2011 csu-pueblo football media guide
DESCRIPTION
The 2011 Colorado State University-Pueblo Football Media Guide. Get all you need to know about the ThunderWolves!TRANSCRIPT
contentsuniversityLocation Pueblo, ColoradoFounded 1933Enrollment 5,400President (Interim) Dr. Julio LeonAthletic Director Joe FoldaAssociate AD/SWA Niki WhitakerNickname ThunderWolvesColors White, Red and BlueAffiliation NCAADivisionIIConference Rocky MountainStadium Neta & Eddie DeRose ThunderBowlCapacity 6,500Athletic Department Phone (719) 549-2711Ticket Sales Contact Ben LoCascioTicketOfficePhone (719)549-2050
media relationsSports Info. Director Anthony SandstromOfficePhone (719)549-2022Fax (719) 549-2570Press Row Phone (719) 549-2351E-Mail anthony.sandstrom@ colostate-pueblo.eduWebsite GoThunderWolves.comSID Mailing Address 2200 Bonforte Blvd. Pueblo, CO 81001
coacHinG staFFHead Coach John WristenAlma Mater Southern Colorado (1984)CSUP Record 11-10 (third year)Career Record 11-10 (two seasons)OfficePhone (719)549-2075Coordinators Chris Symington, Hunter HughesAssistants Mike Babcock, Donnell Leomiti Steve Sewell, Paul Creighton, Bernard Jackson Roxy Burris, Dale Cresswell, Sam Sewell Carl Fetters, Craig Ward, Stig Jantz
Football inFo2010 Overall Record 9-22010 RMAC Record 7-2 (3rd place)First year of football 1938All-time record 214-203-15 (.513)
creditsCSU-Pueblo Football Media Guide design and layout by Anthony Sandstrom, CSUP Sports Information Director. Photos supplied by Bill Sabo, Pro Action Photo.
Quick Facts/Media Info 1
Athletic FacilitiesMassari Arena 2Neta & Eddie DeRose ThunderBowl 3Strength Training Facility 4
Coaches & Support Staff Head Coach John Wristen 6All-Time Coaching Records 7Assistant Coaches 8Support Staff 10
Meet the Pack2011 Preliminary Rosters 12Season Preview 15Returners 18Transfers 36Freshman 37
2011 Opponents2011 Opponent Quick Facts 402011 Opponent SID Contacts 42
2010 Year-in-ReviewSeason Statistics 442010 Starting Lineups 46The Last Time CSU-Pueblo... 482010 Game Recaps 49
Rocky Mountain Athletic Conference 60RMAC Season in Review 62RMAC Football Records 63RMAC Annual Leaders 65RMAC Teams in the Postseason 66
Record BookSeason/Home/RMAC Opener
Records 68All-Time Record vs. Opponents 68All-Time Series vs. Opponents 69Year-by-Year Results 70All-Time Letterwinners 74Football Record Book 77Top Ten Career Records 79Top Ten Season Records 81ThunderWolves in the Pros 84
CSU-Pueblo 86Pueblo & Southern Colorado 88NCAA Division II 89President Julio Leon 90Athletics Staff 912011 Schedule Back Cover
2
MASSARI ARENA
Colorado State University-Pueblo’s Massari Arena is considered one of the finest basketball and indoor facilities in the Rocky Mountain Athletic Conference and one of the top Division II arenas in the nation.
Massari Arena was re-opened in 2008 following a a two-year, $12 million reno-vation that expanded not only the arena, but the Sam Jones Sports Center, which includes a wrestling room, aerobics room, strength-training facility, racquetball and squash courts, swimming facility, athletic department offices, and classrooms for the University’s Exercise Science department.
Massari Arena seats 3,900 fans and is the home of CSU-Pueblo’s men’s and women’s basketball, wrestling and volleyball programs.
The arena includes one section of premium chair-back seating and a luxury box overlooking the arena, dubbed “The Wolf Pack Room”
Massari is also connected to CSU-Pueblo Student Recreation Center, which includes two gymnasiums, a climbing wall, indoor running track, and access to racquetball courts, cardio/weight room, and more. Membership to the Recreation Center is free for all CSU-Pueblo full-time students.
3
NETA & EDDIE DERoSE ThuNDERbowlColorado State University-Pueblo’s Neta
and Eddie DeRose ThunderBowl is one the premier institutions in all of NCAA Division II.
The ThunderBowl is unique in that it was built completely with external funds raised by “Friends of Football”, a col-lection of Pueblo community members and University alums, totalling over $13 million and allowing for the return of football, wrestling and women’s track and field to CSU-Pueblo in 2008.
The ThunderBowl features 6,500 seats, a synthetic turf field, a ten-lane all-weather track, throwing, jump-ing and pole vault areas, as well as a 27,000-square-foot field house, which includes a 4,300-square-foot strength
and conditioning complex for all 16 of CSU-Pueblo’s intercol-legiate athletics programs, team meeting areas, student-athlete study-areas and lounges, and track and football coaches’ of-fices.
4
STRENGTh TRAINING FACIlITIESCSU-Pueblo boasts two outstanding
strength and conditioning facilities on campus at CSU-Pueblo dedicated to train-ing athletes. Together they represent some of the most outstanding strength and conditioning facilities in all of Divi-sion II athletics.
Strength & Conditioning Facilities at the Neta and Eddie DeRose ThunderBowl
The strength and conditioning facility in the field house is 4,309 square feet in size. Included in this facility are 12 state of the art multi-station platforms where you can perform all of the Olympic style exercises, squats, bench press, incline press, pull-downs and pull-ups all on the same station. There are also multiple sets of dumbbells ranging from 5-120 lbs and adjustable free standing benches that can adjust from decline to flat to incline allowing performance of a wide vari-ety of dumbbell exercises. Water filled kegs and tractor tires are also available in the facility to allow performance of implement based exercises. There are sets of various height plyometric boxes and a large selection of medicine balls to provide the opportunity to perform a variety of plyometric drills. In ad-dition, there is also a leg press, leg extension and leg curl machine in the facility, primarily meant to be used by injured athletes who can-not adhere to the normal training protocol. There is also aerobic exercise equipment available in this facility.
Strength Training Facilities at Massari Arena
The newly updated strength and conditioning facility in Massari Gymnasium is 1,839 square feet in size. This facility has a large variety of free weight (squat racks, bench press and incline press benches, dumbbells ranging from 2lbs to 100 lbs) and machine based resistance training equipment along with a variety of aerobic exercise equipment.
5
COACHING & SUPPORT STAFF HEAD COACH JOHN WRISTEN
PAGE 6 ASSISTANT COACHES
PAGE 8SUPPORT STAFF
PAGE 10
6
JOHN WRISTEN HEAD FOOTBALL COACH4TH SeaSon • SoUTHeRn CoLoRaDo ‘84
John Wristen, a former all-conference quarterback at Colorado State Univer-sity-Pueblo, enters his fourth season as the ThunderWolves head football coach.
Facing the momumental task of forging a football program from the ground up when he accepted the job in July 2007, Wristen has answered the call, leading the Pack to a 4-6 record in 2008, the fourth best record in nCaa Division II history for a startup pro-gram in its first season of competition.
He upped the ante with a 7-4 record in 2009, including a big road win over defending-RMaC Champion, Chadron State, and halting the eagles’ 28-game RMaC winning streak. The seven wins marks the third-most wins in nCaa Di-vision II history for a startup program in its second season.
The ThunderWolves’ 11-10 mark over its first two seasons of competi-tion is also the third-best record among nCaa Division II startup programs.
In 2010, the Pack turned in an even more impressive campaign, going 9-2
and finishing just a game out of an RMaC Championship and a national playoff berth.
Wristen returned to Pueblo after coaching the previous 17 years in the nCaa Division I ranks at the University of Colorado, northwestern University, and, most recently, UCLa. He was cho-sen from an application pool of more than 100 football coaches.
During the 2006 season, Wristen served as the special teams and tight ends coach at UCLa. He coached all-american tight end Justin Medlock and worked closely with the offensive coordinator in play calling.
Prior to UCLa, he served his second of two stints at CU from 1999-2006. He helped guide the Buffaloes to four Big 12 north Division Championships and the 2001 Big 12 Title. He coached the tight ends, kickoff and punt teams, and was given the additional responsibil-ity of recruiting coordinator in 2003. He coached three all-americans and helped develop and implement the West Coast offense at CU.
From 1991-1999, Wristen served as the running back, kickoff return and punt team coach at northwestern Uni-versity. The Wildcats won back-to-back Big 10 Titles in 1995 and 1996 during Wristen’s tenure, and he coached Heisman Trophy finalist Darnell autry. northwestern, who played in the Rose Bowl for the first time since 1949 dur-ing Wristen’s time, received the 1997 nCaa Graduation award for graduat-ing 100 percent of its undergraduate student-athletes.
Wristen’s career in Division I football started in 1990 as a graduate assistant at CU, working with the quarterbacks and running backs and helping the Buf-faloes to the 1990 national Champion-ship.
He also served as the offensive coordinator at Fort Lewis College, head football and girls basketball coach at Rocky Ford (Colo.) High School, and assistant football coach at Weslaco (Texas) High School.
As the starting quarterback at then-University of Southern Colorado,
Wristen was an honorable mention all-american quarterback, guiding USC to its only naIa national Playoff appearance in 1983. He graduated as USC’s all-time leader in passing yards (3,283) and touchdown passes (26). In 1982, Wristen led the naIa in pass-ing efficiency with a 182.5 rating as a junior.
after graduating with an education degree, Wristen signed a free agent contract with the Denver Broncos. af-ter being released from the Broncos, he worked toward a Master of arts degree from adams State College, which he received in 1988.
He is the father of three children: Jovanna, C.T. and Bailey.
