare!Allof you feel the great tension; each in his own way feels thepredestinedyear.ThereforeIsay,Guardyourhealth,preserveyourcourage, because without Us there is no advance. Harken withthreeears.

264.Itispointedoutthatspilledbloodespeciallyattractsspatial

entities.Thisistrulyso.Stillwemustnotforgetthatallsecretionspossess the same properties. In like manner each spatial entity ofequaldegreeisattractedtobloodandsaliva.Thusevenanirritatedskinisaccessibletotheseentities.Thelymphatismofmediumshasthe same property. Thus in ancient times, the priests greatlyavoided lymphatic servants and disciples. For the insulation ofsecretions,filmsoutofA.havebeenused.

The given emulsion has the same insulative quality, and it notonly protects, but increases the circulation of the psychic energy.One may observe how harmlessly the emulsion alkalizes the skin,protecting it from accumulations. Thus, the emulsion externallyandapowderinternallywillbethebestarmor.Thelymphacquiresa form of covering and even becomes beneficial. Thus, by simplemeans one can considerably protect oneself from undesirablesurroundings.

265. For the realization of Hierarchy the broadening of

understanding is necessary. Without broadening there will beneither depth nor length. Only thus will Hierarchy enter theconsciousness and be applied to life. Only thus will Hierarchytransform the concept of conventionality. The battle will betransformed into an increase of energy. Slander will become amegaphone. Fatigue will indicate the need of a change of labor.

LovewillbecomeatorchofLight.Agiftwillbecomeanincreaseofpower. Tenacity will mean the shortening of the path. Thus eachpropertyandqualitywillbetransformed.

266. The manifestation of Hierarchy guarantees the

transformationoftheusualintothevaluableandofthesmallintothe significant. It can easily be seen how the followers of theHierarchy were enriched with true values. Thus, some day it willbe possible to publish the biographies of the votaries of theHierarchy. A convincing picture will be revealed; but for results awhole-hearted acceptance of the Hierarchy, without reserve, isactuallyneeded.

267. When the chalice of world events is being filled, then the

fieryChaliceofanAgniYogiisaflame.Thelawofcorrespondencesacts powerfully. In these consonances the unity of the worlds iscontained. Therefore, when the fiery law shifts the oldaffirmations, the sensitive centers resound with the world'sreverberations. Thus, the unity is intensified with thereverberationofthecenters.

Therefore,theMotherofAgniYogafeelsintenselythebrimmingoftheWorldChalice.Hence,thefieryTreasuremustbesogreatlyprotected.Whenthetimeofthegreatfulfillmentisclose,thentheworld is in tremor; when the great shifting takes place, the subtlecenters reverberate. Thus, the world will remember the greatconsonance,andOurannalswillleavetotheworldthefierysigns.ThustheCovenantswillbefulfilled.Yes,yes,yes!

268. People hear about the application of the inner fires for

future evolution and overlook the significance of the fires for thepresent time. It will be asked, "What is the most strikingsignificance of the fire concealed in us?" It is difficult to conceive,butit is certainthat our fire is the chiefregulator ofearthquakes.Thekindledcenters,theconductorsoftheFireofSpace,quenchthesubterraneanfire.OnecantracehowtheGreatTeacherssenttheirapostles to the places threatened by a disturbance of the fierybalance. In the future, many experiments could be carried out inthis direction. Besides, the magnet of fire reacts also upon the

human consciousness; in other words, fire has the greatestapplication. Fire is the most powerful conductor. Certainly thekindlingofthefireisnoteasy,especiallywhenthecurrentsaresotense; but one may be sure that it is just this fire that is thetalismanofthealchemists,socarefullyconcealedbythem.

269. Contact with the Fire of Space strains all centers. Like a

magnetic wave, the Fire attracts the inner fires. The current ofspacerunsthroughallsensitivecentersandnerves;thereforeeachcosmic wave is so powerfully reflected in the flaming centers.When the subterranean fire seeks an outlet, the waves of theSpatialFireareintensifiedcorrespondingly.Fewarethosewhocanaffirm themselves in the understanding of the greatcorrespondences in Cosmos. Thus, the revealed law unites allcosmicmanifestations.Wemustacceptthatmightwhichleadsustothehighestlaws—theMightofHierarchy.Yes,yes,yes!

270.Simplyandpowerfully,lifeisimbuedwiththegreatlawof

Hierarchy.OneneedonlyaccepttheentireaffirmedMight,thenitwill be possible to establish the entire scope. Thus, consciousnessshouldstrivetothegreatlawofHierarchy.

271.Byfillingourlungswithairandestablishingtherhythmof

breathing,wecansustainourbodiesuponthesurfaceofthewater.Itisnotdifficulttoconceivethatwithonemorecomponentwecanwalk upon water. The fires of the lungs will add the requiredcondition. It is similar to the experiments with fire in emptyglobes;astheyfillwithgases,sotheinnerfireacts.Onemayalsoconceive of levitation through the fires of the lungs. The SpatialFire blends with the kindled centers, and, like a magnet, attractsthe fiery body. The Teacher points out these possibilities asconditions for the densified astral body. Verily, the Teachermentions the fiery people at the time of experiments for theformationofanewbody.

272. True, in irritation lies the chief harm to the fires. At the

symptoms of irritation one is advised to inhale deeply ten times.Theinhalingofpranahasnotonlyapsychicsignificancebutalsoa

chemical one, for prana is beneficial to the fires and alsoextinguishesirritation.

273. Humanity comments in its own way on each ordained

affirmation. It distorts in its own way each Ordainment fromAbove. It applies each great principle to life in its own way. Itassertseachmanifestedwillinitsownway.Howcanthegreatbecontained in the small, and the cosmic in the personal? How canthegreatServitorofReasonandofentirehumanitybeunderstoodbyaconsciousnessthatrecognizesonlyitsownhearth?Howcanaself-denying Leader become affirmed in the understanding of asmall daily routine? Only when a spark of devotion to Hierarchyburns in the heart will one find the Gates open. Only gratitude totheTeachercanrevealtheentrancetotheGates.Eachonewhohaschosen his own path must realize the loneliness of his orbit,becauseonlyloveanddevotionforHierarchyincludethespiritintheChainofLight.Thus,eachonedetermineshisownkarma.OnlythroughLightdoweapproachLight.

274.Peoplearepreoccupiedwiththedefinitionoftheboundary

between good and evil. Many legends are dedicated to thisdefinition. It is related that in order to define this boundary anArchangel placed his resplendent glaive between good and evil.Certainly, it is harmful to remain in the region of evil, but it islikewise painful to crowd too close to the fiery blade. Yet peoplestrive to wound themselves on this glaive. Therefore, let us markthe people who perceive with the eye and understand with theconscious vision of the heart. They will strive far and, as it were,draw themselves to a far-off beacon. These anchors for far-offnavigationaresovaluable.Inthetidalwavesthefetidspotsofevilare washed away. Especially nowadays should one cast thesedistant anchors. It can be seen that small distances lose theirmeaning. The great Plan of Unity comprises the expansion ofmaterialandspiritualdimensions.

275. Contact with the spatial current manifests a powerful

resonance of the fiery centers. The contact with the Spatial Firecallsforthnewtensions.Thusthegreatnessofconsonancecanbe

affirmedinCosmos.Howisitpossibleforhumanitynottoponderoverthegreatprinciplesthatguidelife?ToeliminatetheGuidingForcesmeanstoseverthesilverthreadandtoexcludeoneselffromthe Chain of Hierarchy. The planet is sick because it has lost thehighest principles. Thus, one must manifest the most vitalunderstanding of the great principles and of the silver threadwhich binds all worlds. Thus We affirm the principles ofHierarchy.

276. How many unnecessary manifestations people create for

themselves! How many superfluous karmic impediments theycreateforthemselves!Andallthisonlybecauseofunwillingnesstoadmit the Hierarchy to their hearts. Thus, all affirmations canenter into life only when the consciousness can accept theHierarchy.Eachevilintheworldisgeneratedbecauseofresistanceto the great principle of Hierarchy. Each victory is gained only bythe principle of Hierarchy. Therefore, one must be so stronglybasedupontheaffirmedHierarchy.

277.Inreality,theinnerfiresarebasicallyanalogoustoelectric

light. The greater the tension, the more intense the light. Thepurplestaristhesignofutmosttension.Youhavefeltthereactionofsuchatension;itcorrespondstoOurconstanttension.TakethemanifestationofelectricityasconformingtotheInfinite.Oftentheprofane think that the tension of the higher worlds is less thantheirown."Asinheaven,soonearth,"andthegreattensionofthehigher spheres is not to be compared with the earthly battle. Onecaneasilyconceivehowproblemsaremagnifiedinspace.

278. It can be understood how much more complex are group,

state,andnationalkarmas.Theirinterminglingisnotlessenedbutincreased by the conventional boundaries of humanity. One canfeel how aggravated is the interrelation between the powers ofLight and darkness, which increases the non-conformity of thereactionofnature.Youcanseehowgreatlyperturbedaretheweakspirits, how greatly obsessions increase, and to what an extentthese obsessions complicate karma. So, also, the earthly battleshould not upset anyone, because one can understand how it is

magnifiedinInfinity.Is it easy, where the Chaos of the Unmanifest rages? Along the

ChainofHierarchythestrainedheartcanfeelthereverberationofthetensionofthecosmicbattle.

279.Duringtheconstructionofgreatstepsonecanobservehow

the central power gathers around itself all that is needed forevolution. Like a focal magnet, the leader of progress attractseverything to himself, sweeping away the old accumulations andcreating new currents. Thus, throughout history, countries havebeenbuiltbysuchleaders.ItcanbestatedthatbyevidencingfulladherencetoHierarchyanycosmictaskcanbefulfilled.Humanityhas suffered most through its severance from the Higher Will.OnlythroughaffirmationofthegreatunificationwiththeHigherPower can the fulfillment of Higher Laws be achieved. It isimpossible for the acceptance of the powerful Hierarchy to beestablishedwithoutanunderstandingoftheHigherWill.

Thus, each step is built by the realization of the affirmed Will,upon which all higher correspondences are intensified. Thus, somanyevidentpossibilitiescanbeattractedfromtheTreasury.Thenon-acceptanceoftheHigherWillcomplicatesallstructures.Thisshouldberemembered!Eachstructureisheldbyitsfocus.Hence,onemustactbystrivingconsciouslytowardHierarchy.

280. Let us turn back to the concept of love. In each book a

considerable place must be allotted to that fundamental concept,especiallybecauseundertheconceptoflovemuchoftheoppositeisunderstood.Itiscorrectlypointedoutthatloveisaguidingandcreative principle. This means that love must be conscious,striving, and self-denying. Creativeness requires these conditions.And if love is marked by self-enfeeblement, disintegration, andservice to self, it will not be the highest concept of humanity,which extols the concept of achievement. The heart filled to thebrim with love will be active, valiant, and will expand to itscapacity. Such a heart can pray without words and can bathe inbliss.Howgreatlyinneedishumanityoftherealizationofthefireoflove!Apurplestarofthehighesttensionwillcorrespondtothisfire.

281. It is necessary to realize very exactly the fundamental

concepts of Be-ness. The love of achievement is not austere forthose aflame in heart, but it frightens those who love theirweaknessesandwhowaverwhileembracingtheirownillusionary"I."Lovethatcanmoveworldsdoesnotresembletheloveuponthemarshes,wherethebonesofoutwornremainsaredecaying.Abovethe marshes are the will-o'-the-wisps of decay, but the eternalcreativefireoftheheartdoesnotwander, it impetuouslyascendsbythestepsofHierarchytotheHighestLight.Loveistheleadingcreativeprinciple.

Unbearable is the Almighty Light, but Hierarchy is the link tothat dazzling Summit. The Hierarchy leads an illumined spirit tothatpoint where onemight even beblinded. Love isthe crownofLight.

282. The foundation upon which everything is built must be

protected from disintegration. The foundation that upholdseverythingmustbeenhancedbyallthebeststrivings;foruponthestones of the foundation stands the structure; for upon thefoundation stands each affirmation. How, then, shall people treatthe foundations, without realizing that the main thing is thecornerstone? So much has been destroyed by man, because of hisfailure to appreciate his treasures, and by his exposing the mostessential to the hail storm! Thus, humanity must understand thegreatsignificanceofthepowerofthefoundationandmustacceptHierarchywithitswholespirit.

283. During the hour of human injustice, recall spatial justice.

Verily,thereexistmapsofthehighestmountains,butnoneofthedeepest abysses. Even those who are far from flights of the spiritprefersummitstoabysses.Ifacaravanismaintainedaccordingtothe weakest member, history is based upon the most powerfulones.Thus,letusrememberaboutthiswondroussubstancewhichselectsthatwhichismostpreciousforevolution.Ifwearecertainthatweserveevolution,wecanrelyuponthejusticeofspace.Yetthe same justice prescribes necessary caution toward the blackforces.Usuallytheydonotapproachdirectly;theychoosenotless

than three intercessors. They know their auras can easily bedetected, and therefore they choose a consecutive chain ofsuccession,establishingthegradationverysubtly.NotcasuallydoWespeakofthevarietiesoftreason.

284.WhenIspeakoftheblackonesIadvisepayingattentionto

their subtle methods, and discerning how patiently they creep tothe goal and how they choose shoulders behind which to screenthemselves. You do not see the black ones, but the grey ones andalmost white ones. However, this telegraph requires greatattention.

285. Cancer can be treated by psychic energy, since lack of

psychic energy in the blood generates the disease. Often psychicenergyisexhaustedasaresultofspiritualoutpouring,aswasthecase with Ramakrishna and other spiritual Teachers. Certainly,they possessed an enormous amount of it, but, despatching it tofar-off distances, they could remain for a while without itsprotection.PreciselyclosenesstoHierarchyisneededinsuchcases,because even great Spiritual Toilers, in their self-abnegationsometimes expend their forces beyond a legitimate extent. Thus,for evolution We reiterate about Hierarchy, in order to affirm agoal-fitting application of one's forces to the Chain of the HighestOnes.Therefore,Isay,Guardyourhealth,inordertoadheretotheHierarchyevenbythismeans.

286. The Higher Will—who remembers it? Who will ponder

uponwhatisaffirmedbytheHigherWill?Manyreiteratethatthemanifestation of the wishes of the Higher Will is comprehensibleto them. But humanity perceives only its own direction, notconsidering the course of evolution. Hence there are so manyaccumulations of opposite courses. And humanity has lost itsdefense,becauseitproceedscontrarytotheHigherWill.Thus,theentirecosmicsignificanceoftheHigherWillshouldbeunderstood.

287.Letusturntodevotion.Thisconceptisalsosubjecttomany

distortions. Devotion does not resemble a windmill, or a hiredsingerofpraises.Rather,itresemblesafirmtoweruponasummit,

whichtheenemiesavoidinawe,butinwhosechambersashelteriseverpreparedforafriend.Devotionistheoppositeofdoubt,whichis nothing but ignorance. It means that devotion rests uponenlightenment. Thus, validity of learning is akin to devotion. It isnotcredulity,notlevity,butfirmnessandsteadfastness.Truly,thetowerofdevotionisnotconstructedbyhaphazardtoilorbypettydecisiveness;anddevotioncanbeviolatedonlybyperfidy,whichisthesameasbetrayal.Butvaluablearethetowersofdevotion!Suchashrams,likemagnets,attractpowerfulhearts;theyarenurseriesof spirituality. Even material nature is transformed in theproximityofthesetowers.