THE WRISTEN FILEEDUCATIONB.a. SOUTHERN COLORaDO, 1984 M.a. aDaMS STaTE COLLEGE, 1988
CAREER ACCOMPLISHMENTS• HAS HIGHEST WINNING PERCENTAGE IN CSU-PUEBLO FOOTBALL HISTORY (20 WINS, 12 LOSSES, .625 WIN PCT.)• HELPED UNIVERSITY OF COLORADO TO FOUR BIG XII CHAMPIONSHIPS WHILE AN ASSISTANT COACH• ON CU COACHING STAFF THAT WON 1990 NATIONAL CHAMPIONSHIP• HELPED DIRECT NORTHWESTERN TO A BIG TEN CHAMPIONSHIP• COACHED SIX PLAYERS STILL CUR-RENTLY PLAYING IN NFL
HEAD COACHING RECORD2008 CSU-PUEBLO 4-6 (.400)2009 CSU-PUEBLO 7-4 (.636) 2010 CSU-PUEBLO 9-2 (.818) TOTALS 20-12(.625)
7
CSU-PUEBLO COACHING RECORDS – YEAR-BY-YEARYEAR COACH OVERALL CONFERENCE NOTESJUNIOR COLLEGE ERA1938 Dale Rea 1-3-2 1-2 First year as collegiate program1939 Dale Rea 2-4-0 2-1 1940 Dale Rea 3-2-1 0-21941 Jack Johnson 0-6-1 0-21942 Dan Lawrence 1-4 1-21943-45 No team - World War II1946 Maurice “Red” Elder 5-4 1947 Maurice “Red” Elder 3-3-1 3-1-11948 Maurice “Red” Elder 7-1-1 4-1-11949 Maurice “Red” Elder 5-3-1 2-2-11950 Maurice “Red” Elder 4-6 3-21951 Maurice “Red” Elder 1-8 1-51952 Harry Simmons 2-6-1 2-41953 Harry Simmons 6-3 5-31954 Harry Simmons 5-4 5-31955 Harry Simmons 3-4-1 3-3-11956 Joe Prater 5-3 5-21957 Joe Prater 4-5-1 3-3-1 1958 Joe Prater 3-6 2-5 1959 Joe Prater 4-4-1 2-3-1 1960 Joe Prater 6-4 4-3 1961 Joe Prater 4-6 3-4 1962 Joe Prater 7-3 3-3 FOUR-YEAR COLLEGE ERA (MEMBER OF NAIA)1963 Joe Prater 3-5-0 None First year as four-year college 1964 Joe Prater 6-4-0 None 1965 Joe Prater 8-1-1 None 1966 Joe Prater 3-7-0 None 1967 Joe Prater 3-6-1 None 1968 Joe Prater 4-6-0 None MEMBER OF NCAA COLLEGE DIVISION (DIVISION II)1969 Joe Prater 7-2-0 3-2-0 First year in RMAC (Plains Division) 1970 Joe Prater 5-5-0 1-4-0 1971 Joe Prater 4-6-0 1-4-0 1972 Joe Prater 6-4-0 3-3-0 First year in Great Plains Athletic Conference 1973 Joe Prater 3-7-0 1-4-0 1974 Mike Friedman 3-6-0 1-4-0 1975 Mike Friedman 4-5-0 3-2-0 MEMBER OF NAIA1976 Mike Friedman 6-4-1 5-2-0 Rejoined Rocky Mountain Athletic Conference1977 Mike Friedman 3-7-0 2-7-0 Forfeited three wins due to ineligible player 1978 Mike Friedman 8-2-0 None Not eligible for RMAC Championship1979 Mike Friedman 8-2-0 6-2-0 Finished season ranked 14th in NAIA 1980 Mike Friedman 9-1-0 7-1-0 RMAC Co-Champions Finished season ranked 9th in NAIA 1981 Mike Friedman 4-6-0 2-6-0 1982 Mike Friedman 9-2-0 7-1-0 NAIA National Playoffs Finished season ranked 5th in NAIA 1983 Mike Friedman 6-3-1 6-1-1 1984 Gary Richardson 2-8-0 2-6-0 1985-2007 Football Program Disbanded MEMBER OF NCAA DIVISION II2008 John Wristen 4-6-0 3-6-0 Ranked 10th in NCAA Division II Attendance 2009 John Wristen 7-4-0 6-3-0 Ranked 16th in NCAA Division II Attendance2010 John Wristen 9-2-0 7-2-0 Ranked 17th in NCAA Division II Attendance
ALL TIME COACHING CAREER RECORDSCOACH YEARS WINS LOSSES TIES PCT.Joe Prater 1956-73 (18 yrs.) 85 84 4 .503Mike Friedman 1974-83 (10 yrs.) 60 38 2 .608Maurice “Red” Elder 1946-51 (6 yrs.) 25 25 3 .500John Wristen 2008-Pres. (3 yrs.) 20 12 0 .625Harry Simmons 1952-55 (4 yrs.) 16 17 2 .485Dale Rea 1938-40 (3 yrs.) 6 9 3 .400 Gary Richardson 1984 (1 yr.) 2 8 0 .200Dan Lawrence 1942 (1 yr.) 1 4 0 .200Jack Johnson 1941 (1 yr.) 0 6 1 .000
8
HUNTER HUGHESDEFENSIVE COORDINATOR 4TH YEAR AT CSU-PUEBLO
Hunter Hughes is entering his fourth season as CSU-Pueblo’s defensive coordinator.
Under Hughes’ leadership, the Thunder-Wolves defensive unit has been consistently ranked among the top defenses in the RMaC and the nation.
In 2010, Hughes’ unit allowed the ninth-least points per game in the country, allowing just 15.6 points per game. It also led the RMaC in
sacks and turnover ratio, the latter of which is was ranked 4th in the na-tion.
CSU-Pueblo’s ability to force turnovers has been a hallmark under Hughes, as the Pack led the RMaC in turnover ratio in 2009 and 2010. also, in 2009, the ThunderWolf defense led the conference in interceptions, and boasted the lowest third-down and fourth-down efficiency in the RMaC.
Hughes rose through the ranks as a coaching assistant with two of the most prestigious Division I football programs in the country - University of Colorado and the University of Tennessee.
With the University of Colorado, Hughes was a defensive graduate as-sistant from 2003-2006, assisting in coaching various defensive positions as well as assisting in recruiting prospective CU students east of the Mis-sissippi River. With the University of Tennessee, Hughes also served as a defensive graduate assistant, focusing chiefly on linebackers and defensive backs.
Hughes received his Master’s in physical education and sport management from Middle Tennessee State University in 2001. He and his wife, Stephanie, an assistant coach for the CSU-Pueblo softball team, live in Pueblo.
CHRIS SYMINGTONOFFENSIVE LINE COORDINATOR 3RD YEAR AT CSU-PUEBLO
Chris Symington is entering his third season as CSU-Pueblo’s offensive line coach and run game coordinator.
Symington directed the nation’s most im-proved running game in 2009, turning a unit that ranked in the bottom 10 nationally in rushing yards in 2008, and turning it into the nation’s 14th-best running attack in 2009. Amazing, the Pack running game accom-
plished this with two sophomores in the backfield and and true or redshirt freshmen on the offensive line.
His unit followed it up with a repeat performance in 2010, ranked 16th in the nation and helping elevate Jesse Lewis as a Harlon Hill award finalist.
Symington brought 25 years of experience as a player and coach to the ThunderWolves, much of it at the Division-I level. He had served as the of-fensive line coach at eastern Michigan from 2003-2008, helping the eagles’ offense to record the most total yards in school history in 2008 and put up some of the most prolific rushing yardage numbers in the history of the program.
Prior to his time at eastern Michigan, Symington had held offensive line coaching posts at numerous universities, including Tennessee State (2000-03), Western Kentucky (1996-99), and Vanderbilt (1990-94). From 1995-96, Symington was the offensive coordinator at the Division-II level with northwood (Mich.) University.
an offensive lineman at the University of Colorado from 1984-88, Sym-ington was named the Freedom Bowl Most Valuable Player in 1985, was the team’s offensive player of the year in 1987, and was an all-Big 8 honor-able mention selection. Prior to obtaining his first coaching position as a graduate assistant at CU alongside current CSU-Pueblo head coach Wris-ten, Symington signed a free agent contract with the Tampa Bay Bucca-neers in 1988.
Symington and his wife, Marti, have six children: adam, Jessica, Blair, Jackson, Mary Grace and Stuart, as well as four grandchildren.
MIKE BABCOCKQUaRTERBaCKS COaCH/PASS GAME COORDINATOR 4TH YEAR AT CSU-PUEBLO
Mike Babcock is entering his fourth season as an assistant coach with the Thun-derWolves and his third as the team’s pass game coordinator and quarterbacks coach.
after serving as tight ends coach for one season, Babcock undertook the Pack’s quarterbacks, and watched as Pack quar-terbacks shattered most school passing
records, including most passing yards per game. In 2010, he helped direct a ThunderWolves offense that averaged
36.7 points per game, 13th most in the nation.Babcock, who played linebacker for the Bruins at UCLa from 1997-
99, was on two Pac-10 championship teams, and played in the 1998 Cotton Bowl and 1999 Rose Bowl. He received his Bachelor’s in sociol-ogy from UCLa in 2002 before earning his Master’s in education in 2004, also from UCLa. He was the tight ends coach at the University of San Diego in 2007, and was a graduate assistant at UCLa from 2000-04. From 2005-06, he was the offensive quality control intern at the University of Colorado.
Babcock and his wife, Kimberly, have a son, Tyler. The family resides in Pueblo.
STEVE SEWELLRUNNING BACKS COACH 4TH YEAR AT CSU-PUEBLO
Steve Sewell is entering his fourth season as CSU-Pueblo’s running backs coach.
In his first three seasons as the Pack’s running backs coach, he coached a unit that improved from the bottom 10 nationally during his first season in 2008 to the 14th-ranked rushing unit in the nation in 2009. In 2010, the Pack backs were ranked 16th nationally.
Sewell is famously known to Denver Broncos fans in southern Colo-rado, having played for the Broncos from 1985 to 1992, including the Broncos’ Super Bowl seasons of 1986, 1987 and 1989. Since retiring in 1993, Sewell, a resident of aurora, Colo., had slowly warmed up to coaching as his day job, having most recently been an assistant coach with the Grandview High School football team in Centennial, Colo.
Sewell, who had been the team’s offensive coordinator the past two seasons, was instrumental in Grandview’s 5a Colorado State Champi-onship title in 2007. During Grandview’s state championship run, the Grandview offense was nearly unstoppable, averaging 332 yards of of-fense per game, including an average of 237 rushing yards per game. The state’s leading individual runner, Bo Bolen, tutored under Sewell, en route to 2,291 rushing yards and 28 touchdowns.