288. The cosmic laws are little understood by humanity. In life

allorganizationsclashwithCosmos.Thus,humanityacceptsonlya few of the visible effects, but refuses to accept the treasures ofCosmos. The causes of this are lack of faith and ignorance.Thereforedisunionhastakenplace.Howcanoneaffirmthecosmiclawswhensuchawallofdenialhasrisenbeforehumanity?Thus,each great law corresponds to life and to the leading laws. Thus,one can build upon the Chain of Hierarchy, which leads to thesummitofmanifestBeauty.

289. The principles of the affirmation of cosmic laws are

enrooted in the spirit. Striving toward Service always opens therevealedGates.Thus,Ourvictoryisalwaysbroughtintolifebythelawofstrivingandinvincibilityofthespirit.Thusthepredestinedwill be fulfilled. So I affirm! Thus, when the focus affirmed by Usshallbeverilyguarded,theMagnetwillact.

290. A physician usually says to his patient, "When summer

comes you will go to the country, into the sun. You will beregenerated by the mountain wind or the sea breeze." Even anearthlyphysiciancuresbyprojectingintothefuture.Karmaisthesickness of the past. Its cure lies in the future. Precisely, he whowishes to be liberated from the past should strive into the future.Striving with one's entire being protects one from downfalls; takefor example the moving heavenly bodies. Thus, remember that Ihavepointedouthowtowalkuponthewater,butIhaveneversaid

thatonecanstanduponit.Karmacanbechangedbyanirresistiblestriving.

291. Motion into the future is similar to the movement of a

flame. It is amazing how the fire, at times visibly and at timesinvisibly, lives, while vibrating and preserving the balance of theworld.Thusletusstriveintothefuture,becausesustainedbythefieryelementweshallnotfail.Butthefirecanbeinvokedonlybyan action of the spirit. Thus, let us apply the higher laws to theearthlyplan.Onemayevenchangekarma,whichmeansthatonecanchangeallearthlyconditionsbystrivingintothefuture.ApplyMyCommandtolife.Theparticlesofpreciousenergiesadhereonlytohimwhostrives.

292. The building of the great steps of evolution takes place

through unusual ways. Each new step always brings to humanityan affirmation which impels thought to new and mightypossibilities.Thus,theHighestWillalsointensifieseachenergyinaccordance with the Cosmic Magnet. There is no affirmation thatwould not be fulfilled if sent by the Highest Will. There is nostriving that would not be acknowledged if sent by the HighestWill.Therefore,humanitymuststriveonlytoHierarchy.Verily,inthis cosmic concept are contained all possibilities ofconstructiveness.

293. Humanity grows weak to such an extent, because it

evidences disunion with the Highest Will. Therefore We sopowerfully affirm the focus, for without the center the HighestWill cannot be accepted. Therefore We summon so powerfully toHierarchy. Verily, we must sacredly guard the treasures. TheyunderliethefoundationsofOurWork.Eachsacredcreativenessisacontributiontoevolution.Letusponderuponthesignificanceofagreatthought;letusponderuponthegreatmightofthefiresoftheTara;letusponderuponthedevotionoftheheart;letusponderupontheinvincibilityofthosewhowalkinthenameoftheLord.

294.Sometimesonecandemonstratethemostcomplexlawsby

meansofthesimplestapparatus.Thelawofkarmaiscomplex,but

taketheRuhmkorffcoiloranyotherelectriccoilandyouwillgetagraphic image of karma. The current runs along the spiraluninterruptedly, but the protective winding is subject to allexternalreactions;moreovereachthreadcontactsthethreadofthepreceding round, carrying upon it the consequences of the past.Thus, each hour changes karma, for each hour evokes thecorresponding past. Thus, one can contact the entire line of pastexperiences.

The same graphic example shows how the seed of the spirit isunharmed;andstrivingtotheheightsitsustainsitsshellwithoutfearingthepast.Verily,karmaisfrighteningonlytothosewhoareplungedintoinaction.Butastrivingthoughtisliberatedfromtheburden of the past, and like a heavenly body is impelled forwardwithout retracing its path. Thus, even with a difficult karma, onecanachieveausefulliberation.

295. Let us see how people understand Service to the Lord and

Hierarchy. He who thinks of ascending only by prayer is far fromService.HewhoinhislaborhopestobringthebesteffortsforthegoodofhumanitymustadopttheLordwithhisheart.Hewhodoesnot relinquish his own comfort does not know how to serveHierarchy.HewhodoesnotaccepttheIndicationsoftheHierarchydoes not understand Service. Only when the heart is ready toacceptconsciouslytheaffirmationsentbytheHighestWillcanitbe said that the realization of Service is adopted. Thus, We are noloversoffunerealritesandofemptyinvocationstotheLord.Thus,We venerate the striving of disciples to the Service of Hierarchy.HenceitissoeasytoobservehowtheonewhodoesnotaccepttheService in spirit venerates the Lord and Hierarchy only so long asthewayisconvenienttohim.

Thus, We take into account each effort to remove the burdenfrom the Hierarchy; as in the great, so in the small. Thus, in Ourcreativeness,Weaffirmreverencenotinwordsbutbydeeds.Thus,WedeploreitwhenWeseereverenceinwordsbutnotinaction.

296. Thus, humanity is an accumulator and transmuter of the

high energy which We have agreed to call psychic energy. Thesignificance of humanity consists in its transmutation of this

energy through consciousness and propelling it by way ofHierarchyintothehigherspheres.Thelossoftheunderstandingofone's own predestination has thrown people back from theunderstandingofresponsibility.Therefore,Weremindagainofthefoundation of Existence. One must prepare oneself for the nextevolution. Once again, one must draw closer to the great currentand realize the principles of the renewal of life. You notice howgreatlyopposedWearetospiritism,butWeoftenspeakaboutthesubtle bodies. We smile at contemporary hypnotism, but speakabout rays and magnets. We advise re-examination of yourpharmacopoeia,butofferafewfundamentalmedicines.

297. Where, then, is attention directed? It must be understood

thattheprocesstowardperfectionliesatthebasisofevolution.Itsummons one to simplification and to direct communion withhigher worlds. It can be seen how pranayama and other artificialmethodsofvariousyogascanbereplacedbyasimple,fieryheart.Certainlythissimplicityisrelative.Theflamingfierypathleadstoit. Yet it brings into life precisely that which was rejected asabstractionandfiction.Iconsiderthateachstrivingtoknowledgeshould be speedily brought to fulfillment. People ask why We donot compel the striving toward evolution. But even a plain nursetellsachild,"Belikeagrown-up,findbyyourself!"

298.Whenhumanityshallrealizethatspaceissaturatedbythe

effects of human deeds, it will be possible to cure the planet. LikegasestheypoisonEarthanddensifytheatmosphere.Thereforeoneshouldponderuponaffirmationoftheobviousresults.Humanityhas forgotten that redemption must proceed by the karmic way.Therefore each accumulated step can be transmuted by strivingtowardthehighestlawofHierarchy.ThegreatChainofHierarchygives life to the entire world, and the acceptance of this law canopenanewaccesstoenergies.Thusonecanbuildabetterstep.

299.Eachconcepthasitsbalance.ReverenceofHierarchyhasits

balance in the understanding of the pledge. If reverence ofHierarchyisdirectedupward,thenthepledgeisdownward.Thereeven exists a teraph of the pledge. You saw a pledge through a

teraph. Thus, the pledge is indestructible when Hierarchy isrealized.ItestifythatastheTeacherisimmutable,soisthepledgefirm. Therefore, do not pronounce the word Teacher in vain. Buthavingpronounceditdonotthinkofseveringthissilverthread.Asuperficial person can realize the consequences by a simpleexample: let him firmly attach to the wall a twisted rubber band,andlethim,withclosedeyes,pullitwithallhisstrength—abruise,not at all supernatural, will be the consequence. What then, mayresult from the severing of the silver thread? Once again atimorousandmischievousconsciousnesswillspeakofthreats,butany law, any machine, may be the cause of unpleasantness ifimproperlyhandled

300.Preciselywithloveshouldoneteachhowtodealwiselywith

the sacred concept of the Teacher. There are no thirty shekels forwhich one may hire various teachers. As wisely must one selectdisciples. The same silver thread binds each Teacher with eachdisciple.Oncethepledgeispronounceditbecomesthefoundationof karma. Through the events of life one can observe howimmutableisthatwhichhasbeensaid.Noonecangiveignoranceofthelawsasexcuse.Therefore,itisbettertorepeatthisuponeachpage than to permit a heinous error, which drags behind it aloathsome wake of consequences. Not severely but vitally shouldthelawbeunderstood.Thisadvicemustbeaccepted,notinwords,butbytheheart.Notwithoutcausedotheteethlockthetongue.

301. Majestic is the time! Remember that while Moses on the

mountain was preparing the Tablets, the people below weresteeped in madness; yet the calf of iniquity was destroyed whenfacedwiththeHighestCovenant.

302.People'sstrivingisalwaysmeasuredbytheirserviceeither

toLightordarkness.Bythismaybejudgedtheirdestinationinlife.Thus, the worst of all is halfway thinking and halfway striving.The destroyers always build upon halfway striving. There isnothing worse than a halfway servitor, for he screens himself byhalfwayness.ThereforeadirectenemyofLightispreferredbyUs.Wedonotadmitintothegreatbattlesthesmallwormsthatcrawlin the mist. Thus, halfwayness must be avoided. One shouldalwaysandinallwaysavoidanyintercoursewithhalfwaypeople.Halfwayness shown by the disciples throws them back amillennium, and therefore one should know when to affirm one'sown consciousness. Thus, the servitor of Light will not admithalfwayness.

303. It is most pernicious when halfwayness insinuates itself

into one who is affirming himself upon the path, because thenthereresultsdualityofthoughtandaction.Hence,halfwaynessisthe enemy of the Teaching, and when We see halfwayness inrelationtoHierarchy,thisdestructiveattitudemustbeeradicated;

for without integrity there can be no construction. Hence, thedisciples must understand how important it is to have completestriving. For this one should renounce personal comfort, conceit,self-pity, self-deception, and should always remember thatHierarchy must not be burdened. This should be remembered bythose who misunderstand Service as reliance upon the Lord andtheHierarchy.

304. The word Mahatma is translated as Great Soul. Some

imagine the Mahatmas as a completely distinct race. One shouldnot conceive a Great Soul to be entirely distinct. Each Mahatmabegan his ascent from the very midst of the people, having onlydared to choose the difficult path of the Great Soul. And, besidesdaring,hefoundinhisheartindignationofspirit,forhowelsecanthefiresbekindled?Uponthesefirestheprecioussubstanceofthesecretionsistransmutedintoahealingsubstance.Onecanseehowthesalivaofafierybeingcanremoveaninflammationandrestorethevitalenergytonumbcenters.Alongsidethesacredpropertyofsecretionsstandsthehealingpowerofthelayingonofhands.Itisinstructive to compare the secretions of men having dormantcenters with the ejection of the fiery substance. If I advisemedicines made from plants for common organisms, then for themore knowing ones there is a powerful laboratory of sacred fierysecretions.

305. My latest book will be understood by few. Who will

comprehend the sacred quality of the saliva of the Savior or thelaying on of the hands of Moses? People are not accustomed toappreciateafieryheart.Thebookcanhelpthosewhohavealreadysensed the rise of the solar serpent. It winds its coils amidst thefiery ejections. It is impossible to imagine the affirmation of thesubterranean fires without the eruption of the fires of the heart.You know about the usual ejections of the Yogi, which cannot bereplacedbyanythingelse,forthisgasofthefiremustbereleasedandmustblendwiththeFireofSpace.ButtheYogisseldomattainthismanifestationofconfluencewiththeCosmicFire.Wecallthisstage a holy one, for the light of the fire of the higher worlds isblendedwiththeraysofplanetaryYogis.Thisistheshortestpath

totheMahatmas.Donotfeartension,thisisthesamepath.Donotbedisturbedby

anguish,itcomesfromfire.Donotbeangry,fortheheartdislikesthisroot.

306. When events pile up, the subterranean fire is impelled

accordingly. Thus, when the shifting of forces takes place, oneshould pay attention to the cosmic fires. In one case there isregeneration, in the other, shifting. Everywhere the cosmicmanifestations take place, and the Spatial Fire imbues eachtransitory process. People's power is nurtured by a correspondingspirit, and the same power of attraction unites the shiftings ofnations. Therefore, it can be said that the tension of Cosmos istransmitted to all countries. Thus, humanity cannot sever itselffromthegeneralaffirmation.Hence,thehighestlawimpelstotheGeneral Good; and the human spirit is in need of striving to thehigherlaw.

307. Therefore, humanity must understand the beauty of the

higher laws. What, then, will indicate the path to creativeness, ifnot true understanding and veneration of the Hierarchy? What,then, will attract the spirit to the Highest, if not adherence to thelaw of Hierarchy? What, then, will direct the spirit toward themanifestation of Truth, if not understanding of Hierarchy?Therefore, for a higher understanding one must accept Hierarchywith one's heart and strive irresistibly to the highest law ofHierarchy.

308. An experienced sailor frowns at a dead calm of the sea,

foreseeing the gathering of a storm, and smiles at the blusteringwind,perceivingasuccessfulnavigation.Ofsuchasailoritissaidthatheknowsthesea.Wesaythatheknowslifeifheknowshowto understand the difference between the inner and outermanifestations.Somefoolsshout,"Rebellion!"whentheyhearthecry of a pottery vender, and exult at the quiet when they see aclosedmarket.Ourwayistoteachandtoobservehowdifferentisthe thought of dissolute people. Classes for thinking and theobservation of life processes should be established in schools. It

mayoftenbenoticedthatachildunderstandsthehiddenmeaningof an occurrence better than an adult. Only according to innerfeelingcanweapproachajustevaluation.Weacceptacalmsurfacebeforeastorm,andwedonotpayattentiontotheblowingcurtainsatthedoors.Thus,theformationofeventswillbeunderstood.

309. When the Forces of Light and darkness are fighting, the

orbit of each camp is being established. That which nurtures thecampofLightwillcertainlybethecenteroftension,andthegoalofLight will be the target for darkness. Therefore, when the Forcesare in conflict, everything pertaining to the center should beguarded. The main Fire of Space will abide in the center, and theprotectingnetshouldbeguarded.Thus,theorbitofLightengulfsdarkness.

310.WhentheForcesofLightanddarknessarestrained,health

mustbeguarded,becausetheFireofSpaceisraginganddarknessistense.ButinallOurmanifestationsoneshouldperceivevictory.When everything crumbles that is old and not applicable forevolutionandfortheEpochofFire,oneanchorremains,whichwillsave humanity—the anchor of Hierarchy, which will unite theentire chain and give the entire power. Thus, one should becomelimitlesslyaffirmedinHierarchy.