In Sewell’s four seasons with the team, Grandview made the 5a state playoffs three of those four seasons, including a berth in the state semi-final in 2005.
as a player with the Broncos, Sewell had learned from some of the best, including current and former nFL head coaches Mike Shanahan (Washington Redskins) and Chan Gailey (Buffalo Bills), as well as for-mer nFL head coaches Dan Reeves (Broncos), Wade Phillips (Dallas Cowboys), and Mike nolan (49ers). as a player at the University of oklahoma, Sewell was coached by Barry Switzer and current University of Texas head coach, Mack Brown, each of which won national cham-pionships at the collegiate level. Sewell also played alongside current Houston Texans head coach, Gary Kubiak, who was a backup quarter-back for the Broncos during Sewell’s time with the team.
Sewell received his bachelor’s degree in organizational Communi-cation from the University of oklahoma in 1986. a California-native, Sewell graduated from Riordan High School in San Francisco in 1981. He is the father of three children: Samuel, Caleb and Calah.
ASSISTANT COACHING STAFF
9
DONNELL LEOMITIDEFENSIVE BACKS COACH 4TH YEAR AT CSU-PUEBLO
Donnell Leomiti is entering his fourth season as CSU-Pueblo’s defensive backs coach and recruiting coordinator.
Leomiti has coached up an incredibly efficient defensive backfield in his three seasons with the Pack, coaching one all-region defensive back (2010 selection, Grant Crunkleton) and being a main reason why CSU-Pueblo led the RMaC in turnover
ratio in both 2009 and 2010. In 2010, CSU-Pueblo was 4th in the na-tion in turnover ratio.
In his time at CSU-Pueblo, Leomiti has coached five all-RMaC de-fensive backs: Chris Brown (2009 and 2010), Crunkleton (2010), Jon Bailey (2010), Josh Costa (2010) and Jerome Page (2008).
Leomiti had been the defensive technical intern at CU since 2005. at CU, his responsibilities included working with the secondary as well as on-campus recruiting.
Leomiti arrived at the post after serving as a high school assistant coach from 1999-2004. He spent 1999 and 2000 at Denver north High School, and then followed that up with a four-year stint as linebackers coach at Boulder High School.
as a CU player, Leomiti was a member of many great teams in the mid-1990s. Starting out as a receiver at CU, he saw action in 11 games, including the Fiesta Bowl, as a true freshman in 1992. He moved to safety the following year, starting at strong safety as a junior and senior. He had 159 career tackles, including 98 as a senior (the third most on the team), along with three interceptions, three fumble recoveries and seven pass deflections. Two of his biggest plays came his junior year (1994): he returned an interception for a touchdown at Missouri and had a key fumble recovery in the fourth quarter at Michigan, a big play in the game now referred to as both “The Miracle in Michigan” and “The Catch.”
Born in Santa ana, Calif., he graduated from Leone High School in Pavaiai, american Samoa, in 1992 where he lettered in football, basketball and baseball. He was a two-time ashaa League most valu-able player on offense, earning the honor his junior and senior years. He is the father of three children, Donnell Jr., Siliaga, and Malekai. He is married to former CSU-Pueblo all-american cross country athlete, Lauren Dunsmoor.
PAUL CREIGHTONDEFENSIVE LINE COACH 1ST YEAR AT CSU-PUEBLO
Paul Creighton is entering his first season as the defensive line coach at Colorado State University-Pueblo.
He comes to CSU-Pueblo after serving as the defensive graduate assistant at the University of Colorado during the 2009 and 2010 seasons.
Creighton returned to his alma mater of Colorado after a stint at auburn University
where he was the graduate assistant strength and conditioning coach for two years, working with some athletes that went on to win the 2010 nCaa FBS national Championship.
originally a walk-on at Colorado where he earned a bachelor’s degree in psychology in 2006, he was placed on scholarship after just one semester. He ultimately played in 47 games at CU at tight end, fullback and special teams, seeing action in two bowl games.
a Tecumseh, neb.-native, he graduated from niwot High School in niwot, Colo. in 2002. He is married to the former Kathleen almon.
BERNARD JACKSONWIDE RECEIVERS COACH 1ST YEAR AT CSU-PUEBLO
Bernard Jackson, former CSU-Pueblo wide receiver, is entering his first season as the ThunderWolves’ wide receivers coach.
In 2010, Jackson led the ThunderWolves in receiving with 34 receptions for 453 yards, logging 721 all purpose yards dur-ing the season. His success came after a four-year hiatus from the game, last hitting the field as the starting quarterback at the
University of Colorado in 2006.a native of Corona, Calif., Jackson also received the ThunderWolves’
Fellowship of Christian athletes Integrity award in 2011. He is the father of one son, Jayden, and resides in Pueblo.
CRAIG WARDASSISTANT DEFENSIVE LINE COACH 4TH YEAR AT CSU-PUEBLO
Craig Ward is entering his fourth season as a student assistant defensive line coach at CSU-Pueblo.
A former all-conference linebacker at then-University of Southern Colorado, Ward boasts a 100-tackle season to his credit during his collegiate days. He also played for one season in the USFL with the Michigan Panthers in 1983.
Ward and his wife, annette, have eight children: Shawana, Millie, anna, D.J., Kimmy, Josh, Patrick and anthony.
CARL FETTERSOUTSIDE LINEBACKERS COACH 2ND YEAR AT CSU-PUEBLO
Carl Fetters, longtime high school football coach well-known in the Pikes Peak area, enters his second season as a volunteer assistant defensive backs coach with the ThunderWolves.
From 1969-97, Fetters was the head football coach at Cheyenne Mountain High School. He received his Masters from ad-ams State College
SAMUEL SEWELLTIGHT ENDS COACH 1ST YEAR AT CSU-PUEBLO
Former University of northern Colorado tight end Samuel Sewell enters his first season as the ThunderWolves’ tight ends coach.
Sewell played in nearly every game dur-ing his four seasons with the Bears, seeing action in 42 out of 44 games from 2007-10.
Son of CSU-Pueblo assistant coach and former Denver Bronco, Steve Sewell, the
aurora, Colo. native resides in Pueblo.
ASSISTANT COACHING STAFF
10
FOOTBALL SUPPORT STAFFDALE CRESSWELLDEFENSIVE COACH 4TH YEAR AT CSU-PUEBLO
Dale Cresswell is entering his fourth season as a volunteer assistant coach with the CSU-Pueblo football staff, specializing in the team’s defensive unit.
A former all-conference linebacker at then-University of Southern Colorado, he is one of just 17 players in progam history to have 100 or more tackles in a single season.
ROXY BURRISOFFENSIVE COACH 4TH YEAR AT CSU-PUEBLO
Roxy Burris is entering his fourth season as a volunteer assistant offensive coach with the ThunderWolves.
Burris came to CSU-Pueblo after coaching and teaching at Pueblo South High School for 39 years. While on the South staff, he tutored a young quarterback named John Wristen, a South High School graduate.
STIG JANTZCHaRaCTER COaCH 4TH YEAR AT CSU-PUEBLO
Stig Jantz, a longtime fixture at Colorado State University - Pueblo and with the CSU-Pueblo football program, enters his fourth season as the program’s “character coach”.
Jantz tutors team members, especially incoming freshmen, about the demands of being a Pack football player, using a unique motivational style to get the most out of ThunderWolf players.
a 1984 graduate of Cal State-northridge, Jantz currently serves as an academic counselor for Upward Bound at Pueblo Community College. He and his wife, Janessa, reside in Pueblo.
DAVID RAMIREZDEFENSIVE ASSISTANT 1ST YEAR AT CSU-PUEBLO
Former Pueblo east High School head coach David Ramirez will begin his first sea-son as a defensive assistant at CSU-Pueblo.
Ramirez helped turn around a dormant east football program, leading team to playoffs for first time in 12 years in 2008, earning SCL Coach of the Year honors.
The Pueblo native, Centennial High School grad and Colorado College grad currently
teaches social studies at east High School.
JON VICARSSTUDENT ASSISTANT 1ST YEAR AT CSU-PUEBLO
Former CSU-Pueblo guard Jon Vicars enters his first season as a student assistant with the CSU-Pueblo football team.
a starting guard for the Pack in 2010, he helped lead an offensive line that finished the season ranked in the top 20 nationally in rushing for the second straight season.
ROGER CLARKDIRECTOR OF ATHLETIC TRAINING 10TH YEAR AT CSU-PUEBLO
Roger Clark is entering his first season as the head trainer for the CSU-Pueblo football team, but his 10th year at Colorado State University-Pueblo.
Clark is the director of the athletic Train-ing program at CSU-Pueblo and also runs the athletic training room at the neta and eddie DeRose ThunderBowl, which serves all CSU-Pueblo student athletes and serves
as the main athletic training room for the football and women’s track and field programs.
as the director of the CSU-Pueblo athletic Training Program, he takes a lead role instructing athletic training majors both in the class-room and on the field. Under his tutelage, he assigns trainers to spe-cific sports at CSU-Pueblo and oversees all degree-seeking students.
a graduate of Illinois-Urbana, Clark completed his Masters in athletic Training from the University of arizona before earning his Ph.D. in exercise Physiology/athletic Training from the University of Pittsburgh.
Dr. Clark’s hobbies are building and flying radio controlled model airplanes, cycling and playing acoustic guitar. He resides in Pueblo.
ALLEN HEDRICKSTRENGTH & CONDITIONING COACH 3RD YEAR AT CSU-PUEBLO
allen Hedrick, M.a., CSCS*D, FnSCa, Coach Practitioner, is entering his third sea-son as the strength coach for CSU-Pueblo, as well as the CSU-Pueblo football program.
Hedrick directs the strength training regimens for all CSU-Pueblo football play-ers, adapting specific workouts for each position group.
Hedrick’s program yielded immediate results upon his arrival with the program midway through the 2009 season, as injuries decreased immensely, while the offensive and defensive lines, the chief position groups most reliant on effective strength training, enjoyed significant statistical improvement from 2008 to 2009.
In 2011, two of CSU-Pueblo’s football players, Jesse Lewis and Lee Meisner, were named national Strength and Conditioning association all-americans, a testament to the work they did with Hedrick.
Prior to coming to CSU-Pueblo, Hedrick led the strength training programs for the air Force academy’s football program, as well as at the olympic Training Center, just to name a few.
Hedrick and his wife Stephanie reside in Pueblo and have two children (Lindsey and Brandon). In addition to coaching Hedrick also competes in the sport of weightlifting and finished third at the national Masters Weightlifting Championships in 2009.
TONY HARRISONASST. STRENGTH & CONDITIONING 3RD YEAR AT CSU-PUEBLO
Tony Harrison, a 2007 CSU-Pueblo grad, is entering his third season as CSU-Pueblo’s assistant strength and conditioning coach.
Harrison has experience from MBS Sports Performance in Pueblo, and is a member of the U.S. Weightlifting Federation. He is a graduate of Pueblo South High School.
11
MEET THE PACK ALPHABETICAL AND NUMERICAL ROSTERS
PAGE 12SEASON PREVIEW
PAGE 15RETURNERS
PAGE 182011 TRANSFERS
PAGE 182011 FRESHMEN
PAGE 33
12
2011 T-WOLVES NUMERICAL ROSTERNO NAME EXP/CL* POS HT WT HOMETOWN (Previous School)1 Jared Radebaugh HS/Fr. QB 6’0” 185 Thornton, Colo. (Northglenn)2 Grant Jansen 3L/Sr. DE 6’0” 225 Colorado Springs, Colo. (Pine Creek)3 Jonathan Owens VR/RJr. WR 6’2” 180 Topeka, Kan. (Butler County CC)4 Stephan Dickens 1L/So. DB 5’8” 160 Aurora, Colo. (Cherokee Trail)5 Jon Kuzava RS/RJr. QB 6’0” 190 Littleton, Colo. (Chadron State College)6 Nick Henderson 1L/RSo. DB 5’10” 180 Berthoud, Colo. (Berthoud)7 Jervoise Hollins HS/Fr. DL 6’1” 228 Aurora, Colo. (Overland)8 Brode McDonald HS/Fr. QB 6’0” 200 Fort Collins, Colo. (Rocky Mountain)9 Brandon Kliesen 1L/RSo. P 5’10” 200 Pueblo, Colo. (South)10 Kyle Major 3L/Sr. K 6’3” 230 Littleton, Colo. (Heritage)11 Josh Sandoval 1L/So. WR 5’11” 155 Pueblo, Colo. (East)12 Mark Sterling 2L/RJr. CB 6’0” 185 Colorado Springs, Colo. (Sierra)13 Jared Sperber 1L/Sr. WR 6’3” 195 Oakley, Kan. (Garden City CC)14 Jamaal Johnson 3L/RSr. RB 5’9” 185 Fountain, Colo. (Fountain-Ft. Carson)15 Ross Dausin 1L/Jr. QB 6’5” 230 San Antonio, Tex. (Butler County CC)16 Troy Graham 2L/RJr. QB 6’5” 225 Chandler, Ariz. (Northern Arizona)17 Deontrae Cooper RS/RFr. WR 6’2” 180 Riverside, Calif. (Citrus Hill)18 Jon Bailey 3L/Sr. SS 5’11” 190 Fort Morgan, Colo. (Fort Morgan)20 C.J. Roberts RS/RFr. DB 6’0” 180 Boynton Beach, Fla. (Santaluces)21 Marcial Williamson 1L/Sr. WR 6’1” 190 Lakewood, Wash. (Air Force Prep)22 Damon Schiele 2L/RJr. ILB 6’0” 220 Aurora, Colo. (Gateway)23 Franex Dort JC/Jr. CB 5’11” 176 Lake Worth, Fla. (Mt. San Jacinto JC)24 J.B. Matthews HS/Fr. RB 5’11” 178 Aurora, Colo. (Rangeview)25 TivaTatofi HS/Fr. LB 6’0” 205 Kaneohe,Hawaii(Kamehameha)26 Josh Costa 3L/Sr. SS 5’8” 185 Nanakuli, Hawaii (Kamehameha)27 Donovan Bowens TR/So. TB 6’0” 197 Arvada, Colo. (South Dakota)28 Jesse Lewis 3L/Sr. RB 5’6” 173 Loveland, Colo. (Loveland)29 ChrisAshe HS/Fr. RB 6’1” 190 ColoradoSprings,Colo.(Widefield)30 Buster Thede TR/Jr. LB 6’0” 210 Arvada, Colo. (Western New Mexico)31 Kyle McCall 3L/Sr. OLB 6’1” 205 Aurora, Colo. (Grandview)32 Giovanni Rider 1L/RJr. FB 6’1” 220 Pueblo, Colo. (County)33 Justin LaBorde HS/Fr. LB/DE 6’0” 215 Pueblo West, Colo. (West)34 Jason Campbell 2L/RJr. OLB 6’1” 225 Kailua, Hawaii (Kamehameha)35 Jarrod Lacy RS/RFr. S 5’10” 180 Boynton Beach, Fla. (Santaluces)36 Lee Meisner 3L/Sr. LB 6’0” 240 Sterling, Colo. (Sterling)37 Blake Sylvester RS/RFr. LB 5’10” 200 San Antonio, Tex. (Smithson Valley)38 Louie Lozano VR/RSo. LB 5’11” 197 Whittier, Calif. (La Serna)39 Justin Jackson JC/Jr. TB 5’8” 225 Pueblo West, Colo. (Garden City (KS))40 Ben Estica HS/Fr. LB/DE 6’1” 196 Palm Beach, Fla. (Santaluces)41 Adrian Marquez 3L/Sr. ILB 5’9” 210 Denver, Colo. (Bear Creek)42 Joe Campton 3L/Sr. LS 6’2” 245 Littleton, Colo. (Columbine)43 Tyler Hamlin 2L/RJr. TE 6’2” 215 Louisville, Colo. (Monarch)44 Marquis McNeal RS/RFr. FB 5’8” 230 Commerce City, Colo. (Prairie View)45 LouisFisher RS/RFr. LB 6’2” 205 Broomfield,Colo.(Broomfield)46 Dyrell Hallcy VR/Sr. LB 5’10” 230 Denver, Colo. (Glendale (AZ) CC)47 Beldy Nseka 2L/RJr. OLB 6’0” 216 Aurora, Colo. (Cherokee Trail)49 Trent Thompson RS/RFr. TE 6’4” 205 Pueblo, Colo. (Central)50 Dexter Scott 1L/RJr. LB 6’0” 242 Morrow, Ga. (Georgia Military)51 Evan Ruppert RS/RFr. LB 6’0” 225 Colorado Spgs., Colo. (Cheyenne Mtn.)52 JonathanJones 2L/Jr. C 5’8” 225 Houston,Tex.(Westfield)54 Taylor Kelly VR/RSo. OT 6’5” 245 Ojai, Calif. (Nordhoff)55 Corey Orth TR/RJr. DE 6’5” 255 Buena Vista, Colo. (Eastern Arizona)58 Alex Fenlon HS/Fr. FB 6’0” 200 Woodland Park, Colo. (Woodland Park)59 Ben Jackson 1L/RSo. OG 6’1” 265 Brighton, Colo. (Brighton)60 J.T. Haddan 2L/RJr. C 6’2” 285 Craig, Colo. (Moffat County)61 R.J. Trione 1L/RJr. OG 5’11” 240 Wheat Ridge, Colo. (Wheat Ridge)62 Mario Kinoshita HS/Fr. C 6’0” 230 San Antonio, Tex. (Brandeis)66 Ryan Jensen 2L/Jr. OT 6’4” 265 Fort Morgan, Colo. (Fort Morgan)67 Patrick Barnes HS/Fr. OL 6’3” 285 San Diego, Calif. (Torrey Pines)68 Drew Swartz 2L/Jr. OT 6’4” 280 Gilbert, Ariz. (Gilbert)69 James Vicars 1L/RSr. OT 6’9” 340 Torrance, Calif. (Torrance)70 Chris Warren 1L/RJr. OG 6’2” 265 Walnut, Calif. (Walnut)71 Scotland Coyle RS/RFr. C 6’2” 245 Longmont, Colo. (Longmont)72 Gary Dixon HS/Fr. OT 6’3” 280 Fontana, Calif. (Summit)74 Austin Payne RS/RFr. OT 6’6” 238 Pueblo West, Colo. (West)76 Nick Sabye 3L/Sr. OG 6’6” 240 Phoenix, Ariz. (Paradise Valley)
77 Zack Martinez HS/Fr. OL 6’4” 254 Redlands, Calif. (Redlands East Valley)80 Koby Wittek 3L/Sr. TE 6’3” 236 Golden, Colo. (Golden)81 PaulBrowning RS/RFr. WR 6’3” 212 Widefield,Colo.(Widefield)82 Roger Pfannenschmid 2L/RJr. TE 6’3” 240 Pueblo, Colo. (Centennial)84 Treyben Letlow HS/Fr. TE 6’4” 225 Hayden, Colo. (Hayden)85 Da’Quan Cartwright 3L/Sr. WR 6’1” 205 Pueblo, Colo. (South)87 Josh Bredl RS/RSo. DE 6’6” 255 Thornton, Colo. (Horizon)90 Darius Allen HS/Fr. DL 6’0” 200 Pueblo, Colo. (East)91 Josh Mack 1L/RSr. DE 6’3” 267 Pueblo, Colo. (East)92 Tony Campton HS/Fr. DT 6’0” 270 Littleton, Colo. (Columbine)93 Emanuel Tottress VR/Jr. DE 6’3” 230 Aurora, Colo. (Gateway)95 Ethan Ward RS/RFr. DE 6’3” 230 Pueblo West, Colo. (West)97 Justin Herrera 2L/RJr. DE 6’3” 220 Littleton, Colo. (Heritage)99 Austin Warren HS/Fr. DE 6’2” 225 Lubbock, Tex. (Monterey) Hawken Albus HS/RFr. WR 6’6” 210 Lexington, Neb. (Lexington) Wes Bennett HS/Fr. RB/LB 6’2” 185 Longmont, Colo. (Longmont Christian) Matt Biery HS/Fr. S/RB 6’2” 185 Kiowa, Colo. (Elizabeth) Brock Campbell TR/RFr. WR 5’10” 170 Meeker, Colo. (Northern Colorado Kevin Cuff HS/Fr. LB 6’0” 215 Torrey Pines, Calif. (Torrey Pines) Jonathan Gaye VR/RJr. RB 6’0” 180 Highlands Ranch, Colo. (Colo. State) Tuff Gibson HS/Fr. LB 6’0” 195 Merino, Colo. (Merino) Dominique Grimes HS/Fr. RB/DB 5’8” 165 Nashville, Tenn. (East Literature) Austin Huff HS/Fr. WR 6’1” 170 Aurora, Colo. (Cherokee Trail) Nic Johnson RS/RFr. RB 6’1” 195 Evergreen, Colo. (Evergreen) Ronell McNeal HS/Fr. CB 5’9” 165 Aurora, Colo. (Prairie View) Michael Mintken RS/RFr. WR 5’10” 165 Aurora, Colo. (Grandview) D.J. Morman TR/So. LB 6’0” 225 Colo Springs, Colo. (Valley City St (ND)) Greg O’Donnell HS/Fr. K 6’0” 158 Monument, Colo. (St.Mary’s) Kevin Parks Fr./HS DB 5’10” 178 Fountain, Colo. (Fountain-Ft. Carson) Jeff Richards HS/Fr. LB 6’0” 210 Pueblo, Colo. (South) Drew Rodriguez VR/RSo. S 6’1” 180 Ojai, Calif. (Nordhoff) Joe Rosenbrock HS/Fr. RB/LB 5’10” 185 Brush, Colo. (Brush) Jorden St.Louis HS/Fr. DB 5’11” 175 Lantuna, Fla. (Santaluces) Pat Smith HS/Fr. OG 6’3” 275 Pueblo, Colo. (East) Kana Souza HS/Fr. QB 5’11” 180 Maui, Hawaii (Kamehameha Maui) Nik Spinuzzi HS/Fr. QB 5’11” 180 Pueblo, Colo. (South) Tyrell Strickland HS/Fr. CB 6’0” 180 Fort Worth, Tex. (Richland) Jarred Thompson HS/Fr. DB 5’10” 165 Brighton, Colo. (Prarie View) Keanu Trujillo Fr./HS OL 6’2” 260 Raton, N.M. (Raton) Desmond Turner Fr./HS DB 5’10” 185 Denver, Colo. (Gateway) John Vela HS/Fr. RB 5’7” 160 Pueblo, Colo. (Centennial) Riley White HS/Fr. S 6’1” 205 Castle Rock, Colo. (Douglas County) Ian Young HS/Fr. DB 6’2” 188 Colorado Springs, Colo. (Doherty) Tomas Zepeda HS/Fr. LB 6’1” 225 Denver, Colo. (George Washington)