311. Let us observe how the black ones labor. It is necessary to

observe their peculiar habits. They are not indignant about anonentity. They consider that the first steps of service areparticularly useful for them. A nonentity is negligible even intreason.Treasonispreciselythemainbasisofunderminingbytheblack ones. For treason, one must know something. This relativeknowledge, not strengthened by devotion, may be found on thefirststeps.Onemustknowthatcondemnationactslikefireuponawavering devotion. It is sad to observe with what unnoticeabledeviations the disciple begins to steep himself in indifference,findingeloquent justifications.Likethebladeofaknife,theheartloses its protective net. Without its sheath, the blade injures thecarrier himself; and such spurs do not lead to achievement, theylead only to irritation. If one day has passed successfully in

demeaning the Teacher, why may not tomorrow also be blazingwith blasphemy against the Highest? And if the silver thread isbroken,thebladeofossificationisalreadyirrevocablysharpened.

312. It is necessary to observe the wavering ones, for the

contagionfromthemisgreat.Oftentheythemselvesareabouttobe submerged in the black agglomeration, yet the blasphemydisseminated by them wounds many innocent ones. You armyourself rightly against indifference; it corrodes all beginnings,andwhatfiresarepossiblefromthefrigidityofindifference?Also,the affirmations of the Teacher are like the watering of flowers.The watered garden will not wither. We are concerned withadvancing. We affirm new dimensions! Indifference to Ouraffirmationsisimpermissible!

313. When the spirit is filled with striving, there is no place for

indifference. When the spirit is aflame, there is no place forindifference.Thisqualityprovidesimmunitytoindifference.Onlywhenthespirittendstoegoismcanitsdeathoccur.Therefore,oneshould flamingly protect the spirit from indifference where theevil generated by neglected striving will nestle, whence this evilwillinflictablowthatwillbearfruit.Itisdifficulttodetecttherootof evil generated by indifference. Only in endless vigilant strivingcan one find protection for construction. Hence, whileconstructing great works, one must understand that egoism andindifferenceareinadmissible.

Therefore,WedemandthatthefirstthoughtbededicatedtotheTeacher.Isitpossibletosucceedwhenthediscipleputshimselfinthefirstplace?AreWenotbuildingalluponagreatName?DidWenot put Beauty at the foundation? We have given the greatfoundationsfortheworld.Thereforeeachthoughtmustbevaluedasthefoundationofagreatstructure.Verily,thefutureisgreat!

314. Amidst the concepts of courage, the most invincible is the

courageoftheflamingheartwhen,withfulldecisiveness,withfullrealization of achievement, the warrior knows only the path ofadvance. To this achievement of courage only the extreme degreeofthecourageofdesperationiscomparable.Withthesamespeed

withwhichthecourageoftheflamingheartovercomesthefuture,desperation flees from the past. Thus, where the courage of theflaming heart is lacking, let there be the courage of desperation.Onlythuscanthewarriorgainvictorywhentheoffensiveisgreat.Allotheraspectsofcourageareofnosignificance,becauseinthemwill be halfwayness. This quality, next to cowardice and treason,mustbeavoided.

315.Thereorganizationoftheworldintensifiesalltheforcesof

Cosmos. If humanity would understand that reorganizationrequires the striving of the spirit, it would be easy to establishequilibrium in the world. But the nations do not ponder aboutwhattoplaceuponthescalesandwhereisthebalance;hencethechaos of thinking is so destructive to humanity, and thus thedislocatednationssinktothedepthswithouttakingmeasuresforspiritual transmutation. Therefore, it is time to ponder theestablishing of spiritual quests. When the cosmic perturbationsrequireapowerfultension,humanitymustknowwheretolookforthecenterofsalvation.

Therefore, the quest for a spiritual center will lead unavoidablyto Hierarchy. Humanity has lost the necessary formula forsalvation.Hence,theanchorforsalvationisthefocusofHierarchy.OnlyaconsciousquestandtheaffirmationofHierarchywillaffordsalvation. Yes, yes, yes! Therefore, We gave the basis for actionsandworksthatarefoundedonBeauty.

316.Healingthroughthefragranceofflowers,resins,andseeds

goes back to hoary antiquity. Thus, a rose not only possesses asimilaritytomuskbutalsopreventsimperil.Agardenofroseswasconsidered by the ancients as a place of inspiration. Freesias arebeneficial for the sympathetic nervous system, which vibrates somuchinaYogi.Theseedsofbarleyareunsurpassedforthelungs.You know already about mint, about the resin of cedar and otherresins. Perfumes are now bereft of meaning like all otherdesecratedvalues,yettheoriginoffragranceunderliesausefulbutforgottenknowledge.Certainlythepoisonsofantiquitywereverysubtle. The newly invented narcotics are comparatively crude;chiefly, they destroy the intellect—in other words, precisely that

which sustains the balance in all psychic experiments. A flamingheartwithoutspiritualbalanceisanimpossibility.ThusonemustrememberalldetailsthatbringoneclosetoHierarchy.

317.ThedisciplesonthepathofServicemustapplyallthebest

strivings of their spirit and consciousness. While creating, oneshould understand that only the application of the best actionsaffords corresponding results. Thus, let us not expect beautifulresults where the spirit has not applied its best strivings. Oftenpeoplewonderwhytheirundertakingsareunsuccessful.Letussaythen, Did you apply all your best impulses? Did not light-mindedness, the dullness of inflexibility, negligence, and lack ofardorfortheHierarchyintrudethemselves?Thus,onemayexpectcorrespondence based upon cause and effect. Thus, one mustunderstand that each irresponsible action, each non-goalfittingdeed, may bring many unnecessary and harmful consequences.Thus, the disciples on the path must display their best strivingsandardortotheHierarchy.

318. Hence one must chiefly develop one's vigilance and watch

untiringly the creativeness surrounding the Sacred Hierarchy.Onlywhendisciplesshallattainthisqualitymayonehopethatthepredestined success will come. Therefore, one should manifest anextreme conscientiousness and vigilance toward all that occursaround the Focus. Each unnoticed mistake will yield its ownblossom.

319.ItisaskedwhyWesooftendelayindestroyingtheenemies.

There are many reasons. Let us name two: the first—karmicconditions.Itiseasytoharmthenearonesbytouchinganenemybound to them by karma. This may be likened to most delicatesurgerywhenasurgeondoesnotamputateasicklimbbecauseofthe danger attendant upon severing an artery. With the karmicbonds the interacting relationship is unusually complex. Weconsider it more useful to insulate the dangerous fellow travelerthan to obstruct the entire caravan. The second reason is thatenemiesarethesourceoftensionofenergy.Nothingcansogreatlyincrease the energy as counterattack. Therefore, why invent

artificial obstacles when the dark ones attempt with all theirstrengthtoincreaseourenergy.

320. What undertakings enter into life without great tension?

Each creative step is the affirmation of great battles. Each battlehasitspredestination,andeachdesignitssignificance.Thus,thosewhowalkalongwiththePowersofLightmustknowthatwithouta tense battle there is no victory. Thus, when the step of greatvictory is being affirmed, the disciples of Light must feel entireinvincibilityofthespiritandentiresteadfastnessofactions.Whentheaffirmationofgreatfoundationswasgiventohumanity,eachtension was accepted as a further impulse for new structures.Thus,inevolutioneachbannerhasbeenaffirmedbythegreatnessofthesteadfastnessmanifested.Verily,onlythuscanoneconquer!

321. One can compare the process of the inner fires with some

parallels of physical fire. Let us take the flame under a blowpipe.Observe how, under pressure, the flame loses its yellow tone andthroughbluebecomessilverandpurple.Besides,letusnoticehowthe flame inclines. Our fires are similarly strained under thepressureofthecosmicwhirl.Thoseraremanifestationsshouldberecorded,fortheytestifytoparticipationinthecosmicbattle.Fewcan pride themselves upon such participation. Not a chaotictremor, but a vanguard of the hosts of Light is required for thepiercingofdarkness.Andhowblessedisthepressingwhirl,whichimpelsusintoconstructivebattle!Newthoughtsmayberealizedinthis battle, however, one should know the direction of the blow,andthisWepointout!

322. Hierarchy and the creation of a new consciousness are

affirmedasthecornerstoneofevolution.Eachdayonecanobservetheevidenceofsuchprogress.Butpeopleseldomsynthesizethesemany-colored petals of the Fire Blossom. Courage is lacking toacknowledgeoneselfaslivingupontheruinsoftheoldworld.Yetevenawoodcutterknowsinwhatdirectionthetreewillfall,forhedoesnotwanttobecrushed.Onthecontrary,hequietlycalculatesthe amount of new building material and fuel. Thus, one mustrejoiceatthecosmicbattle!

323.Ifpeoplewouldunderstanduponwhattheearthlypriority

is built, verily, the highest principles could be given. But who hasponderedupontheprincipleofcreativeimpulses?Whenisolationtakesplace,andthelawassertedbytherightofthegreatBe-nessisinfringed, then, indeed, the main foundation is destroyed. Eveninsects know the greatness of Hierarchy. The knowledge of thefoundationsoflifecantransformlife,henceonlythegreatnessofthe law of Hierarchy will give to humanity the striving to thehigheststepsofevolution.

324.Hence,theknowledgeofthespiritissuchapowerfulguide,

for it will always lead to the foundations of Existence. Thus, oneshouldadopttheconceptofHierarchyasthehighestService.Thus,the knowledge of the spirit directs the disciples on the path toHierarchy.Thus,withtheentirestrengthofone'sspirit,oneshouldunfurl the Banner of Peace, in which are contained all theabutmentsofculture.

325. A poorly developed mind always stumbles at a seeming

contradiction, it cannot reconcile Hierarchy with resourcefulindependent activity. Certainly, without synthesis the mostmonogenic conceptions will fall apart like brickwork withoutcement.Therealizationofsynthesiswillbelikeasteptowardthetransformation of the race. The remark about the immortality ofunicellularorganismsiscorrect.Butwithwhatcanonebringintounityourheterogeneouselements?Onecaneliminateamultitudeofartificialmeans,bringingtolifethedormantcrystalsofpsychicenergy. One may think of it as our origin. Only unitedunderstanding of conscious striving toward the affirmation ofascentgeneratesthepoweroftransmutation.Donotthinkthisanabstraction;Iadviseacceptingitasnecessaryfortheascentoftherace.

326. Synthesis must be understood as the apparatus of the

laboratory of life. Let us remember this definition. The mind thathas achieved the stage of synthesis becomes productive, moral,unifying,non-irritable,capableofmanifestingpatientcooperation

withHierarchy.HowcanoneexplaintheadvantageofsynthesistoonewhodoesnotponderuponEternityandstupidlyshutshimselfoff from all calls? He will never understand that what is said alsoconcernshim.Satisfied,hewillgarbhimselfinasuitapprovedbyatailor and be at ease, having acknowledged the tailor's hierarchy.Butletusnotoffendthetailorbecausepeoplehaveinventedmanydisgustinghierarchies.

327. The vibration of objects may come from the pressure of

psychic energy. The vibrations of light may also reflect upon thesurroundings. Thus is so-called magnetism transmitted. Man isborne by vibrations to a like at-onement of receptivity andharmony.

328. How difficult it is for people to realize what determines

theirownwelfare.Theythinkthattheycreate;theythinkthattheylabor;theythinkthatnothingwilltakeplacewithoutthem.Theythink that in them lies the foundation. Woe to those who takecredit for that which does not issue from themselves, for theseservitors of darkness are verily the destroyers of luminousinceptions. Certainly the attempts of these dark ones onlydeterminetheirowndestruction,forLightisunconquerable.Thusself-destruction occurs where there is disobedience to theHierarchy of Light. Thus, the attributing of creativeness tothemselvesbythedarkoneshasareason,becauseverilythejinnshave affirmed themselves as co-workers of Light. Each evilintentionistheaffirmationofvictory.

329. Is it possible that the dark ones are blind, not wishing to

showunderstandingofHierarchy?IsitpossiblethattheassertionoftheHigherLawisnotacknowledgedastheonlysalvation?Howimportant it is at such a decisive time to understand the law ofHierarchy! Thus, let traitors ponder. Thus, let the servitors ofdarkness, who are opposing Hierarchy, ponder. Whoever slandersHierarchyisthegreatesttraitor.

330. If one combines the complete responsibility of the

physician, judge, priest, teacher, architect, and lawmaker, one

arrivesatapartoftheresponsibilityofaHierarch.Butjustapart.Forbesidestheearthlyresponsibility,Healsobelongstothesubtleandmentalworlds.Weneversummonanyonetodonthearmorofa Hierarch, because only the spirit itself can choose such aresponsibility.TheseedoftheHierarchisgeneratedaccordingtoacertainray.Verily,themightofascenthasnofearofresponsibilitybefore the three worlds. This courage is like a link between theworlds, like the pillar of the Covenant, like the Light, all-penetrating!Thus,facingthethroneofresponsibility,thewingsofachievementglow.

331.Withoutculturetherecanbenointernationalagreementor

mutual understanding. Without culture the people'sunderstanding cannot embrace all needs of evolution. ThereforetheBannerofPeacecomprisesallsubtleconceptsthatwillleadtotheunderstandingofculture.Humanitydoesnotunderstandhowto manifest reverence for that which comprises immortality ofspirit. The Banner of Peace will bring the understanding of thislofty significance. Humanity cannot flourish without theknowledge of the greatness of culture. The Banner of Peace willopenthegatestoabetterfuture.Whencountriesareonthewaytodestruction, then even those who are spiritually depleted mustunderstand in what the ascent consists. Verily, salvation lies inculture.Thus,theBannerofPeacebringsabetterfuture.

332.Letpeoplebecomeaccustomedtoejectingfromtheirlivesa

multitude of petty lies and to learning to apply truth to life.Nothing is as destructive as a consciously injurious distortion ofreality. It disturbs the rhythm of Cosmos. The subterranean firedominatesbythecounter-currentofitsrhythm.

333. With the cooperation of all energies the preordained

structurecanbebuilt.Itisthesameinhumanconstructiveness.Itshould be remembered that positive forces create under thepressure of negative ones, and the creativeness of Light issaturated by the tension of the manifested pressures. Thus,creativenessintheNameoftheLordscertainlycallsforthtension.Hence, precisely Service to Light asserts such a tension of cosmic

potencies. When such a mighty construction is being affirmed,howisitpossiblethattheshiftingforcesshouldnotbeopposed?

334. Verily, the Banner of Peace will unite all cultural tasks and

will give the world the achievement that is so needed. Therefore,those who carry a striving quest will respond to all affirmations.ThenationswillverilyuniteunderthisBanner.

335. Humanity must carry out a multitude of urgent

experiments.Imperilmustnotonlyberecognizedasthecalamityof the departing race but the contagion of imperil should also bestudied. It will be possible to ascertain that imperil acts at fardistances and can affect the subtle body. Imperil clashes like adissonance with the Fire of Space. People who depart from Earthwithastoreofimperilcreateforthemselvesatorturousexistence;theFireofSpacerushesuponthem,forharmonymeansadherenceto the foundations. Each opposition to the foundations calls forththecounteractionoftheFireofSpace.Thus,oneshouldadmitthatpersonal irritation is an excrescence of the departing ones. But itmust be noted that people often do not wish to heed their ownirritation,thoughthedangerouspoisondoesnotdiminishbecauseofthat.