13
2011 T-WOLVES ALPHABETICAL ROSTERNO NAME EXP/CL* POS HT WT HOMETOWN (Previous School)8 Hawken Albus HS/RFr. WR 6’6” 210 Lexington, Neb. (Lexington)3 Darius Allen HS/Fr. DL 6’0” 200 Pueblo, Colo. (East)29 ChrisAshe HS/Fr. RB 6’1” 190 ColoradoSprings,Colo.(Widefield)18 Jon Bailey 3L/Sr. SS 5’11” 190 Fort Morgan, Colo. (Fort Morgan)67 Patrick Barnes HS/Fr. OL 6’3” 285 San Diego, Calif. (Torrey Pines) Wes Bennett HS/Fr. RB/LB 6’2” 185 Longmont, Colo. (Longmont Christian) Matt Biery HS/Fr. S/RB 6’2” 185 Kiowa, Colo. (Elizabeth)87 Josh Bredl RS/RSo. DE 6’6” 255 Thornton, Colo. (Horizon)81 PaulBrowning RS/RFr. WR 6’3” 212 Widefield,Colo.(Widefield) Brock Campbell TR/RFr. WR 5’10” 170 Meeker, Colo. (Northern Colorado34 Jason Campbell 2L/RJr. OLB 6’1” 225 Kailua, Hawaii (Kamehameha)42 Joe Campton 3L/Sr. LS 6’2” 245 Littleton, Colo. (Columbine)92 Tony Campton HS/Fr. DT 6’0” 270 Littleton, Colo. (Columbine)85 Da’Quan Cartwright 3L/Sr. WR 6’1” 205 Pueblo, Colo. (South)17 Deontrae Cooper RS/RFr. WR 6’2” 180 Riverside, Calif. (Citrus Hill)26 Josh Costa 3L/Sr. SS 5’8” 185 Nanakuli, Hawaii (Kamehameha)71 Scotland Coyle RS/RFr. C 6’2” 245 Longmont, Colo. (Longmont) Kevin Cuff HS/Fr. LB 6’0” 215 Torrey Pines, Calif. (Torrey Pines)15 Ross Dausin 1L/Jr. QB 6’5” 230 San Antonio, Tex. (Butler County CC)4 Stephan Dickens 1L/So. DB 5’8” 160 Aurora, Colo. (Cherokee Trail)40 Ben Estica HS/Fr. LB/DE 6’1” 196 Palm Beach, Fla. (Santaluces) Alex Fenlon HS/Fr. FB 6’0” 200 Woodland Park, Colo. (Woodland Park)45 LouisFisher RS/RFr. LB 6’2” 205 Broomfield,Colo.(Broomfield) Jonathan Gaye VR/RJr. RB 6’0” 180 Highlands Ranch, Colo. (Colo. State)58 Tuff Gibson HS/Fr. LB 6’0” 195 Merino, Colo. (Merino)16 Troy Graham 2L/RJr. QB 6’5” 225 Chandler, Ariz. (Northern Arizona) Dominique Grimes HS/Fr. RB/DB 5’8” 165 Nashville, Tenn. (East Literature)60 J.T. Haddan 2L/RJr. C 6’2” 285 Craig, Colo. (Moffat County)46 Dyrell Hallcy VR/Sr. LB 5’10” 230 Denver, Colo. (Glendale (AZ) CC)43 Tyler Hamlin 2L/RJr. TE 6’2” 215 Louisville, Colo. (Monarch)6 Nick Henderson 1L/RSo. DB 5’10” 180 Berthoud, Colo. (Berthoud)97 Justin Herrera 2L/RJr. DE 6’3” 220 Littleton, Colo. (Heritage)7 Jervoise Hollins 1L/So. NG 6’1” 228 Aurora, Colo. (Overland) Austin Huff HS/Fr. WR 6’1” 170 Aurora, Colo. (Cherokee Trail)59 Ben Jackson 1L/RSo. OG 6’1” 265 Brighton, Colo. (Brighton)39 Justin Jackson JC/Jr. TB 5’8” 225 Pueblo West, Colo. (Garden City (KS) CC)2 Grant Jansen 3L/Sr. DE 6’0” 225 Colorado Springs, Colo. (Pine Creek)66 Ryan Jensen 2L/Jr. OT 6’4” 265 Fort Morgan, Colo. (Fort Morgan)14 Jamaal Johnson 3L/RSr. RB 5’9” 185 Fountain, Colo. (Fountain-Ft. Carson) Nic Johnson RS/RFr. RB 6’1” 195 Evergreen, Colo. (Evergreen)52 JonathanJones 2L/Jr. C 5’8” 225 Houston,Tex.(Westfield)54 Taylor Kelly 1L/RSo. OT 6’5” 245 Ojai, Calif. (Nordhoff) Mario Kinoshita HS/Fr. C 6’0” 230 San Antonio, Tex. (Brandeis)9 Brandon Kliesen 1L/RSo. P 5’10” 200 Pueblo, Colo. (South)5 Jon Kuzava RS/RJr. QB 6’0” 190 Littleton, Colo. (Chadron State College)33 Justin LaBorde HS/Fr. LB/DE 6’0” 215 Pueblo West, Colo. (West)35 Jarrod Lacy RS/RFr. S 5’10” 180 Boynton Beach, Fla. (Santaluces Community) Coy Letlow TR/Jr. S 6’0” 202 Hayden, Colo. (Northern Colorado)84 Treyben Letlow HS/Fr. TE 6’4” 225 Hayden, Colo. (Hayden)28 Jesse Lewis 3L/Sr. RB 5’6” 173 Loveland, Colo. (Loveland)38 Louie Lozano 1L/RSo. LB 5’11” 197 Whittier, Calif. (La Serna)91 Josh Mack 1L/RSr. DE 6’3” 267 Pueblo, Colo. (East)10 Kyle Major 3L/Sr. K 6’3” 230 Littleton, Colo. (Heritage)41 Adrian Marquez 3L/Sr. ILB 5’9” 210 Denver, Colo. (Bear Creek) Zack Martinez HS/Fr. OL 6’4” 254 Redlands, Calif. (Redlands East Valley)24 J.B. Matthews HS/Fr. RB 5’11” 178 Aurora, Colo. (Rangeview HS)31 Kyle McCall 3L/Sr. OLB 6’1” 205 Aurora, Colo. (Grandview)8 Brode McDonald HS/Fr. QB 6’0” 200 Fort Collins, Colo. (Rocky Mountain)44 Marquis McNeal RS/RFr. FB 5’8” 230 Commerce City, Colo. (Prairie View) Ronell McNeal HS/Fr. CB 5’9” 165 Aurora, Colo. (Prairie View)36 Lee Meisner 3L/Sr. LB 6’0” 240 Sterling, Colo. (Sterling) Michael Mintken RS/RFr. WR 5’10” 165 Aurora, Colo. (Grandview) D.J. Morman TR/So. LB 6’0” 225 Colorado Springs, Colo. (Valley City State (ND))
47 Beldy Nseka 2L/RJr. OLB 6’0” 216 Aurora, Colo. (Cherokee Trail) Greg O’Donnell HS/Fr. K 6’0” 158 Monument, Colo. (St.Mary’s)55 Corey Orth TR/RJr. DE 6’5” 255 Buena Vista, Colo. (Eastern Arizona/Wyoming)
NO NAME EXP/CL* POS HT WT HOMETOWN (Previous School) Jonathan Owens VR/RJr. WR 6’2” 180 Topeka, Kan. (Butler County CC) Kevin Parks Fr./HS DB 5’10” 178 Fountain, Colo. (Fountain-Ft. Carson)74 Austin Payne RS/RFr. OT 6’6” 238 Pueblo West, Colo. (West)82 Roger Pfannenschmid 2L/RJr. TE 6’3” 240 Pueblo, Colo. (Centennial)1 Jared Radebaugh HS/Fr. QB 6’0” 185 Thornton, Colo. (Northglenn) Jeff Richards HS/Fr. LB 6’0” 210 Pueblo, Colo. (South)32 Giovanni Rider 1L/RJr. FB 6’1” 220 Pueblo, Colo. (County)5 C.J. Roberts RS/RFr. DB 6’0” 180 Boynton Beach, Fla. (Santaluces) Drew Rodriguez VR/RSo. S 6’1” 180 Ojai, Calif. (Nordhoff) Joe Rosenbrock HS/Fr. RB/LB 5’10” 185 Brush, Colo. (Brush)51 Evan Ruppert RS/RFr. LB 6’0” 225 Colorado Spgs., Colo. (Cheyenne Mtn.)76 Nick Sabye 3L/Sr. OG 6’6” 240 Phoenix, Ariz. (Paradise Valley) 11 Josh Sandoval 1L/So. WR 5’11” 155 Pueblo, Colo. (East)22 Damon Schiele 2L/RJr. ILB 6’0” 220 Aurora, Colo. (Gateway)50 Dexter Scott 1L/RJr. LB 6’0” 242 Morrow, Ga. (Georgia Military) Pat Smith HS/Fr. OG 6’3” 275 Pueblo, Colo. (East) Bryson Souza HS/Fr. QB 5’11” 180 Maui, Hawaii (Kamehameha Maui)13 Jared Sperber 1L/Sr. WR 6’3” 195 Oakley, Kan. (Garden City CC) Nik Spinuzzi HS/Fr. QB 5’11” 180 Pueblo, Colo. (South) Jordan St.Louis HS/Fr. DB 5’11” 175 Lantuna, Fla. (Santaluces)12 Mark Sterling 2L/RJr. CB 6’0” 185 Colorado Springs, Colo. (Sierra) Tyrell Strickland HS/Fr. CB 6’0” 180 Fort Worth, Tex. (Richland)68 Drew Swartz 2L/Jr. OT 6’4” 280 Gilbert, Ariz. (Gilbert)37 Blake Sylvester RS/RFr. LB 5’10” 200 San Antonio, Tex. (Smithson Valley)25 TivaTatofi HS/Fr. LB 6’0” 205 Kaneohe,Hawaii(Kamehameha)30 Buster Thede TR/Jr. LB 6’0” 210 Arvada, Colo. (Western New Mexico) Jarred Thompson HS/Fr. DB 5’10” 165 Brighton, Colo. (Prarie View)44 Trent Thompson RS/RFr. TE 6’4” 205 Pueblo, Colo. (Central)93 Emmanuel Tottress VR/Jr. DE 6’3” 230 Aurora, Colo. (Gateway) Keanu Trujillo Fr./HS OL 6’2” 260 Raton, N.M. (Raton) Desmond Turner Fr./HS DB 5’10” 185 Denver, Colo. (Gateway)61 R.J. Trione 1L/RJr. OG 5’11” 240 Wheat Ridge, Colo. (Wheat Ridge) John Vela HS/Fr. RB 5’7” 160 Pueblo, Colo. (Centennial)69 James Vicars 1L/RSr. OT 6’9” 340 Torrance, Calif. (Torrance)95 Ethan Ward RS/RFr. DE 6’3” 230 Pueblo West, Colo. (West)99 Austin Warren HS/Fr. DE 6’2” 225 Lubbock, Tex. (Monterey)70 Chris Warren 1L/RJr. OG 6’2” 265 Walnut, Calif. (Walnut) Riley White HS/Fr. S 6’1” 205 Castle Rock, Colo. (Douglas County)21 Marcial Williamson 1L/Sr. WR 6’1” 190 Lakewood, Wash. (Air Force Prep)80 Koby Wittek 3L/Sr. TE 6’3” 236 Golden, Colo. (Golden) Ian Young HS/Fr. DB 6’2” 188 Colorado Springs, Colo. (Doherty) Tomas Zepeda HS/Fr. LB 6’1” 225 Denver, Colo. (George Washington)
14
2011 SIGNING CLASSCSU-Pueblo’s 2011 recruiting class helped to further cement
the reputation that the ThunderWolves have in the region, as competing with Division I schools for available talent as op-posed to its rival RMaC schools.
“of the players that we were going really hard after that we lost out on, they all ended up going Division I,” CSU-Pueblo head coach John Wristen said of the Pack’s 2011 signing class. “That’s something I can live with. The guys we have coming in are top notch and we believe it’s the top class in the RMaC.”
Filling an immediate hole from this class is a four-year Divi-sion I transfer, former University of Wyoming and northern arizona defensive end, Corey Orth (Jr., Buena Vista, Colo.). orth is expected to start at defensive end in the Pack’s 3-4 alignment and make a significant impact.
As has become commonplace for the program, the signing class includes several ranked as Division I-caliber prospects by national recruiting websites - Rangeview tailback J.B. Mathews (Aurora, Colo.) received a “two-star” rating by Scout.com and is already slotted to be a kick returner. He has already displayed the chops as the potential future starting tailback of this squad.
CSU-Pueblo, returning a strong senior class that was with the program since the team’s re-birth as a collegiate sport in 2008, will be relying on the Class of 2011 signees to help reload the loss of these seniors as well as fill some immedi-ate holes on both offense and defense as the Pack looks for its second RMaC title and national playoff berth in school history in 2011.
“Coming off a 9-2 season creates new opportunities for recruiting,” Wristen said. “We have built a solid foundation for the football program based on integrity, respect, tradi-tion, hard work and commitment. now we have the luxury of recruiting some exceptional talent into our system, teaching them what it takes to be a Pack football player and coaching them to play Pack football.”
“each one of these guys come from an outstanding pedigree and their success will undoubtedly continue at CSU-Pueblo. This is very rewarding for the seniors who bought into the program four years ago, who have kept the drive and determi-nation to build one of the finest Division II teams in the coun-try, and who will ultimately continue our quest for excellence.”
CSU-Pueblo 2011 SigneesDEFENSIVE BACKMatt Biery, 6-2, 185, Kiowa, Colo. (Elizabeth HS) Dominique Grimes, 5-8, 165, Nashville, Tenn. (East Literature HS) Ronell McNeal, 5-9, 165, Aurora, Colo. (Prairie View HS) Jorden St. Louis, 5-11, 175, Lantuna, Fla. (Santaluces HS) Tyrell Strickland, 6-1, 180, Fort Worth, Tex. (Richland HS) Jarred Thompson, 5-10, 165, Brighton, Colo. (Prairie View HS)
DEFENSIVE LINEDarius Allen, 6-0, 200, Pueblo, Colo. (Pueblo East HS) Tony Campton, 6-0, 270, Littleton, Colo. (Columbine HS) Corey Orth (Jr.), 6-5, 255, Buena Vista, Colo. (Buena Vista HS/Wyoming/Eastern Arizona) Austin Warren, 6-2, 225, Lubbock, Tex. (Monterey HS)
RUNNING BACKChrisAshe,6-1,190,ColoradoSprings,Colo.(WidefieldHS)Wes Bennett, 6-2, 185, Longmont, Colo. (Longmont Christian HS) Alex Fenlon, 6-0, 200, Woodland Park, Colo. (Woodland Park HS)Justin Jackson (Jr.), 5-8, 225, Pueblo West, Colo. (Pueblo West HS/Garden City (KS) C.C.) J.B. Mathews, 5-11, 178, Aurora, Colo. (Rangeview HS) John Vela, 5-7, 160, Pueblo, Colo. (Centennial HS)
KICKERGreg O’Donnell, 6-0, 158, Monument, Colo. (St. Mary’s HS)
LINEBACKERKevin Cuff, 6-0, 215, Torrey Pines, Calif. (Torrey Pines HS) Ben Estica, 6-1, 196, Palm Beach, Fla. (Santaluces HS) Tuff Gibson, 6-0, 195, Merino, Colo. (Merino HS) Justin LaBorde, 6-0, 215, Pueblo West, Colo. (Pueblo West HS) D.J. Morman (Jr.), 6-0, 225, Colorado Springs, Colo. (Harrison HS/Valley City State (ND))Joe Rosenbrock, 5-10, 185, Brush, Colo. (Brush HS) TivaTatofi,6-0,205,Kaneohe,Hawaii(KamehamehaHS)Buster Thede (Jr.), 6-0, 210, Arvada, Colo. (Pomona HS/Western New Mexico) Tomas Zepeda, 6-1, 225, Denver, Colo. (George Washington HS)
OFFENSIVE LINEPatrick Barnes, 6-3, 285, San Diego, Calif. (Torrey Pines HS) Mario Kinoshita, 6-0, 230, San Antonio, Tex. (Brandeis HS) Zack Martinez, 6-4, 254, Redlands, Calif. (Redlands East Valley HS) Pat Smith, 6-3, 275, Pueblo, Colo. (Pueblo East HS)
QUARTERBACKBrode McDonald, 6-0, 200, Fort Collins, Colo. (Rocky Mountain HS) Jarred Radebaugh, 6-0, 185, Thornton, Colo. (Northglenn HS) Bryson Souza, 5-11, 180, Maui, Hawaii (Kamehameha Maui HS) Nik Spinuzzi, 5-11, 180, Pueblo, Colo. (Pueblo South HS)
TIGHT ENDTreyben Letlow, 6-4, 225, Hayden, Colo. (Hayden HS)
WIDE RECEIVERAustin Huff, 6-1, 170, Aurora, Colo. (Cherokee Trail HS)
15
2011 SEASON PREVIEWOFFENSE
CSU-Pueblo proved that its 2009 offensive explosion was no fluke, up-ping the ante in 2010 by scoring the 13th-most points per game in the nation (37.6) and once again finish-ing in the top 20 in rushing yardage. With nearly all pieces from the 2010 squad returning in 2011, hopes are high to blow the lid off of the RMaC.
QUARTERBACKFor the first time since current
head coach John Wristen returned to quarterback the 1983 team after starting in 1982, CSU-Pueblo will have a returning starting quarter-back as Ross Dausin (6’5”, 200, Jr.-1L) returns to the fray in 2011. Starting 11 games in 2010, Dausin was steady, but not great, reporting just one 300-yard passing game and throwing for 1,674 yards.
Dausin, however, has appeared to mature immensely over the offsea-son, far and away claiming the job after a short-live rush by understud-ies Jon Kuzava (6’0”, 190, Jr.-TR) and Troy Graham (6’5”, 220, Jr.-2L).
The biggest addition to Dausin’s game has been a better ability to run the ball, a factor that wasn’t there for him in 2010. Labelled strictly as a dropback passer, he has shown in drills improved foot speed and most importantly improved decision-making skills.
In short, 2011 has the potential to be a breakout year for the junior from San antonio, Tex.
RUNNING BACKFor the third straight season, the
fearsome tailback combination of Jesse Lewis (5’7”, 180, Sr.-3L) and Jamaal Johnson (5’9”, 180, Sr.-3L) anchor what has become arguably the most experienced backfield in the nation.