336. Thus, one should investigate impeding elements with all

means. One must understand in what consists harmony with thefoundationsofExistence.Inwhatliestheprogressofaspiritwhoisgraduallybecomingaccustomedtoexistingabovetheworldandtolaborwithoutend?Also,thesacredpainsshouldbeunderstoodassigns of the flights of the spirit into the region which binds theworlds.Thus,itiseasytounderstandthatinvolutionhasdeprivedhumanity of some acknowledged qualities, and one shouldmanifestmuchoftheprimaryenergy,inordertoweaveagainthetorn web of Assurgina. But praise to the courageous, daring, andstrivingones!

337. The time when the Fire Blossom is manifest cannot be an

easyone.TheBannerofPeaceisnotpresentedatthebazaar.Thus,letusbeunitedinoneunconquerablestriving.

338.HowdoeshumanityexpecttoapproachtheHighestwithout

acknowledgingtheentrustedearthlyrepresentativesofHierarchy?How can a link be established if humanity does not admit thegreatness of the Chain of Hierarchy? Thinking is infected soextensivelybythepoisonofconceitthattheentirecosmicbalanceis disturbed. Thus, on the way to Us one should adopt all theaffirmations concerning Hierarchy as an anchor of salvation.Verily, Hierarchy is like a wondrous Light for humanity! As amightyShield,Hierarchystandsonwatch!Hierarchyisaffirmedasthelinkbetweentheworlds!

339. Therefore the most heinous is apostasy and demeaning of

theTeacher.Thus,whenWeintroduceintolifeanewaffirmation,oneshouldstrivewiththeentirespiritonthepathoffulfillmentoftheHighestWill.Hence,whenWeaffirmthegreatsignificanceofthe Banner of Peace, it must be adopted in spirit. Verily, thus thesalvation of the world will come. The time is great! The time issignificant!

340. Wisely is ordained the bliss of him who sacrifices his soul

for his neighbor. Often this commandment is applied to thesacrifice of one's life, yet it is not said of life or body, but of thespirit. Thus a most difficult and lengthy task is given. In order togive one's soul one should cultivate, expand, and refine it, then itcanbegivenforthesalvationofone'sneighbor.Thusthewisdomof the Commandment should be understood and consciouslyapplied.Itisalsosaid,"FollowMe."ThuswillspeakeachHierarch,affirming a progressive motion. He cannot turn back, otherwisetheleadingstarwillbehiddenbehindtherock.

ItisnotcorrecttothinkofthehumilityofaHierarch—humilityahead and the Command behind. Likewise, the concept ofHierarchyisclearlyexpressedinthewordsoftheApostleabouttheComforter. This advice should be similarly understood, becauseinaction in sorrow is not indicated, but consolation is preparedthroughachievement.Thus,eventhebestTeachingsareobscuredbynotacknowledgingthatwhichisimperceptibletoearthlysight.

341. How is responsibility understood by the many? How littledopeopleponderuponthegreataffirmationofresponsibility!Theone who accepts responsibility with obvious light-mindedness orwith selfish desires is subject to a terrible karma. When the greatServiceforthegoodofhumanityisgiven,responsibilityshouldbecarriedaccordingly.WhenOurvesselisinthehandsoftheCarrier,it means that dignity should be preserved, in order that thewondrous vessel may keep its wings. Verily, it is befitting thatresponsibility be carried by a tempered spirit and with the entiresolicitudeoftheheart.

342. Individuality and egoism are like birth and death. The

buildingofindividualitymanifeststheconceptionofaNewWorld,whereas egoism can mirror itself in the dead volcanoes of themoon. Not only does egoism deaden itself, it strikes thesurroundingswithsterility,whereasindividualitykindlesfiresinall adjacent camps. Cooperation is the crown of individuality, butthe scourge of egoism is like the sting of a scorpion. Can one relyupon egoism? No more than upon a viper! But true individualitycontains in itself the foundation of universal justice. We mustgatherindividualities;foranewdiamondisinneedofcutting,butegoism must pass through many incarnations. Indeed, this lawmay also be changed by the fire of the heart. Therefore, we canadvisethoseadheringtoegoismtobekindledbytheproximityofafieryheart.

343.NotwithoutpurposedoWekindlethebeaconsofthefiery

heartasarefugefortravelers.Itisnoteasyfortheflamingheart,yetitsacrificesitselfforitsneighbors,whichrevealsthejusticeoftheCommandmentofBliss.Butjoyisaspecialwisdom.

344. At the time of world reconstruction one can hold fast only

through affirmation of the New World. The ascertainment of themanifested decision can enter life only through greatunderstanding of world regeneration by way of the great law ofHierarchy. Therefore, those who seek the New World must striveto the confirmation of the Decree of Hierarchy, which directsthrough the appointed Hierarchy. Only thus can balance be

established in the world. Only a flamingly guiding Heart willmanifestsalvation.Thus,theworldisinneedoftheaffirmationofthelawofHierarchy!

Thus Hierarchy is lawfully affirmed during the shifting ofcountriesandthesubstitutionoffireforallthatdeparts.ThereforeitissourgenttoadoptthelawofHierarchy,forwithoutthechainthe great ladder of ascent cannot be constructed. Thus, theaffirmation of the greatness of the law of Hierarchy must beadoptedfierily.

345. Do not be perturbed by the necessity for seeming

repetitions. In the first place, nothing is repeated. Even the samewordsappearcompletelydifferentatdifferenttimes.Secondly,oneshouldreiteratedayandnightaboutHierarchy.Youarerightthatthe hierarchy of thralldom is ended, but the emergence of arealized Hierarchy is followed by human sufferings. There is toomuchslaveryintheworld,andeachflameofconsciousnessistoooppressed. Slavery and a consciously realized Hierarchy are likeday and night. Hence do not be dissuaded from repeating—aconsciousness of Hierarchy, Hierarchy of freedom, Hierarchy ofknowledge,HierarchyofLight.LetthosescoffwhoareignorantoftheinceptionoftheNewWorld,foreachconceptofaNewWorldfrightensthem.IsnotInfinityterrifyingtothem?IsnotHierarchyburdensomeforthem?Beingignorantdespotsthemselves,theydonot understand the constructiveness of Hierarchy. Being cowardsthemselves,theyarehorrifiedinthefaceofanachievement.Thus,let us place upon the scales the most urgent concepts of the greatapproachingAge—InfinityandHierarchy.

346. When a step of evolution is being built the dark ones

intensify all their cunning, because Light is unbearable to them,and,sensingtheirdoom,thedarkonesclingtothemeasuresmoststiflingforthem.DuringeachnewgreatEpochthesamepressureof forces is repeated. But a more teeming period has not beenknown to history, for the Epoch of Fire comprises all cosmicactions.Thus,thevigilmustbefiery.

347. Many pillars of salt are spread upon the face of Earth. Not

onlydidLot'swifeturnbacktothepastbutnumberlessarethosewhohavelookedback.Whatdidtheyexpecttoseeintheburningcity? Perhaps they wished to bid farewell to the old temple?Perhapstheylookedfortheircozyhearth?Perhapstheylookedinanticipation of seeing the house of their hated neighbor collapse?Certainly, the past chained them for a long time. Thus, one muststriveonwardforenlightenmentandhealthandforthestrengthofthe future. Thus it should be always; but there may be cosmicknots when an impetuous onward motion is urgent. One shouldnot be disconcerted and mourn over the past. Even mistakes areobvious, yet the caravan does not wait, and the very events pressonward. We hurry, and We summon to hasten. The future iscrowded,butthereisnodarknessahead!

348.LeaveallthepasttoUsandthinkonlyofthefuture.Letus

not take anything useless from the past; let us not burden ourconsciousness by anything. I, Myself, will put away and willremember all that is valuable! Events propel one into the future.ThereforeHierarchymustbeunderstoodasalifebelt;so,also,thesign of the Mother of the World may be understood. Do not bedisturbed,forIwillturnalltousefulness.Weshallshoutintotheearsofthefaint-hearted—Hierarchy!!!TheTeachingisgivenattheimperativehour,andonemusthavetheearsofanassnottohearthethunder.Itisusefultorejoicebeforethevictory.Letusrejoice,andthusuniteourselveswiththejoyoftheLord.

349. Life-activity is sustained by the subtle energies of the

organism.Peoplegetaccustomedwithdifficultytotherealizationof the subtle energies and to the activity of all the imperceptibleforces. Hence a great disunion with Cosmos occurs, and thephysical body is greatly limited by the basic properties of matterinstead of developing the subtlety of receptivity. People sense solittle the vibrations of cosmic forces, and they display littlediscriminationastowhereiscontainedsubtlecognizance!Aspiritstrivingtothehighestspheresknowsthatamagneticbondexistsbetween the subtle energies and manifests concordance with allspatialpressures.Thus,thenewgenerationmustbebroughtuponthe understanding of the subtle energies, for the vibrations of

spacearenearingEarth,andtheaffirmationoftheNewEpochwillbringtheshiftingofmanymanifestations.Thusthesubtlebodieswillassimilatealltheenergiesthataresent.

350. Thus, the epochs of the manifestation of Fire have always

been followed by perturbations, because the spiritualconsciousness was shifted, together with the cosmic changes.Hence,duringtheEpochofFirethemostimportantthingissubtlereceptivity.DuringtheEpochofFire,theHierarchyisfollowedbyanimpetuoustorrentofgrowthofthespiritofpeople,andbecausethe law of Hierarchy has not been adopted by nations, suchshiftings of peoples occur. Thus, the Epoch of Fire is the Epoch ofHierarchy!

351. Hierarchy must be adopted as an evolutionary system. To

those spirits who have not yet outlived slavery it should berepeatedthatHierarchydifferscompletelyfromdespotism.Evenachimney-sweepmustclimbtotheroofinordertocleantheflues.Thiscannotbedonefrombelow.Onecannotcomposeasymphonywithout one key for all instruments. Many analogies may bequoted, beginning with a jest and finishing with the touchingexamples of bees, ants, and swans. But the best example forcontemporary humanity is the comparison with impersonalchemistry. It is easy to understand that a reaction can take placeonly under precise conditions. Hierarchy likewise correspondscompletelytotheastrochemicalprinciples,whichevenaneophyteof science will not deny. We justly agreed already upon theimportanceofthediscoveryofpsychicenergy;forthecoordinationofitsrealizationHierarchyisasindispensableasahelpfulchemicalprocess.

352. Which path is the most affirmative one on the way to Us?

Themostunfailingwayisthepathofself-sacrificingachievement.The most wondrous fire is the flame of the heart saturated withlove for Hierarchy. The achievement of such a subtle heart isaffirmedbyServicetotheHighestHierarchy.Hence,sowondrousistheself-sacrificeofthesubtleheart.Thespirit-creativenessandindependent action of a sensitive server fierily imbue space. Thus

the subtle heart responds to all cosmic occurrences. Thus, verily,the visible reverberates with the invisible, the present with thefuture, and the predestined takes place. Thus the self-sacrifice ofthesubtleheartimbuestheworldwithflame.

353.Verily,thesacredconceptofanArhathasbeendistorted.It

isviolated,beingbereftofbeauty.Howdimlytheunderstandingofthe Teacher of General Good burns in the consciousness of theworld! But Truth lives, and in the name of Truth We create.Therefore, for the transformation of life one should acceptHierarchyasthebeautyofTruth.Thusthesubtleheartcreatesforcosmic evolution. Thus, one should realize the significance of thefocus within the heart; thus, the great process of the subtle heartmustbeunderstoodthroughtheheart.

354.SomepeoplecannottolerateOurfrequentremindersabout

battle.Forthemletitbenotabattle,buttheopeningoftheGates.The process of opening also requires energy; but for you, withoutneed of hypocritical palliation, it may be said that the battle ofLightagainstdarknessproceedsincessantly.Manywarriorshelpinthisbattle,otherwiseweagainwouldbeengulfedinChaos.Oftentheparticipantsinthebattleaskwhy,intheirphysicalshells,theydo not remember the achievements of their subtle bodies. But itwould be criminal on Our part to permit such consciousness. Theheartcouldnotbeartherealizationofsogiganticabattle.Onlyanespecially flaming heart retains the black missiles in itsconsciousness.Theheartisstopped,eitherbecauseofrealizationorthroughsclerosis.Butthecosmicbattlecanstrikeatthestrongestheart.

Thus, let us remind about the battle, when the clash againassumessuchcolossalscope.Thesubterraneanfireisequilibratedwith difficulty, and the layers of magnetic currents areintercrossed. But let us not deny that this perturbation bringsrenewedpossibilities.

355.Thelife-activityisintensifiedbydifferentvibrationsofthe

subtle energies. Thus the essence of life-activity and that uponwhich the life of each spirit is based are so inadequately realized.

People think that the life process is contained only in the tissues,forgetting that the creativeness of Cosmos is intensified by thesubtle energies and by that invisible process which permitsperpetual interchange and contact with the Spatial Fire. Themaintenanceofpsychicenergyisbaseduponthespiritualprocess.Verily, humanity must realize where is the source of life-activityand in what is contained the interchange for the growth of theforces. The moment humanity severed itself from the Source ofPower, the shifting of the forces occurred; thus it is in the entirecosmicconstructiveness.

Thus,intheentirestructuretheforceisinneedofsaturationbythe Source. Hence, Hierarchy is so greatly stressed by Us, for thisSourceistheSourceofBliss,andintheepochofthetransformationoftheworldthereisverilyonlyoneanchorofsalvation.Therefore,consciousness should be affirmed upon the center of all that isgiven.

356.Asthewordsimply,theevolutionaryspiralexpandsandthe

involutionaryspiralcontracts.Theverysamemaybeobservednotonly in personal aspects but also in ideas. It is very instructive todiscern how ideas are generated and how they complete theircircle. Often they seem to disappear completely, but if they are ofanevolutionarynaturetheyappearagaininanexpandedform.Forevolutionarythinking,oneshouldstudythespiraloftherootofanidea. The task of the gradual containment of an idea can afford aprogression toward a higher understanding. One may take forinstancetheideaofreligionsandexamineitspirally;precisely,notcomparatively,butevolutionally,spirally.Thusonecanseetheoneroot. Likewise one can study how the ideas of religions expandedthrough evolution. Thus, the prognosis of the future will not bediminished.Positivesignsmustbegathered.

357.Manyconcessionshavebeenmadebyhumanityinorderto

erasethevitalfoundationoftheTeachingsofLife.Forthesakeofcomparativeconcessionsonemaydeprivethelampofitswickandbeastonishedattheconflagrationfromthespilledoil.

The lamp of the world is overturned, and the sacred miracle oflifecanbesafeguardeduponthemountains.Theconflagrationcan

bearrestedbytwofountainheads—Hierarchyandpsychicenergy.358. Humanity must build its strongholds as a wondrous

indivisible circle. Each creative inception must be built uponintegrity and indivisibility, affirming itself in an orbit around thecenter. Only thus, by a radius, can one reach all points andestablish the right scope. It should be understood that eachstrongholdmustbenurturedfromthecenter.Themoresuperficialthe receptivity, the more perilous it is in all directions. Thereforeone should harken to the inner manifestation of the center. Theindivisibilityofthestrongholdisitsmight.Integrityisitsbeauty.ThecenteristheHierarchyofBliss.Thusthehigheststepisbuilt.Eachspiritmustrealizethatalllivesthroughthelightofintegrity.Each Ashram is nurtured by integrity and lives by the Light ofHierarchy. Each atom lives by integrity. In this is beauty; thus istheworldconstructed.