The duo combined for over 2,000 yards rushing last season and nearly hit the 2,000 mark during 2009. Lewis broke every single season rushing record there was, rush-ing for 1,391 yards and 14 rushing scores, including a national-best 7.9
yards per rush average.a slew of available backs will come
in to spell Johnson and Lewis, and will likely hint at who will succeed them in 2012. The likeliest players
to see time will be South Dakota transfer Donovan Bowens (6’0”, 197, So.-TR) and true freshman J.B. Mathews (6’0”, 188, Fr.-HS).
JESSE LEWIS
JAMAAL JOHNSON
16
2010 SEASON PREVIEWWIDE RECEIVER
The biggest surprise of the 2010 season was the emergence of true-freshman Josh Sandoval (5’11”, 155, So., 1L) as a slot option, coming away with 27 catches, second-most on the team. Between Sandoval and fellow Pueblo-native, Da’Quan Cartwright (6’1”, 205, Sr..-3L), the ThunderWolves return experience at the wideout posi-tion.
But the Pack is waiting for a receiver to help its passing game explode, and the most likely candidate to lead the receivers is redshirt-freshman Paul Browning (6’3”, 212, RFr.-RS). Browning earned the “Corey Tolle award” for best wide receiver during spring drills and is progressing nicely in the offense.
TIGHT ENDThe tight end position has slowly
turned in to one of the strongest on the team, and a big reason for that is the play of second-team all-RMaC se-lection Koby Wittek (6’3”, 224, Sr.-2L).
Wittek enters his senior season after a stellar junior season, which saw him catch 24 passes and score touchdowns three times. He also emerged as the Pack’s top receiving target inside the red zone, catching two crucial scores in key RMaC battles with Colorado Mines and Chadron State.
He anchors two and three tight end packages that feature Tyler Hamlin (6’2”, 215, Jr.-1L) and Roger Pfannen-schmid (6’3”, 225, Jr.-2L). Pfannen-schmid took down 10 passes in 2010 and both he and Hamlin have shown the ability to block for the Pack backs with high efficiency.
Redshirt freshman Trent Thomp-son (6’4”, 205, RFr.-RS) has also shown that he could break into the tight end rotation, as well.
OFFENSIVE LINE
In 2011, the Pack offensive line will begin its third season together, as most on the line will be juniors. as a unit, it has established itself as arguably the top returning line in the
RMaC.Three have secured all-conference or
all-Colorado selections – Ryan Jensen (6’4”, 265, Jr.-2L), tackle Drew Swartz (6’4”, 280, Jr.-2L), and J.T. Haddan (6’2”, 265, Jr.-2L) – to go along with all-conference-caliber center Jonathan Jones (5’8”, 225, Jr.-2L), one of the quickest centers in the nation. Round-ing out the line will be Taylor Kelly (6’5”, 245, So.-1L) at tackle.
Jensen, an all-RMaC tackle in 2010, will be bookended by Kelly at the other tackle position. Kelly moves to tackle after last season’s start-ing tackle, Swartz, also an all-RMaC tackle in 2010, moves over to guard in 2011. Haddan will remain at guard after subbing at center for a portion of 2010.
The Pack will, however, have to go without Swartz, who injured his aCL in fall camp. Replacing him is R.J. Trione (5’11”, 240, Jr.-2L), who was a starter in 2009 and 2010 before a season-ending injury took him out of the lineup.
KOBY WITTEK
RYAN JENSEN
17
2011 SEASON PREVIEWDEFENSE
With a team of mostly sophomores and juniors on the defensive side of the football, the Pack defense flourished in 2011, allowing just 15.6 points per game, ninth-lowest in the country. The loss of a couple seniors in the defensive backfield raises some alarm, but the rest of the team returns largely intact and ready for another go in 2011.DEFENSIVE LINE
The success of the defensive line in 2011 will be greatly impacted by the play of four-year-starter, Grant Jansen (6’0”, 225, Sr.-3L). Jansen, an all-RMaC selection and one-time RMaC Freshman of the Year, is on pace to graduate as CSU-Pueblo’s all-time sacks leader. He enters the season with 29 consecutive starts dating back to 2008, by far the most on the team.
In the middle, Jervoise Hollins (6’1”, 228, So.-1L) returns after starting as a true freshman and becoming a rock and nose guard. Starting in all 11 games, he turned in 2½ sacks and 38 tackles.
Corey Orth (6’5”, 255, Jr.-TR), a transfer from the University of northern arizona, will come to fill the void left by 2010 RMaC Fresh-man of the Year, Beau Martin, who left the team to walk on at Boise State. orth quickly established him-self as a force at spring drills and could be in for a big season.LINEBACKERS
Very few teams in the nation, let alone the RMaC, have such an experienced and talented inside linebacker as Lee Meisner (6’0”,
240, Sr.-3L). an all-region selection and one of the nation’s leaders in tackles, ranking sixth in the country, he has been named a preseason all-American by The Sporting News and was named the RMaC’s Preseason Defensive Player of the Year.
a close second to Meisner as far as hitting ability and smarts in the open field is Damon Schiele (6’0”, 220, Jr.-2L). If it weren’t for an injury that halted his season, he would have been a shoo-in for all-conference honors, logging 60 tackles and picking off three passes, one for a score, in just eight games.
Beldy Nseka (6’0”, 205, Jr.-2L) and Jason Campbell (6’1”, 225, Jr.-2L), will take up the two outside backer spots, and are consistent with the team speed and aggressive pop on the tackle that is preached by defensive coordinator, Hunter Hughes. Campbell was second on the team in tackles for loss last season with 11, while nseka was second on the team in tackles with 70 despite missing one game.
The linebacking unit helps make the Pack front seven one of the most physical and tenacious in the RMaC and will certainly be a key to the team’s success in 2011.DEFENSIVE BACKS
The biggest question mark defen-sively is definitely at defensive back, where both starting cornerbacks were lost to graduation. Though replacing two all-conference cor-ners like Chris Brown and Grant Crunkleton will be a tall order, the personnel is in place for a seamless transition.
Taking one cornerback spot is Stephan Dickens (5’8”, 160, So.-1L). Dickens saw time at corner as a true freshman midway through the season, and by the end of the year, he had ejected Brown from the starting lineup, getting the nod in three games. He turned in two picks and 23 tackles in less than a half-season played, and will likely hold on to that starting spot in 2011.
The other corner position will likely fall to junior Mark Sterling (6’0”, 190, Jr.-2L) or redshirt fresh-man C.J. Roberts (6’0”, 180, RFr.-RS).
At the safety positions, there is no turnover as three-year starter Jon Bailey (5’11”, 170, Sr.-3L) and Josh Costa (5’8”, 190, Sr.-3L) return.
Bailey has a nose for the loose ball and while Costa, a preaseason all-RMaC pick, is a prototypical strong safety, packing a wallop to opposing receivers wishing to go over the middle.SPECIAL TEAMS
The Pack special teams is solid behind all-conference placekicker Kyle Major (6’3”, 230, Sr.-3L), who smashed all CSU-Pueblo scoring re-cords in 2010, and punter Brandon Kliesen (6’0”, 220, So.-1L), who ranked 8th in the nation in punting in 2010. Both have the ability to put up All-American seasons in the thin air environment in the RMaC. Snapping the ball will be long snap-per Joe Campton (6’2”, 245, Sr.-3L), the best dedicated long snapper in the RMaC.
QUARTERBACK 15 Ross Dausin 6’5” 230 Jr.-1L16 Troy Graham 6’5” 220 Jr.-2LTAILBACK 28 Jesse Lewis 5’7” 180 Sr.-3L14 Jamaal Johnson 5’9” 180 Sr.-3LFULLBACK 44 Marquis McNeal 5’8” 230 RFr.-RS32 Giovanni Rider 6’1” 220 Jr.-1LZ RECEIVER 13 Jared Sperber 6’3” 195 Sr.-1L11 Josh Sandoval 6’1” 180 So.-1LX RECEIVER 81 Paul Browning 6’3” 217 RFr.-RS85 Da’Quan Cartwright 6’1” 210 Sr.-3LTIGHT END 80 Koby Wittek 6’3” 236 Sr.-3L82 Roger Pfannenschmid 6’3” 225 Jr.-2L
TIGHT TACKLE 66 Ryan Jensen 6’4” 290 Jr.-2L69 James Vicars 6’9” 310 Sr.-1LTIGHT GUARD 60 J.T. Haddan 6’2” 290 Jr.-2L59 Ben Jackson 6’1” 285 So.-1LCENTER 52 Jonathan Jones 5’8” 225 So.-1L71 Scotland Coyle 6’2” 255 RFr.-RSSPLIT GUARD 61 R.J. Trione 5’11” 240 So.-1L70 Chris Warren 6’2” 272 Jr.-2LSPLIT TACKLE 54 Taylor Kelly 6’5” 260 So.-1L74 Austin Payne 6’6” 270 RFr.-RSPLACEKICKER 10 Kyle Major 6’3” 230 Sr.-3L9 Brandon Kliesen 5’10” 210 So.-1L
LEFT DEFENSIVE END 2 Grant Jansen 6’2” 225 Sr.-3L3 Darius Allen 6’0” 200 Fr.-HSNOSE GUARD 7 Jervoise Hollins 6’1” 228 So.-1L50 Dexter Scott 6’2” 242 Jr.-1LRIGHT DEFENSIVE END 55 Corey Orth 6’5” 255 Jr.-TR91 Josh Mack 6’3” 267 Sr.-1LLOU BACKER 39 Beldy Nseka 6’0” 205 Jr.-2L38 Louie Lozano 5’11” 200 So.-1LWILL BACKER 22 Damon Schiele 6’0” 220 Jr.-2L41 Adrian Marquez 5’9” 210 Sr.-3LSAM BACKER 36 Lee Meisner 6’0” 225 Jr.-2L30 Buster Thede 6’0” 210 Jr.-TR
ROB BACKER 34 Jason Campbell 6’1” 225 Jr.-2L31 Kyle McCall 6’1” 205 Sr.-3LLEFT CORNERBACK 4 Stephan Dickens 5’8” 160 So.-1L23 Franex Dort 5’11” 176 Jr.-JCRIGHT CORNERBACK 12 Mark Sterling 5’10” 170 Jr.-2L20 C.J. Roberts 6’0” 180 RFr.-RSFREE SAFETY 18 Jon Bailey 5’11” 170 Sr.-3L35 Jarrod Lacy 5’10” 190 RFr.-RSSTRONG SAFEY 26 Josh Costa 5’8” 190 Jr.-2L6 Nick Henderson 5’10” 165 So.-1LPUNTER 9 Brandon Kliesen 5’10” 210 So.-1L10 Kyle Major 6’3” 230 Sr.-3L
PROJECTED TWO-DEEP: OFFENSE PROJECTED TWO-DEEP: DEFENSE
18
JON
BAILEY #18FREE SAFETY • 5’11” • 190 • SR-3l • FORT MORGAN, cOlO. (FORT MORGAN)
GENERAL: A three-year starter, boasts some of the most experience of any defen-sive back in the RMAC.2010: Started at safety in all 11 games, earning second team all-RMAC honors ... Recorded 14 tackles and an interception for 17 yards vs. Chadron State on Oct. 2 ... Recorded his second interception of the season at Colorado Mines on Oct. 9 that was returned for 26 yards ... Finished 2010 with 52 tackles, two interceptions and a pass breakup.2009: A valuable player for the Thunder-wolves defense in 2009, Bailey saw action in all 11 games while starting in eight of them ... Recorded two interceptions in 2009 - vs. Mesa State on Oct. 10 and Oct. 17 vs New Mexico Highlands ... Finished 2009 with 32 tacklesandfivepassbreakups.2008: Was the ThunderWolves’ top reserve in the secondary, earning two starts at safety and seeing action in all 10 games ... Scored thePack’sfirstdefensivetouchdownwhenhe returned a fumble 25 yards for a score in the ThunderWolves’ 37-7 win at Fort
LewisSept.13...Inhisfirstcareerstartat Colorado Mines on Oct. 4, recorded a career-highfivetackles,forcingandrecover-ing a fumble ... Led the Pack with most fumble recoveries with 2. High School: Was an all-state selection for Fort Morgan High School in Fort Morgan, Colo. ... Active player on the Mustang’s state qualifying team ... Selected for all-confer-ence team ... Honored as Tri Valley Player of the Year ... Nominated as team MVP ... Also a member of the basketball and track teams ...Atwo-timetrackstatequalifier...Trackschool record holder ... Participant in the Qwest Leadership Challenge ... Graduated in the top 20 percent of his class carrying a 3.7 GPA. Personal: Son of Kim and Rick Bailey ... Has one younger brother, Mike ... Plans to major in chemistry.