359. Our constructiveness lies in vitality. The pledge of

happiness for humanity lies in beauty. Hence, We assert art to bethehigheststimulusfortheregenerationofthespirit.Weconsiderart to be immortal and boundless. We make a demarcationbetweenknowledgeandscience,becauseknowledgeisart,scienceismethod.Therefore,theelementofFireintensifiesartandspirit-creativeness. Therefore, the wondrous pearls of art can actuallyuplift and transmute the spirit instantaneously. Everything isattainablethroughthegrowthofthespirit,foronlytheinnerfirescangivetheneededstrengthofreceptivity.ThusanAgniYogicansense all cosmic beauty without narrow scientific methodology.Verily,thepearlsofartbringexaltationtohumanity,andthefiresof spirit-creativeness can give a new understanding of beauty tohumanity. Thus, We value integrity around the center andappreciatetheServicetoHierarchythroughtheheart.

360. How pervertedly people interpret the foundations of the

world! What formulas they invent for the interpretation of vitalprinciples! Without understanding the great foundations of theunity of all cosmic principles, they saturate space with all thedisruptingprinciples.Thus,thereresultsimbalanceoftheorigins,

disunion of all the highest principles, and striving to manyauthorities. Thus, dividing the great Origin of Hierarchy throughhumanfrailtybringsitseffects,andhumanitystrainsalleffortstodepreciate the great Principle. Thus occurs the substitution of thesmallfortheGreat.

361.Verily,thecosmicOriginsarewondrousintheirmight,and

thecreativelawofHierarchyimbuesallwithfire.Therefore,atthebaseoftheentireCosmosliesthelawofthegreatunificationofthehighest fires. Hence all great designations should not bedissociated. And the foundation of the future, the radiantHierarchy of Bliss, is indeed intensified in the assertion of greatlaws. Verily, it must be remembered that one can build onlythroughHierarchy.OnemaybeintheorbitaffirmedbyHierarchyonly when the consciousness understands that a blow upon theShield of the Name of the Hierarch is a blow at Us, and each onepermittingablowpaysdearly.Thus,inunityliesthesuccessofallworks. The admittance of depreciation is an evidence of faint-heartednessanddefection.Unityisawondrousfire!

362. People are often more perturbed by thunder than by

lightning. Likewise with events—people are more troubled by thereverberation than by the essence. One could say that there is noneedtobeterrifiedbythunderifthelightninghasnotstruck!Onlyanovicefearsthethunderofcannonsanddoesnotheartheflightof a bullet. Psychic energy reacts to the lightning. It can be seenhow the natural capacities of the organism protect one fromperilous conflagration. Thus psychic energy sometimes inducesartificial swellings in order to divert a dangerous conflagrationfrom an adjacent center. It is a very rare manifestation when,under one's eyes, the Yogi's extremities swell and the tissues asquickly contract to their former size. You witnessed such amanifestation when the center of the larynx was threatened byconflagration. In spite of the danger the psychic energy speedilymasteredthefire.

Ejectionslikewisewardoffinflammation;itisentirelyanalogousto volcanoes. A multitude of analogies are revealed to a searchingeye. Only, one should not seek the artifice of a ritual, or forcing.

ThenaturalblendingwiththeHighestisachievedonlythroughanaturally kindled fire of the heart. Certainly the boiling of theChalice that is filled to the brim is unavoidable, but this is theburdenoftheMotheroftheWorld.Remembertheancientimageofan infant lying in a chalice. A multitude of scientific signs aretransformedintomistysymbols,butitistimetostudythem.

363. During cosmic perturbations purifying fires are

accumulated,whichintensifytheatmosphereandpropelthefiresfortheconstructionoftheNewWorld.Thus,upontheruinsoftheoldworldthererisesanewevolutionandtheEpochofFirewhichterminatesKaliYugaandsaturatesspacewiththefireoftheNewWorld.Thus,theall-encompassingBanneroftheLordssummonsto pure creativeness. Thus the avowal of Hierarchy enters life.Thus, We welcome everything that is directed to Good. Thus, Wewelcome everything imbued with a pure striving to walk thehigherpath.

364. It is generally known that before the beginning of Satya

Yugathe scroll ofkarma rolls upwith especial rapidity.It maybeaskedwhy,then,manycrimesandblasphemiesremainseeminglyunpunished? There are many reasons. The first, people prefer tojudge by thunder rather than by lightning. The second, one maynot notice how gradually the circle of events revolves. The thirdreason lies in the motive and in old karmic bonds. Thus, only asubtle consciousness can feel how, behind some undesirableaction, there is concealed not a bad motive. But the reverse alsohappens when an action which is not apparently bad is the resultofaninadmissiblethought.WhenIspeakofspatialjustice,Ihavein mind the law of equilibrium. The Chalice will reflect eachwaveringofthespirit.

365. Observe how each deed reflects upon the fluctuation of

karma.Itcanbeperceivedhowtreasoninallitsaspectscallsfortha speedy formation of karma. One can learn much from suchobservations.Howpainfulit istoseepeopleharmingthemselves!Itcanbeobservedhowthought,likeaviper,strikestheinnerbeingduring these self-defeats. Nothing can avert the consequences,

becausecauseandeffectaretooclose.Thus,onlybythefireoftheheart can one defend oneself and purify the channel that carriesinfection.

366. How greatly people distort the concept of psychic powers,

forgetting that a physical manifestation can always be explainedby a psychic factor, but a psychic manifestation cannot beconfirmed by physical means. When all psychic factors wereeliminated from science then, certainly, a sharp demarcationbetweenorganicandinorganicoccurred.Thus,onemaypointouttoscholarsthatbooksbereftofspirit,psychicenergy,andCosmicFirecannotproducethesciencethatshouldbegiventohumanity.The separation of that which has existed for millenniums fromthat which was created through centuries has disclosed thoseerrorswhichhaveprecipitatedsogreatlytheKarmaofourplanet.

Therefore, humanity must ponder on how to bring the psychicmanifestationsclosertothephysicalworld.Otherwise,establishedscienceandpedantrymaymeetatanemptyboard.Therefore,thevitalityofart,whichguardsthedivinefire,givestohumanitythesaturation by that fire which kindles the spirit and imbues allworlds.Hence,thewondroustorchesofthebeautyofcreativenessare so precious for humanity. We have seen how the creations ofarthavetransformedmen—somethingallthebook-learningintheworld cannot do. Thus the Banner of Beauty and Peace unites theworld.Thusspirit-creativenesssaturatesspace.

367. Who is the giver? The one who possesses. But lest one

become exhausted one should receive from the inexhaustibleSource.LetusturntowardHierarchy.

368.Youhaveheardofthefragranceemanatingfromthesaints.

We shall point out how the aura of saints, bringing them back tothe bloodless kingdom, gives them the fragrance of the flowersthrough which they passed during their round of earlyincarnations. Thus, one can also heal by applying correspondingflowerstothebody.

369. When spiritual quests involve millenniums how can one

deny their achievements? What errors occur on the ground ofdenialoffieryachievements!Thusitcanbeaffirmedthatinvisibleprocessesrevealthepowerofactiontohumanity.Thus,oneshouldunderstand that spiritual energy is the element of Cosmic Fire,whichmoveslifeandimbuesallvitalmanifestations.ThepowerofknowledgeofthehighestenergiesisthekeytoBe-ness.Thesignsof psychic energy are spatially diffused in the entire Universe;thereforeoneshouldharkentotheSpatialFire.

370. One of the most harmful actions is the condemnation of

Hierarchy for the consequences of our own mistakes. Excepttreason,nothingsodefinitelyseversthelinkwiththeHierarchyasdoessuchignorantcondemnation.TheprotectingveilofHierarchyminimizes in everything the consequences of harmful mistakes,but to reject Hierarchy means to bring upon oneself the entiretorrent of consequences. One experienced sailor advised, "Neverchange ships during a storm." One may remember how people,having committed an error, often have tried to explain itsconsequencesasasacrificetoHierarchy,notrealizingthatbythistheyhavealreadycondemnedHierarchy.

371. The adherence to Fire affords saturation of the centers by

the cosmic rhythm. Hence, the resonance is affirmed by acontinuous adherence to the spatial current. The sensitiveness ofthecentersmustbeprotectedandaffirmedasabondbetweenthevisible and invisible worlds. During the resonance of the centers,quietshouldbeobserved.

372. The affirmation of the Teacher should be repeated each

hour, for Our structure is in need of a conscious adoption ofHierarchy. Various events may be expected, but participation inthemcanonlybethroughtheHierarchyproclaimedbyUs.ThusIsay, Not only Our decision but the karma of millenniums makesthestructureofthefutureimmutable.Detailsmaybechanged,butthefoundationmustnotbeviolated.Thus,OurWillshouldnotbeforgotten, even in the details of life. You realize correctly thecreativefairytale,butonlyupontheladderofHierarchywillitbetransformedintothesalvationoftheworld.ThusIspeak.

373."Labor,creategood,reverencetheHierarchyofLight"—this,

Our Commandment, can be inscribed even upon the palm of anewly born child. Thus simple is the Commandment leading toLight.Inordertoadoptitonemustonlybepureinheart.

374. When the planet loses its equilibrium owing to the loss of

spiritual understanding, the consequences to the planet areinevitable;forthereisnokarmiceffectwithoutcauseandnocausewithout effect. The manifestation called forth by the loss ofspiritualstrivingswillcertainlyinducethoseimpulseswhichwillbring regeneration to the planet. The appearance of physicalchanges will give to the planet the understanding of Agni Yoga.The financial crash will effect a revaluation of values. Thedistortion of religions will result in a search for a new spiritualachievement.

Therefore, verily, the crumbling of the old world is a newaffirmation,forthroughthecomingofnewvaluesWebringtotheworldthesalvationofspirit.

375. Thus, upon the principle of Fire the world is regenerated.

Thefireofthecenters,thefireofthespirit,thefireoftheheart,thefire of achievement, the fire of attainment, the fire of Hierarchy,the fire of Service—these constitute the principles of the NewWorld. The blended arcs of consciousnesses thus create theHighestWill.Verily,thegreatBannerofPeacewillcovertheentireworld.Verily,agreattime,thetimeofgreatfulfillments.Thusthetimeofgreatactionapproaches.

376.Ishallsayoftreasontothefanaticsandbigots,Theyassume

that treason is only a matter of thirty pieces of silver, but theyforget that it is contained in each blasphemy and slander. Oneshould not think that a malicious word is not also treason. It ispreciselymalicethatisofteninseparablefromtreasonandslander.One and the same black tree nurtures these loathsome branches,and their fruits are as black as the roots of shame. One mustspeedilyliberateoneselffromthehorrorofmaliciouswords.

377. The transformation of the world is indeed affirmed in thehighest tension. All perturbations, all shiftings, all diseasesaccompany this transformation. The most powerfully propelledenergies bring fires into motion. Thus, in the Epoch of Firedarkness becomes dense, and everything is intensified in a fierystriving.Eviliscreatedbythedensifieddarkness.Lighttransformsthe world. Thus, at the great time, the manifestation of theuniversaltransmutationsaturatesspace.

Thus,duringtheEpochofFire,whenLightbattleswithdarkness,themanifestationoftheBannerofPeaceisthatfundamentalsignwhichwillgiveanewsteptohumanity.ThusBeauty,Knowledge,Art, and all nations will unite under this sign. Thus, only thehighestmeasurescanbeappliedtotheBanner.Verily!

378. Resistance to evil is one of the fundamental qualities of

those who are in search of Hierarchy. Physical qualities will notgivetenacityagainstevil,butthespiritandthefireoftheheartwillcreateanarmoragainstthecunningofevil.Buthowtounderstandevil? Certainly, first of all, it is destruction. But replacing an oldhouse with a new and better one will not be destruction. Bydestruction is meant dissolution leading to an amorphous state.Onemustknowhowtoopposesuchdestruction.Oneshouldfindthe strength of spirit to overcome the cowardice inherent in non-resistance.Thuslettherebereadinesstoopposeevil.

379. How greatly must consciousness be expanded in order to

compriseallbroadaffirmationsandtounderstandtheentiretask.Correspondence,co-measurement,andtensionshouldberealized,for without this understanding one can diminish a world task bymeasuring it in small dimensions. Thus, when creating an urgentworld step, first of all, a world scale must be applied. Thus, whenthegreatBanner,thesignoftheNewEpoch,isunfurled,consciousmeasures should be applied. Therefore, the great proclamationmustbeunderstoodasasteptowardtheregenerationoftheworld.

380. Are there not enough earthquakes? Are there not enough

wrecks, storms, excesses of cold and heat? Has not the fiery crossrisen?Hasnotastarshonebyday?Hasnotafieryrainbowflared?

Have not the signs sufficiently multiplied? But humanity amidstchaosdoesnotwishtobeawareoftheapparentsigns!AndsoWeshall not insist upon a visible sign when doubt has blinded thepeople. But amidst these blind and deaf the children of fire arefound. To them We send signs, that they shall know of theapproachofLight.

381. The consciousness that encompasses only the present,

without any thought of the future, cannot adhere to evolution,becausethechainofcenturiesdisappearsforsuchaconsciousness.Hence, when the consciousness expands it encompasses the greatleadingchainofcausesandeffects.Thus,whileevolutionisbeingestablished, the manifestation of causes is so important. Atpresent, when the planet is completing its Karma, certainly theretributionforengendermentsisgreatlyreflecteduponhumanity.Yetthatwhichisengenderedbyhumanspiritualstrivingenwrapstheplanet.Henceeachbrighttensionandstrivingwillgivetotheplanet the affirmation of the New World. Therefore, the loftyBanner of Peace carries its projectiles of Light and fierily imbuesthe currents around Earth as a panacea against evil. Theconsciousnesses blended for millenniums create. Thus Lightconquers darkness. Thus a wondrous step is being fulfilled. Thusthepreordainedapproaches.

382. Cosmic justice resolves all karmic ties. And how little

humanity ponders upon the affirmations that bear us throughspace!Wouldtheybutponderupontheaffirmationsthatcarryusintothehigherspheres,theywouldinvariablyarriveatHierarchy.ThushumanitywouldgarbitselfintherealizationofTruth.Thus,upon the blending of the arcs of consciousness We create thefuture.

383. If even radio waves react so powerfully upon man, how

powerfully can objects saturated with psychic energy act! Themagnet that is consciously saturated transmits its magneticcurrents; thus Our emanations surround each transmitted gift.ThereforetheaffirmedactionofOursendingscanalwaysintensifythe strength of the one to whom they are sent. Space is raging.

Perturbationsareaccumulating,butabovealleventsanewcurrentisdirectedforthestepofregeneration.

384.CananyoneassertthatOurGuidancehasbelittledhim?Can

anyone say that We have destroyed his best structures? CananyonefindinOurGuidancedestructionanddisparagement?No!Theheartofeachonewillsaythatevenmistakeshavebeenerased,if one's own apostasy did not impede. You could testify how theapostates harmed themselves, but of these consequences theythemselves were guilty. It is glorious to lead the pure soul,unstainedbyapostasy,alongthesummitsofBe-ness.Theaffinityis evidenced as the consequence of cooperation. We call to suchcooperation,whichbindsforever.

385.Cosmicmagnetismimbueseveryvitalprocess.Ourtaskisto

establish the physical correlation of vibrations, for thus it will bepossible to determine the correlations of all manifestations. Eachmanifestation is linked with the centers of subtle energies. Eachflash, each vibration, is correlated with a certain manifestation inCosmos. Studying these waves, one may come to the conclusionthatthebondbetweenallmanifestationsissopowerfulthatbyitone may determine where lies the link with magnetism; thus,different thoughts, standards, and aspirations are impeded bymagnetismofdifferenttensions.

386. Only the unexpected terrifies and frightens. Everything

anticipated already enters into life. This means that theunexpected should be transformed into the expected. In otherwords one should strive to knowledge. Furthermore, thisknowledge should be understood, not formally, but in its entiremultiformity.Whenthemightoflifeitselfshallimbueuswithitsendless variety, the vanguard under the three spheres will beinvincible.Butcognizanceofthethreespheresshouldbeachieved,or else we shall move only along the surface. You must hasten toaccustom yourself to the necessity of movement, within yourinner cognizance. The Teaching will not guide one if it is notapplied.

387. In the development of the works hostility will certainly beencountered, but one must firmly remember two conditions: thefirst—hostile people should be avoided, because they are notpredestined;thesecond—perhapsjustthishostilitywillserveasaworthy springboard. But delay is not caused by enemies—lookcloser!

388. When a victory was announced to the emperor known to

you, he accepted this message in complete calm. The courtierswhispered, "Is it indifference?" But the sovereign said, "Notindifference,butknowledge.Formethisvictoryisalreadypassed,andatpresentIamthinkingofagreatdifficulty."

When We say guard your health, or do not give your writingsinto alien hands, or do not leave your home, We have foreseenmany circumstances already transpired, which should have beenavoided. Who else, then, can define the consequences sosolicitouslyasWe,astheTeacher?WhenWespeakofgratitudeitiscertainlynotbecauseWeareinneedofit,butbythisWetrytostrengthen the bond once more. Each disunity is as perilous as ahookwithbaitinthehandsofthefisherman.

389. The dark forces attempt to battle with Light. They try to

affirmtheirdarkdeeds,strengtheningthemselvesbytreason,butthe Forces of Light are greatly strained and bestow so manymanifestations necessary for creation! The shifting of forces isstrained by the dark counter-action. Thus, Hierarchy faces alltensioninthenameofthegreatcreation.Hierarchybearstheplanfortheshifting.Thus,evolutionadvancespowerfully.

390.Howstupidareallwhodenyhope!Howblindarethosewho

affirm the advantage of wars! How few are the consciousnessesthatcanperceivetheregenerationoftheplanetbywayofculture!Certainly,thosewhodonotcomprehendcreativenessbymeansofhighermeasureswillperishinthesameoldupheavals.Thosewhodo not comprehend the new ways are greatly in need ofunderstanding the Epoch of Maitreya. The Banner of Peace and oftheLordswillopenallways!

391. Again they will come to you in doubt about the law ofkarma. "Is it possible that the unfit ones can revel in comfort,whereas worthy ones suffer?" Answer, "Heavy is the karma ofthosewhocannotforegoearthlycomfort,foritissaid,'Comfortisthecemeteryofthespirit.'"Besides,asyouhaveobserved,earthlycomfortshutsoutspiritualhearing.Butmany,underthemaskofwell-being,hidethegreatestmisfortunes.Thereforenoneofthosewhoknowwillapplythestandardsofearthlycomfort.Oneshouldjudge according to the summits, not thinking of subterraneantorrents.

392. The Teacher is glad to see how you become accustomed to

understanding the possibility of difficulties. One should becomeaccustomed to this blessed realization. It is one of the firstconditionsofadherencetotheHierarchy.

Sometimes I advise you to be silent; also, one must realize thesignificance of tension of space caused by a conscious silence.Moreover, one must remind about the rhythm of repetitions. It isunwisetooverlookthehelpoftechniqueandofvariousconditions.Take, for instance, the condition of a headache. What could bebetterthansilence?Orduringpalpitationsoftheheart,thecosmicrhythm,whichchangesthepulse?

393. Service is often taken as an affirmation quite opposed to

Truth.Serviceisregardedassomethingnotconformingtoreality.Service is regarded as a ritual, as a rhythm, which entered lifeincidentally. But it must be realized that Service is a chain whichconnects the Higher with the lower, and is affirmed in life andpreordained by the manifested essence; thus the entire chain ofService enters into the Hierarchy of Bliss. Thus all actions form aunifying chain; hence the law of Hierarchy can bring us to theHighestBliss.

394. The intensification of energy between the disciple and

Teacher is analogous to a steam engine—a continuous projectionand restitution. Therefore We point out so persistently thenecessityofconcordance,forbenevolence,striving,andgratitude.Only by those means can one develop the dynamics of

concordance.Asteamengineisprovidedwithfuel,butWehaveaninexhaustible reservoir of psychic energy. One should not thinkthat the enumerated qualities are needed by Us; on the contrarythey are needed by you. Otherwise how will you strengthen thebondwithUs?Thepowerfulrhythmofthedynamoofspiritcanbeaffirmed, not by doubt, egoism or self-pity, but only by anindivisible, vigorous striving toward Us. These strivings must beintroduced into life. It should be remembered that each physicallawmustremindofthestabilityofthelawsofthespirit.Withsucha consciousness one can verily become a co-worker for thetransformationoflife.

395.Humanityhassunkinthemireofoutwornsurvivals,inold

thoughts, beyond the realization of affirmed Existence. Thus thespiritoftheshiftednationssmoldersunderthedepartingenergiesof bigotry and superstition. The basis of this smoldering—thechurchthatsowsterror—isintolerable.Astatethatactsbymeansof treason cannot live. Thus, the regeneration of the spirit musteliminate these horrors which engulf the planet. Hence, only theChain of Hierarchy can restore the human image. Thus, a newaffirmationisbeingbuiltbymeansofeternalHierarchy.

396. When the world is convulsed and humanity heaves in

turmoil, there remains only one path to salvation. How is itpossible not to realize the highest, and the creative, path of theascentofthespirit!Justnowwhenalltheoldwaysaredestroyed,whenalltheoldenergiesareout-lived,whentheplanetitselfshiftsitscrust,howisitpossiblenottoadoptwithone'sentirespiritthenew affirmations and the regenerating energies emanating fromthe might of the Chain of Hierarchy! Only thus can humanity beattracted to the higher energies. Following the foundations of theCosmicMagnet,thehighestmanifestationwillattractthespirittothe Highest. Thus, the highest law of Hierarchy creates throughbeneficence,affirmingabetterfuture.

397.Duringatrance,eventhemostaveragemanbecomesadroit,

daring, indefatigable, begins to learn much of what is as yetinaccessible to him, and the evidence of the invisible world

becomesapparenttohim,merelybecauseforatimehehaspartedfrom the lower physical world. But on returning to it the manforgets his higher substance as though it were a dream. A bridgemustbefoundtopreventthelossofconsciousnessandtobecomeenrichedbytheHigherWorld.AgniYogaisgiventobringpeopletotheHigherWorld.

They will say, Why the pains of a Yogi? Certainly this is theburden of this world. Pains are unnecessary where the cosmicrhythmisnotviolated.ThereforeitisbeneficialforaYogitohaveabetterattunedcirclearoundhiminordertogiveacertainformtothe approaching cosmic waves. Therefore, when I speak ofharmony, I do not have in mind only sensitiveness; I point out auseful construction. Hierarchy stands upon exact laws. We, whohave realized them, take upon Ourselves the responsibility ofprotectingthisladderofLight.OnemustrepeatthisuntiringlyinorderthatthestructureofHierarchymaybeimpressedasadesignuponthebrain.

398. The accumulations of cosmic energies correspond to the

affirmationsofhumandisturbancesofspirit.Duringsuchcosmiccorrespondence the disturbances can be resolved only by such apowerfulleverasHierarchy.Whenthechainofeventsdestroystheold foundations, saturating space with tossing energies, thencertainly a force is needed that can propel all energies to newconstructiveness. Hierarchy is the link that transforms thedepartingenergiesintoaradiantfuture.Totheworld,Hierarchyisthe affirmation of a cosmic dimension. In Cosmos everything isboundbytheaffirmeddimensionsofapowerfulHierarchy.Thus,all energies are mutually bound. Thus, the thread of the heart islinkedwithHierarchy.Thus,thisgreatbondestablishesthecosmicSubstance.

399.Whenanewraceisassembled,theAssemblerisaHierarch.

When a new step for humanity is built, the Builder is a Hierarch.When the step preordained by the Cosmic Magnet is constructedupon the vital rhythm, a Hierarch stands at its head. There is nomanifestation of life which does not contain in its seed itsHierarch. The more powerful the step, the more powerful the

Hierarch.

400. Compared to the vegetable kingdom, the animal kingdom

provides far more feasible experiments. If one understood AgniYoga,onecouldfeeltowhatanextenttheinfluenceofmanexertsitselfonanimals.Itcanbeseentowhatanextentirritationorfearor assurance is transmitted to them. Certainly the law of Yogismextends from a "deadly eye" to resurrection. But through amultitude of intermediate steps one may observe various effects.Those who approach Agni Yoga should be warned of the possibleconsequencesofthoughtlessactions.Howmanyunpleasantnessesmight be avoided by simple self-discipline, to which one shouldaccustomoneself.Howmanyachievementsaccumulatedthroughcenturies are swept away by an unrestrained roaring. One mustthink of self-perfectment. One must arouse in oneself thesuperiority of the spirit, which will always be sustained byHierarchy.

401.Thesuperiorityofthespiritwillnotcomeifwedonotstrive

toward it. One must assimilate the thought about thetransitoriness of the earthly hour and the immutability of theInfinite. Thus Agni Yoga is linked inseparably with Infinity andHierarchy.Likewise,onecantransportoneselftothemicrocosmofthe heart, which contains the reflexes of the far-off worlds. Howenticingitistounderstandwithinoneselftherhythmsthatguidetheplanet!Certainly,atthetimeofdisturbancesitisdifficult,buthowwondrousitistoadheretotheCosmicMagnet.

402. All cosmic disturbances are reflected upon and mutually

intensified by vital manifestations. Each energy corresponds to avital manifestation. Thus when the imbalance and destruction ofall the old foundations are affirmed on the planet, thesubterranean fire, whirlwinds, and physical destruction of thecrustarepowerfullyintensified.WhenthefierysignofHierarchyis being affirmed on the planet, conditions are indeed intensifiedbythevivifyingfire.Thus,thegreataffirmationisassertedbythehighestfireofthelifeofHierarchy.

403. Can you indicate any disparagement in the Decrees of the

Teacher?Youcannot,forthentheTeacherwouldnotbeworthyofthis title. But can you vouch for your own actions, sincedisparaging is contrary to the Brotherhood? Disparagement isinvolution, whereas upliftment is evolution. We serve evolution.One can find Commands, warnings, and even indignation, butthereisnodisparagementinOurWorks.EvenOuradversariesarenot belittled. Two types of people differ especially—some willcreatesomethinggreat,evenoutofasmallhint;otherswillcreatea repulsive image, even out of a beautiful vision. Each one judgesaccordingtohisconsciousness.Oneisgreatinheart;theotherhasa heart like a dried mushroom, which one must soak in waterbeforeitisofuse.Verily,onemustredeemallmistakes.Rememberthislaw.

404. It is said that the shirt on a traitor burns. One can notice

howthingsareruinedintheproximityofasickpsychicenergy.405. When the centers are fierily intensified, it means that

correspondence with the cosmic perturbations should be found.The signs are accurate and ascertained by close bonds betweenCosmosandanAgniYogi.Thusthebondrevealsconcordancewithall currents of space. Thus a striving Agni Yogi displays aresponsive vibration to all fiery manifestations. Therefore, healthmust be guarded. A very important time; space vibrates and thewhirlwindsarepowerful.

406. A traveler is in need of indications. Success is a very

sensitive flower. The seeds can be planted only at a designatedtime. One must leave the house in time. But when the Teacherordains the sowing, not a moment should be lost. Only childrencan think that if today has passed, tomorrow will be better. But acourageousmindunderstandsthatsuccessthatismissedwillnotberepeated.Eventhesundoesnotshineuniformly.Refinementofunderstanding should be developed. The complexity of the timewill increase. He who did not discriminate yesterday will not beresourceful tomorrow. The Teacher foresees an undeferrable,immediatesowing.

407.Ahurricanemaybringheapsofgoldashore;humanturmoilcan likewise yield treasures. One must remember that turmoilintensifiesenergies.TheTeacherisonvigil.TheTeacherobservestheimperceptiblefunctions.Heknowswhowilldiscriminateandwhowillbeabletoreceivethegifts.

408. The kings of spirit—where are they? Often people place

themselvesonthelevelofakingofspirit,forgettingthatthemostessential quality of a king of spirit is his following of a Hierarch.Can one ascend to the level of a king of spirit by neglecting theHierarch? Can one expect esteem for oneself through disparagingthe Hierarch? Do not those who oppose the Hierarch carryineradicable stains on themselves? Thus, let humanity rememberand ponder upon how to become true kings of spirit! Thus, onemay warn those who wish to become kings of spirit. Not by self-glorificationdowereachthekinglystepofspirit.Notbystrivingtoanevidentself-doomcanonereachtheaffirmationofthestepofakingofthespirit.

Therefore,WeadviseeachonetofollowaHierarch.409. Thus, We have a list of those following a Hierarch, those

denying a Hierarch, and those who openly oppose the Most High.Certainly the life of each one who, if only a few times, opposes aHierarch,becomesverycomplicated,becausesuchisthelawoflife.HenceitmustberealizedhowimportantitistofollowaHierarch.Thus,theimportanttimemustbeattested.Thus,oneshouldhaveanunderstandingofthemanifestedtime.Thus,WeattesttheNewWorld.Indeed,thedarkonesareinfuriatedandfrightened,butWeare more powerful than darkness. Thus, all dugpas condemnthemselvestoannihilation.

410. Again the deniers of Hierarchy will come and term it

leadership by coercion. Again you will tell them, "Hierarchy hasnothing in common with coercion. It is the revealing law whichdiscloses." We oppose any coercion. We do not direct the energywithouttheconsentoftheco-worker.Weknowtheworthlessnessof everything superficial and outwardly propelled. Like a builder,Wesummonco-workers.ButWeleavehim,whoisnotinneedof

Our boat, to cross the ocean even if it be on a bamboo stick. YetpeopleoftenaresofearfulofallcooperationthattheyarereadytoplungeintomudratherthancontacttheHighest.ManytimesyouwillhavetosunderyourselffrompeopleonaccountofHierarchy.They would rather accept Infinity, because they do not feel theirresponsibility before it. Furthermore, the unavoidableness of thelawofHierarchydisturbsthelimited,selfishmind.

Learn not to insist where you see that the path is besmirched.Onecannotgoagainstkarma.ButamultitudeoffoolishoneshavesinnedagainstHierarchy,hencethefrothoftheirirritation.

411.Whentheworldisplungedintothedarknessofdenial,then

indeed, one must expect the destruction of old unfit foundations,for how else can the world be regenerated? How can humanitycometoitssensesifnotbytheshatteringofallunfitfoundations?OnlywhenthenewandaffirmedgreatprinciplesofHierarchyarerealized by humanity will it be possible to confirm humanity'ssalvation.Thus,Weintenselyimpeltheplanettotheprinciplesofthe Hierarchy of Good. The loss of the highest concepts must becompensated for, because each lost principle brings cosmicupheavals. Thus, humanity must be regenerated upon theprincipleofHierarchy.

412. Only by renewal of thinking can humanity attain the new

planetary step. What a spatial tension surrounds the planet! Suchominous forebodings have taken place only before a stupendouscosmic conflict. Therefore, only when Our Hierarchy shall beaffirmedcanhumanitybesaved.

413. The contemporary dugpas do not find labor too difficult.

Onehasonlytosay,"Howbeautifulyouare,"andthefruitwillfall.Butifoneslackens,thendugpawilltenderlyadvise,"Defer."Thus,he will find a moment when the man lays aside his strength andpossibilities. Certainly, a third and most beloved expedient stillremains—preciselygold.

We protect only those upon the right path. When someonewaversindarkness,hefallsoutoftheareaoftheRay.

414. What thorns people weave into their wreaths of life! Whatstrength people dissipate to counteract those principles uponwhich life itself is maintained! How many unnecessary thornssurroundpeople,transformingtheir livesintoregress!Peoplewillnot understand the higher Wisdom if they do not first of allunderstand the law of Hierarchy—that upon which the entire lifeis founded; that by which the world progresses; that upon whichevolution is built; that upon which the best steps and pages ofhistory have been constructed. Thus, humanity cannot evade thegreatlawofHierarchy.Self-destructionistheonlydirectionalongwhich those bereft of the understanding of Hierarchy proceed;thus, the thorns directed against Hierarchy turn into a dark path.Thus,thegreatlawofHierarchymustbesafeguardedasaleadingprinciple.

415.Inthesmallandinthegreat,onemustbeimbuedwiththe

guiding law of Hierarchy. Thus only will one be able to build thegreat future. Upon the blending of the arcs of consciousnesses islife built. Hierarchy and leadership are affirmed upon the cosmiclaw.HencecreativenessofspiritissoessentiallyimbuedwiththeCosmic Magnet. Thus, the leader is in contact with the CosmicMagnet,andtheentiresaturationoftheworldcanbeintensifiedbythis great law. Thus We create through the merging ofconsciousnessandheart.

416.Hierarchyisagoal-fittingcooperation—thusthispartofthe

Teachingcanbetermed.ButletusnotbeconcernedifyouusetheoldGreekwordHierarchy.Ifsomeoneinterpretsitaccordingtotheconventional understanding, he will only prove that his brain isnotyetreadyforcooperation.

417. Each spirit creates its own karma. Each nation builds its

own Karma. Certainly nations are looking for a leader, becauseevenanestablishedprestigecannotsustainthosepeoplewhothinkerroneously. Neither gold nor vulgar, glamorous names, nor pilesof inapplicable counsels will save a nation. Verily, the fierythought, the fiery spirit of the leader will provide new ways.Therefore, letthestaroftheSpiritualLeadershinebrightlyatthe

time of cosmic perturbations. Thus, let the great Realm of Lightriseupontheruinsoftheoldworld.

Thus,theattractionhasbeenmanifestedasagreatMight.Thus,thetimeofthegreatpredestinedNewWorldhascome.Therefore,woetothosewhogoagainstHierarchy!

418. Diseases are divided as sacred, karmic, and those that are

admitted. The first two concepts are easily understood, butprecisely in the book Hierarchy one should mention the admittedones.Whoorwhatpermitsthesediseases?Certainlyignoranceandthe horror of non-realization. It is not enough not to think aboutthem.Childrenlikewisedonotthinkofthem,yetbecomeinfected.One should protect oneself in consciousness and create aninvulnerable armor of nerve emanations. Even severe epidemicscannot develop if people master their consciousnesses. Anexperiment with the substance of psychic energy would indicatewhat powerful antiseptics people carry within themselves. Forthis,twoconditionsarenecessary:thefirst—realizationofpsychicenergy; the second—realization of Hierarchy as the sole path forthe increase of psychic energy. One should not look uponHierarchyassomethingabstract.Oneshouldrealizefirmlythatitisthemostpowerfullife-giver.Wecallittheprimaryremedy.Butevenapillmustbeswallowedandanointmentapplied.Thereisnoeffectfromaremedythatisinatrunk.Likewise,theBenefactionofHierarchymustbetakenbystriving.Thus,anirrevocablestrivingwillaffordahealingresult.

419. You have witnessed many magic methods, and finally you

havecometotheunderstandingofthemagnetoftheheartandtothe realization of psychic energy. Indeed, why is a substituteneeded if one can receive the might of the Source itself? ManyaccumulationsareacceptedbyhumanityinsteadofstrivingtotheHigher World. People presume that it is easier to reiterate theunrealizedformulasthantocognizethatwhichistheclosesttothehuman essence. Striving upward is not natural to men when thespirit suffers. But is it not better to substitute higher striving forsuffering?

420.Illuminationofthespirit!Howcanonereachthisstep?Howcan one penetrate into the primary source of Truth, if not byadhering to Hierarchy? The spirit can be illumined only throughthe source of Light. Where can one find a leading ray, if not inHierarchy?Humanityhasbeendrawingitspower,notfromwithinitself, but from the power of the great Hierarchy. Thus throughcenturiesOurcreativenesshasguidedhumanity.Thusmancanbedirected only by the Higher Power of Hierarchy. The illuminationof the spirit is assuredly the path of adherence to the highestHierarchy. Hence, those who search for Truth can find thesignificanceofBe-nessonlyinthepathofascenttowardHierarchy,otherwise life remains a vicious circle, and for millenniums thespiritwillnotfinditsliberation.Thus,thelawofHierarchyistheleadingprinciple.

421. The spirit cannot be affirmed and display its strength

without drawing its power from Hierarchy. The spirit cannotmanifestpowerwithoutadoptingtheHigherPower;thereforeeachcreator of life is a link in the great Hierarchy. Thus, also OurGuidanceisthegreatRegency.

422. If you know that an exalted, self-denying thought

physically changes one's aura and even induces rays from theshoulders,thenyoualreadyknowoneofthegreatmysteriesoftheworld. Each visibility is the reflex of a material reaction. Thus, ifirritationgeneratesimperil,theneachexaltedthoughtmustcreatean opposite beneficial substance. And so it is. Certainly Bliss is acomplete reality. It is generated in the cortical system and reactsuponthebrainmatter.TheTibetanringsehasadeepsignificance,being the sediment crystallized by the manifestation of Bliss.Certainly it is difficult to investigate the substance of Bliss whilealive,fortheheartandbraincannotbetouched.Themanifestationofimperilismucheasiertoapproach,inthenervechannelsoftheextremities.Butatthesametimeitwouldbeunjusttodisclosetohumanity the negative substance and to presuppose onlytheoretically the existence of the most salutary substance. Ofcourse, in the laboratory which is being created both substanceswill be demonstrated. We shall not assist the usual experiments,

but where the steps of evolution are being built Our Hand will beon guard! First, We shall give attention to establishing the fact ofimperil.Afterward,WeshalldefinethewaysofthemanifestationofBliss.IfancientsciencepreservedfragmentarymemoriesaboutthesedimentsofBliss,then,certainlyabiochemistcanshowmorecontemporary proofs of it. Later, these experiments upon thesubstance of the organism will be transferred to spatial energies.And again we shall understand why Bliss has the closestcorrelationtoHierarchy.

423. Indeed, it is not necessary to call forth irritation, because

men are filled to the brim with it. It is only necessary to lock sixbipeds in one room and within an hour the door will be shakingfrom imperil. It is more difficult with Bliss, but here, also, theknowledgeofAgniYogaandclosecooperationwithcertainplantswillprovideaperceptibleresult.Certainlythedensificationoftheastralbodywillprovideirreplaceablepossibilities.Adifficulttimeaffordsnewapproaches,andthetreadoftheNewWorldisalreadyaudible.

424. Roses are beneficial for Bliss. All helpful means should be

assembled.Notwithoutreasonwastherosethesymbolofmysteryinalchemy.Butnowadaysroseoilisverypoorlyprepared.

425. Verily inscrutable are Our ways! To the ignorant it seems

thattheinvisibleworlddoesnotexist;theyshowprejudiceagainsteverythingnotperceptibletotheircoarsesenses.Truly,sincemancannotacceptthesacredways,howwillheunderstandthehighestand limitless foundation of life? Man must realize and feel all thesubtle sensations; without this, there can be no correspondenceandaffirmationevidencedbytheunderstandingofHierarchy.

426.Faithisthepresentimentofknowledge.Inthemultiformity

of the All-Existent, faith has an actual foundation. Like a motiveforce, faith intensifies the energy and through this increases theworkingcapabilityofspace.Onecanwelcomethetensityofenergywhen it is connected with the manifestation of the substance ofBliss. Thus We can point out the most evident path of faith

together with an uplifted and refined consciousness. Certainly,Hierarchy is that megaphone which will stir the heavens tothunder.

427. Despair is the death of faith. But faith is knowledge.

Therefore despair is the death of knowledge, the death of allaccumulations. Despair is always connected with a feeling ofissuelessness.Theusualmethodofthedarkonesistoconfinetheirvictiminacirclewithoutissueandthenurgehimtocrime.Indeed,where can the victim turn if he is not aware of the path upward?For those who know the Bliss of Hierarchy there can be no suchthingasissuelessnessanddespair.Thus,onecantracetowhatanextenttheTeachinghasinmindanessential,directbenefit,whichcanbegiventoeveryonewhoknowshowtolookupward.

428.OnemustlearntoaddressoneselftoHierarchyasthemost

immutable.WhatpowertheinvocationofHierarchycangiveone,withoutwasteandwavering!Butthesewaverings,thoughswifterthanaheartbeat,canstingtheconsciousnessworsethanadeadlyviper. One must accustom oneself to constant communion withHierarchy.Onlythusisthenestoflifebuiltintheheart.

429. The earthly life span cannot be lived through without

Hierarchy.Butthedifferenceliesinthekindofhierarchythatcanbecomprisedbytheconsciousness.Indisintegrationonecanturntothehierarchyofgoldandeventothehierarchyofgluttony.

430. How much significance people attribute to their ego! How

people dread that their personality may be intruded upon bysomething incomprehensible to their consciousness! How peopledread to adhere to the Highest and prefer to remain on theboundaryofdarkness!EachintentionbringsoneclosertoabetterdecisionifthespiritstrivestowardtheHierarchyofBliss.Mancanascend each step in evolution if he accepts the Leading Hand andeach Command of Hierarchy. History is built by the Hierarchy oflife.ThebeststepsofhumanitywerebuiltbyHierarchy.Thebestachievements were affirmed by Hierarchy. Thus one can attainonlythroughHierarchy.

Thus is the Great Time affirmed, and We saturate space with aloftycall.

431. A sensitive heart is close to the sensitive ear. A sensitive

heart transforms the brain. The lack of heart annihilates allprevious accumulations. What is the use of literacy if onlysuperficialeyesmeasurethecurvesofahieroglyph!OnerousistheBurdenoftheWorld!FilledtothebrimistheChaliceoftheKeepersof the Magnet! Flaming hearts can combat everywhere theannihilationoftheessenceofBliss.Onecancomprehendwhyoneshould become accustomed to understanding the heart as thepropellant of Be-ness. One can understand how the thread of theheart is linked with Hierarchy. If the heart is withered the brainwill not be kindled to consciousness. Thus we realize chemicallyhowanorganismbecomespartofthegreatHeartoftheUniverse.WhenIadvisecautiousnessitmeansthatouterconditionssettheover-filledChaliceatremor.

432. How, then, does humanity hope to save its Karma and

advance its evolution? Certainly not by denial of the greatfoundations, not through disparaging the highest principles, notby destruction of the affirmed and manifested Origins! Still,humanity continues to base its principles upon destruction, notrealizingthatbreakingawayfromthegreatHierarchycarriesittothe abyss. Thus, self-destruction is the fate of all servitors ofdarkness.Thus,aslongashumanitydirectsitselftothelimitationsestablished by darkness it will not find the path to the HighestLightandsalvation.

433. What state flourishes without a great leader? What

affirmed undertaking has existed without a leader? Verily onemustunderstandthattheconceptofaleaderisthesynthesisofallthe highest strivings. Thus, only the concept of Hierarchy, of anIlluminedLeader,candirectthespirit.Thus, letall,all,allponderupon and remember the Might of Hierarchy. Only through thisrealizationcanoneadvance.Onlythroughthisrealizationcanoneattain. Let it be remembered that each stone thrown at Hierarchywill be transformed into a mountain against oneself. Thus let all

remember!ThusWeproclaimtheLeader—theHierarch!434.Helpeachother,harken!Helpinthesmallandinthegreat.

Helpisarapuponthefuture.Youknownotwhichisthedropthatfilled the cup to the brim. I shall remind you of a tale of ancientIndia:KingRishiputracouldnolongersleep.HesummonedaSageto restore his sleep to him. The Sage said, "King, examine thycouch." The royal couch was examined, and a stone was found inthe folds of the sheets. The King rejoiced, believing that this wasthe cause of his affliction. But sleep did not return and the Sagerepeated his advice. Again the couch was examined, and a deadbutterflywasfound.AgaintheKingwassurethatthecauseofhissleeplessnesswasdiscovered.Buthissleepdidnotreturn.TheSagesaid,"Thereisnoeffectwithoutcause.Thouthyself,King,examinethycouch;fornothingcantaketheplaceofone'sowneye."AndtheKing found under his pillow a grain of gold, small as a mustardseed."Thisminutegraincouldnothaveharmedme,"thoughttheKing. But sleep immediately closed his eyes. In the morning theSage pointed out to the King, "The downfall of the spirit is notmeasuredbyfourths.Thetreasuresofwarcannotoutweighaseedtakenfromawidow.Help,King,whereverhelpcanreach."

Helpwheneverthehandcanreach,whereverathoughtcanfly.Thus shall we rap upon the future. Hence, let us remember thateach hour taken from oneself will be recorded for the future. Onemust become accustomed to the fact that Our cooperation bringsallthatisneededifthehandthatholdsthecurrentdoesnotwither.

The heart aflame with help is Our heart. Thus we may face thetimewhichisterriblefortheignorant,butbrightfortheknowing.

435.Whenwillhumanitylearntounderstandwhereinconsists

thetruedignityofanation?Whenwillhumanityunderstandthatthe sacred spirit should be protected, and that the carriers ofthought, as the sole source, can guide nations? Thus, through theannihilationofthoughtonemaydepriveanationofitsstrengthorofthepredestinedinfluence.Henceeachnationshouldtakecareofits Pilot first of all, since the boat without a rudder cannotwithstand the storm. Therefore, the great care of a nation and ofeach construction must be founded upon Hierarchy; for each

structure must be saturated by the power from Above. Thus, aslongastheunderstandingofHierarchyisnotaffirmed,humanitywillsinkintheignoranceanddarknessofdestruction.

This is why the dark ones are on watch, for they sense howpowerfullytheworldsearchesforandisinneedofreconstruction—thusthedarkonesaffirmtheirownruin!

436. Let no one think that without the energies of the heart he

can comprehend help, cooperation, and Hierarchy. Neither themind nor intellectual erudition will enlighten where only thetensity of the heart can kindle the rainbow of completecomprehension. The shield of heart-comprehension is mostlasting.Theswordpiercessuffering,buttheheartisthestrongholdof the hero. To you, the keepers of the Stone, only heroism isbefitting.Onlyunwaveringnessandcouragebefityou.Theecstasyofaherocomesagainwiththetensionoftheheart.

437. Truly, in the days of perturbations there exists only one

salvation for humanity. Thought that leads to the understandingofHierarchyistheonlywaybywhichhumanitycanbebroughttothe goal of realization of the highest affirmed Hierarchy. Thus, inthedaysofchaosonecansaythatonlybyfollowingtheHierarchycanonereachthebeststep,fortheleadershipofthespiritistheall-comprising and all-encompassing might. Thus it can be assertedwhentheCosmicMagnettransmitsitsmighttohumanitythroughthe leadership of the spirit. Therefore, one should adopt progressthroughHierarchyasthesalvationoftheplanet.

438. Even the imagination is created by a lengthy experience of

accumulationsthroughthecenturies,andallqualitiesofthespiritpertain to the same law. The quality of heroism must also becreatedandtemperedinlife.Wedonotcasuallyremindyouofthedays of past heroism, at the hour when the firmness of the spiritmustagainbeevidenced.Weremindofhowsoonthevaliantandinvincibleheroismmustbemanifested.Thustheaccumulationsofthe spirit are awakened. How, then, can the realization of thebeauty of heroism be created if it has not been justified byexperience in life? How, then, can one affirm that heroism is

beautiful, if the spirit remembers not the transport of the rays ofachievement?What,then,canliftusabovethechaosofmediocrityif not the wings of achievement? Thus, it is best when Hierarchycan evoke a spark of the very same feelings which formerlystrengthenedandupliftedthespirit.

439.Oneshouldgatherthearmorofthespiritwhentheearthis

atremor. Can the mountains be in dread and trees be in terror?Certainly they can, if their spirit is in contact with the developedconsciousness of man. But can the lake rejoice and the flowers bemerry?Certainlytheycan,ifflowersevenwitherundertheglanceof man. Such is the correlation between the lowest and highestlinks of Hierarchy. Only a very refined spirit will find withinhimselfthecouragetoacknowledgeabrothereveninarock.

440. Great firmness, great determination must be evidenced

when the goal is communion with Us. But even a minor treasongeneratesnumerouscalamities.Iwarnthosewhohaveears.

441. In the mighty shifting of nations what can be the saving

manifestation? What else can provide the direction to the Good ifnotthewaytowardHierarchy?Whenthespiritofhumanitysinksintothelowerstrata,whatcanbringittothehigherunderstandingif not adherence to Hierarchy? The Epoch of Fire approaches,whichwillbringtohumanitygreatattainmentsandequallygreattransmutations, because the Epoch of Fire can be assimilated bythespiritthatadherestoHierarchy.

Our co-workers must therefore understand that only throughfierystrivingcanoneattain.IntheEpochofFireonecanbuildonlybyfire.Eachindifference,eachdelay,eachdisplayofegoismisthemanifestationofruin.ButthedisparagementofHierarchyismostheinousofall.

442. If you want to ponder upon the Three Pearls of the World,

can you feel your heart as a summit, bestowing power upon thethreesacredrivers,whichnurturemanylands?Canyoumasterthetrinity of consciousness without diminishing one part? The spiritmust be accustomed to divisibility. One can imagine amidst

sloping hills a strong snowy summit, which takes upon itself allthe burden of the whirlwinds. So rises an Arhat, who takes uponhimselftheentireburdenofimperfection.Ascloudshoveraroundthe summit, sometimes screening it from earthly eyes, so thewearisomeburdensoftheworldpiercetheChaliceofanArhat.Onemust possess the stronghold of striving in order to nurture therivers,gatheringthewholeinvincibleServicetoHierarchy.WhyistheServicecalledgreat?BecauseitapproachestheInfinite.Thisisthe measure by which you can think of the Three Pearls of theWorld.

443. If I again say that the currents are difficult, the ignorant

mayask,"Butwhenwilltheybedifferent?"Iwillsay,"Withinthedefile of darkness the calm of death may exist, but upon thesummits are the whirlwinds of the far-off worlds." Thus, guardyourhealth.

444. The Spatial Fire rages especially when the evidence of

humanimperfectionmanifestsitselfonapowerfulscale.TheFire,permeatingallvitalcosmicmanifestations,rushesimpetuouslytotheformationofnewbodies.Butwhentherearenocorrespondingmanifestations in the vital actions of humanity, then, certainly,destruction asserts itself both in Cosmos and in the humanaffirmation.AsCosmoshasitscenterofCosmicFire,sohumanitymust realize its fiery center in the Hierarchy, which guideshumanityandimbuesitwiththepowerfulleadingprinciple.Thus,one can strive to the realization of the Highest Hierarchy of thefieryHeart.

Thus,humanitymustrealizeallthebeststrivings.Onlythuscanone progress in evolution. Verily, only by adhering to Hierarchycan one advance. Hence, in the great time of shifting, humanitycanbesavedonlythroughHierarchy.ThereforeitissoimperativetorealizethegreatnessoftheLeaderastheSaviorofnations.Thetimeisaustere,butgreat.Thusweshallconstructthegreatfuture.

445.Theapproachisendless;so,too,aredefeats.Fewwilldiscern

whereisvictoryandwheredefeat.Onemustknowtherelationofspiritualgrowthtothevictoryoverdarkness.Darknesscandisplay

the Maya of well-being, whereas Light can attest to violentcommotions. Each one strives along the shortest path, but who iscapable of imagining the best achievements? Only the link withHierarchycanrevealtheuniquenessofthebestpath.Ourdecisionis to consider achievement as the shortest path. The dark onesconsider fearlessness as a bad sign. We have determined not toavoid the steep path. For them, each ascent is an unnecessarydissipation of strength. With Us, the Ray of Light is a bridge ofgranulations,buttheydreamofavoid.Weunderstandeachdaringleap; for them, it is but recklessness. Thus, between the daring ofwisdom and the recklessness of treason stands only the heart. Itwill safeguard and open the Gates of Hierarchy. He will err lesswhofollowsthesilverthreadstretchedfromhishearttotheheartoftheTeacher.

446. It is necessary to accept the one direction to that Heart

where there is no refusal. The channel of the heart must bepurified. Will it not be the protecting net of the planet, like thesilver threads of destinies? One should not think of the heart as abloboflowermatter.Ifso,howtocontacttheHighestWorld?

Onemustaccustomoneselftothethoughtofvictory.Otherwise,how many defeats are but the consequences of indifference.Indifferenceisalreadydefeat;asinthepresent,sointhefuture.

447.Duringgreatconstructions,certainlythebattleisalsogreat,

because the dark ones are afraid of losing their weapons. Thus,eachstrivingdirectedtotheGoodundoubtedlycallsforthattacks.However, one should understand the invulnerability of theservitorofLight,forwhentheheartisflaminglyimbuedwiththeHierarchy, all hostile attacks can be overcome. Indeed, it must beunderstoodthateachpersonalfeelingunderminestherootsofthegreat structure. Thus, so much of the wondrous is destroyed byhumanity,becauseLeadershipwasrejected.Thereforenoonewillbe successful who has not realized the greatness of Leadership.Thus,theclosestandthemostdistantonesmustsensethecurrentofeachaffirmedlaw.

448. Hierarchy is cooperation. But with cooperation, the

intensificationofenergiesresultsinacontinuouscircuitofsparks,from above downward and from below upward. The dynamoproducingthisflamingtorrentistheheart.Itmeansthataboveallelse, Hierarchy is the Teaching of the Heart. One should beaccustomed to understanding the heart as the central motivepower. One cannot understand the flame without understandingthe significance of the heart. I spoke to you of many centers, butjustnowIespeciallystresstheChaliceandtheheart.TheChaliceisthe past, the heart is the future. Now, certainly, we comprehendthattheascentisaccomplishedonlyalongthesinglesilverthread!Therefore, let us be especially cautious with the predestinedstructure.Thechemistvaluesararereactioninacertaintesttube,andnothingintheworldwillrepeatthisreactionifthetesttubeisbroken.SoitiswithOurconstruction.

449. Likewise the heart should be understood as the unique

natural link between the visible and invisible worlds. Manysecretions bind the lowest strata of both worlds, but only thethread of the heart can lead into the Infinite. In this lies thedifference between magic and the nature of the spirit. Thus, Iadvise,firstofall,topayattentiontotheheartasthesourceofthepredestinedunificationoftheworlds.ItshouldnotbethoughtthatHierarchy is only discipline; it is the advance into the HigherWorld.

450.Therealizationoftheimmutabilityoftheplandirectseach

trend of thought to Truth. Creativeness of the spirit demands asaturatedonwardstriving;thereforeeachwaveringcarriesawayaconstructiveapproach.ThefundamentalqualityofcreativenessisthedirectfollowingoftheHierarchy.Onlythuscanitbeaffirmedthat the path will lead to the highest attainments. How else canhumanity contact the Spatial Fire if not through the approach toHierarchy? Thus, the leading principle of Hierarchy fierily impelshumanity to a new advance. Without this mighty progressdarknesswillengulftheplanet.

451.IfoneweretoexpoundtheconditionandaimsofYoga,the

number of applicants would not be great. For them the

renunciationofselfhoodwouldbedreadful.WhenaYogifeelsthesameduringwantorplenty;whenhefeelshimselfonlyadisposerof means; when he feels his destination in bringing service to theworldandhisholidayincommunionwiththeHigherForces—sucha way of life, with the assumption of all the burdens ofsurroundingimperfections,willnotbepleasanttomany.Manyarealtogether incapable of thinking about the future, lullingthemselves with the misunderstood letters of the Scriptures. Wemustnotthinktoomuchoftheearthly,yetitisnotsaidanywherethatweshouldnotthinkofthefuture.ThethoughtofthefutureisalreadylikegatestotheInfinite.Thus,thinkofthefuture,andyoumaybesurethatthisthoughtwillbesupportedbyHierarchy.

452. One should think of Us precisely as of an Inexhaustible

Spring;otherwisetheearthlyriversmaydryup.MuchhasalreadybeensaidbyUsabouttheTeachingbeingasourceoflife.Itshouldbe understood that the linking of the worlds would already be asalutaryconquest.

453. How easy it is to ameliorate life only by striving to a

manifestvictoryofthespirit!Is itpossiblethatallthediscoveriesofsciencehavenotbroadenedhumanthinking?

454. When you understand the foundations of Hierarchy, We

shallproceedtoanexplanationofthecenteringofthespiritintheheart.Inordertolinkthechainoftheworldsitwillbenecessarytogivespecialattentiontotheheart.Onlythusshallwekeepwithinthe boundaries of a natural growth of the spirit. The abode of thespiritisintheheart.ThoughtsaboutHierarchyarespiritualizedbythe heart. Thus we shall remain as before in the essence of a trueaccumulation.

455.ThepowerofGuidanceimbueshumanitywithallstrivings.

Each attainment directed to progress is affirmed by the HigherWill. The guaranty is manifested only by affirmation of thecorrelation between the Higher Will and assimilation. Thus isrevealedtohumanityadirectbondbetweentheHierarchyandthedisciple. Thus, verily, the great Might underlies the silver thread

that links all the best inceptions. Truly, it can be affirmed thatvictoryunderliesthebondwiththeHigherWill.

456. Everyone whose consciousness can already contain the

significance of Hierarchy must first of all renounce blasphemy ofthe spirit. Much unworthy blasphemy is uttered and thoughtamidst the usual work of day and night. The most dangerouspoison is produced by these imperceptible treasons. Often theirconsequences are more dreadful than one misdeed through crassignorance. It is not easy to break the habit of the abomination ofblasphemy, for the boundary between the white and black iscomplicated. We call this contamination a black ulcer similar tocancer.Besides,themeaningofcanceringeneralisnotfardistantfromtheconsequencesofaspiritualabomination.Likestrivingtothe Guide, one should develop in oneself comprehension of theHighest Hierarchy. Ponder that in concluding our notes aboutHierarchy We do not conclude anything, but only open the nextGates.

457.Spirit-creativenessisthemostpowerfulattractionofforces.

Aroundtheseedaregroupedvariousparticleswhichareunitedbyone and the same fiery attraction. Each inception can exist onlythrough this fiery attraction. Therefore the Might of Hierarchy isthat great Magnet which keeps everything in concatenation andbroadens all possibilities. The principle of Hierarchy underlies allvital manifestations. The principle of Hierarchy leads the entireCosmos. Thus, spirit-creativeness imbues with fire allmanifestations of space. The symbol of Great Guidance isestablishedinCosmos.

458. Fear generates ugliness. Nothing that proceeds from fear

can have a worthy importance. It is impossible to approachHierarchy through fear. It is not possible to understand theapplicationoftheHighestChainbeforerealizingtheharmoffear.There are many ways to Hierarchy. But the slippery unsteadinessoffearwillnotenduretheascentupontherocks,andatremblinghand will not feel the handrails which have been carefullyprepared. The condition of fearlessness must be understood

equally with devotion. Broad is devotion, but you remember howmulticoloredisfear.Amanwhoisnotevenbadmaybefrightened,and this infection can forever deprive him of ascent. Hence, oneshouldcureoneselfoffear.

Besides psychic energy, musk is useful, because it strengthensthe nervous system and kindles the protective net. Thus thestrengthening of the centers of the heart and Chalice gives anecessary strength to the protective net. Heart, fiery Chalice,illumineyethepathoftheascendingones!

459. The ways of the heart, the fiery ways that lead to the

ascension of the spirit, are developed by being imbued with oneandthesameimpulseoftheattractionoftheCosmicMagnet.Howmanydifferentbranchingsthesensitivefieryheartpossesses!Butitssourceisone,anditspotentialityisimbuedbythesolesource,Hierarchy.Thewaysoftheheart,thefieryways,proceedfromthegreat summit of Hierarchy and lead to that Pearl of the World.Thus, We affirm the flame of the heart and the wondrous silverthread that unites the worlds. Thus we conquer throughcreativenessmanifestedbythesilverthread.

460.Avalianteyewillnotbedulled.Avalianteyewilllookinto

thesunofHierarchy.Notcringing,notirritation,notprofit,willbethe gates to Hierarchy. But willing Service, a heartfelt veneration,andconsciousascentwillbringonetothethresholdofLight.

WefinishOurwritingonthisGreatDay,whenonemorestepofSatyaYugahasbegun.Thestepofascentwasproclaimedthroughscriptureslongago,butthedustofthebazaardulledpeople'seyes.So it is today. It will again be asked, "Where is the trumpet call,where are the wings of the angels, where is the sundering ofmountainsandseas?"Theblindonestakethetempestforacalltotherepast.

Thus,thecureisintherealizationoftheHierarchyoftheHeart.The Teaching will be revealed to those who have perceived therightpath.TheMessengerwillknockattheirdoor.

AgniYogaBooks

LeavesofMorya'sGardenILeavesofMorya'sGardenIINewEraCommunityAgniYogaInfinityIInfinityIIHierarchyHeartFieryWorldIFieryWorldIIFieryWorldIIIAumBrotherhoodSupermundaneLettersofHelenaRoerichILettersofHelenaRoerichIIOnEasternCrossroadsFoundationsofBuddhismAgniYogaGlossary

AgniYogaSociety

www.agniyoga.org