2010All-Rocky Mountain Athletic Conference (Second-team)
BAILEY 2010 GAME-BY-GAME
Opponent UT-AT-TOT TFL/Yd Sack/Yd INT/Yds PBU QBH FF [email protected] St. 1-2-3 0/0 0/0 0/0 0 0 0 0NW Okla.St. 4-2-6 0/0 0/0 0/0 0 0 0 0Adams St. 2-2-4 0/0 0/0 0/0 0 0 0 0@Fort Lewis 0-3-3 0/0 0/0 0/0 1 0 0 0Chadron St. 6-8-14 0.5/1 0/0 1/17 0 0 0 [email protected] 4-3-7 0/0 0/0 1/26 0 0 0 0Neb-Kearney 4-4-8 0/0 0/0 0/0 0 0 0 0@Mesa St. 0-1-1 0/0 0/0 0/0 0 0 0 0NM Highlands 0-0-0 0/0 0/0 0/0 0 0 0 0@Western St. 0-1-1 0/0 0/0 0/0 0 0 0 0@Western NM 2-3-5 0/0 0/0 0/0 0 0 0 0TOTALS 23-29-52 0.5/1 0.0/0 2/43 1 0 0 0
CAREER STATISTICS
Year G UT-AT-TOT TFL/Yd Sack/Yd INT/Yds PBU QBH FF FR2008 10 16-8-24 0.0/0 0.0/0 0/0 2 0 1 22009 11 18-14-32 1.0/2 0.0/0 2/1 5 0 0 02010 11 23-29-52 0.5/1 0.0/0 2/43 1 0 0 0TOTALS 32 57-51-108 1.5/3 0.0/0 4/44 8 0 1 2
19
GRANT
JANSEN #2DEFENSIVE END • 6’0” • 225 • SR-3l • cOlORADO SPRINGS, cOlO. (PINE cREEK)
GENERAL: Currently CSU-Pueblo’s all-time sack leader, his success in 2011 will be mea-sured by his ability to rebound from an offseason surgery.
2010: Wasafirst-teamRMACall-academicteam selection ... Also was named a second-team ESPN All-Academic District VII selection ... Jansen was named as RMAC defensive player of the week for his efforts vs. New Mexico Highlands on Oct. 30 ... In that game he recorded 11totaltackles,fiveofwhichweretacklesforaloss and 2.5 sacks ... Was the most productive defensive lineman for the Thunderwolves in 2010 leading the team in tackles-for-loss (14.5) and second in sacks (7.0) ... Recorded 11 tackles and a forced fumble vs. Chadron State on Oct. 2 ... Finished 2010 starting all 11 games while recording 52 tackles.
2009: Was a starter at nose guard as well as at defensive end during 2009 ... Led the interior de-fensive line with 27 tackles during his sophomore year in 2009 ... Fifth on the team with tackles for a loss (5.0) ... Recorded a season-high seven tacklesvs.WesternStateOct.24...Hadfive
tackles, one for a loss and one sack vs. Adams State Nov.7 ... Started all 11 games for the Pack in 2009 ... Was a second-team Academic All-RMAC selection.
2008: Named Rocky Mountain Athletic Confer-ence Freshman of the Year after a six-sack campaign in 2008 ... Opened up his career in a big way, coming off the bench to record 2.5 sacks and one forced fumble vs. Oklahoma Panhandle State Sept. 6 ... Returned an interception 34 yards during a four-tackle effort vs. New Mexico Highlands on Oct. 18 ... Recorded a season-high six tackles vs. Western New Mexico Nov. 1.
HIGH SCHOOL: Coached by Todd Miller at Pine Creek HS ... Also competed in basketball and rugby for the Eagles ... Named Academic All-State, All-State and All-Conference.
PERSONAL: Son of Shawn and Camie Jansen ... Has one sister, Shanna ... Father, Shawn, graduated from the United States Air Force Acad-emy in 1989 ... Currently majoring in Business
2011Preseason All-Rocky Mountain Athletic Conference
2010National Football Foundation All-Colorado (Second-team)Academic All-Rocky Mountain Athletic Conference (First-team)CoSIDA/ESPN The Magazine Academic All-District (second team)
2009Academic All-Rocky Mountain Athletic Conference (Second-team)
2008Rocky Mountain Athletic Conference Freshman of the Year
JANSEN 2010 GAME-BY-GAME
Opponent UT-AT-TOT TFL/Yd Sack/Yd INT/Yds PBU QBH FF [email protected] St. 2-1-3 0/0 0/0 0/0 0 0 0 0NW Okla.St. 1-1-2 0.5/1 0.5/1 0/0 0 0 0 0Adams St. 1-4-5 2.0/8 1.0/5 0/0 0 0 0 0@Fort Lewis 2-0-2 1.0/7 0/0 0/0 0 0 0 0Chadron St. 2-9-11 2.0/4 0/0 0/0 0 0 1 [email protected] 1-1-2 1.0/6 1.0/6 0/0 0 0 0 0 Neb-Kearney 2-4-6 0.5/1 0.5/1 0/0 0 0 0 0@Mesa St. 1-2-3 0/0 0/0 0/0 1 0 0 0NM Highlands 5-6-11 5.0/14 2.5/9 0/0 0 0 0 0@Western St. 0-1-1 0.5/1 0.5/1 0/0 0 0 0 0@Western NM 2-4-6 2.5/8 1.5/6 0/0 1 0 0 0TOTALS 19-33-52 14.5/49 7/28 0/0 2 0 1 0
CAREER STATISTICS
Year G UT-AT-TOT TFL/Yd Sack/Yd INT/Yds PBU QBH FF FR2008 10 17-18-35 11/35 6.0/25 1/34 2 1 1 02009 11 10-17-27 5.0/18 2.5/5 0/0 1 3 1 02010 11 19-33-52 14.5/49 7/28 0/0 2 0 1 0TOTALS 32 46-68-114 30.5/102 15.5/58 1/34 5 4 3 0
20
JAMAAL#14
TAIlbAcK • 5’9” • 185 • SR-3l • FOUNTAIN, cOlO. (FOUNTAIN-FT. cARSON)
GENERAL: When combined will All-American back, Jesse Lewis, Johnson helps to comprise one of the top tailback combos in the nation.2010: Returned in 2010 to combine with Jesse Lewis for the nation’s 16th-best rushing attack ... Saw action in 10 games, starting in two of them rushing for 613 yards on 108 carries and nine touchdowns ... Also was a productive receiving optionoutofthebackfieldcatchingninepasses for 80 yards and a touchdown ... Had a season-high 135 yards and two touchdowns vs. Fort Lewis on Sep. 25 ... Rushed for 103 yards and two touchdowns vs. New Mexico Highlands on Oct. 30 ... Recorded 693 all-purpose yards in 2010. 2009: Earned all-RMAC third-team honors and second-team All-Colorado (NFFCC) honors with 906 yards rushing ... Com-bined with tailback Jesse Lewis to lead a rebirth of the Pack rushing attack, which was ranked in the bottom 10 nationally in 2008 but in the top 15 nationally in 2009 ... Scored seven touchdowns in 2009 ...
Rushed for over 100 yards four times ... Had a season-high 164 rushing yards vs. Western New Mexico on Oct. 31 ... Aver-aged 81.7 all purpose yards for the Pack ... Played in all 11 games for the Thun-derwolves while starting in two of those contests ... Was effective as a “Wildcat” tailback, going 3-for-4 on passes for 109 yards and a quarterback rating of 303.9.2008: Played in nine games, seeing the start in four at cornerback for the ThunderWolves ... Recorded two tackles in the Pack’s win over Oklahoma Panhandle State Sept. 6, logging a pass breakup.College: Redshirted one season at Colorado State University-Fort Collins in Fort Collins, Colo.High School: Was a 2007 all-state selection from Fountain-Fort Carson High School in Fountain, Colo. ... Was an all-conference selection two times ... Was an all-area selection ... Also competed in basketball ... Was an all-conference selection for basketball ... Was an honor roll student all four years, graduating with a 3.0 GPA.Personal: Son of Pearl and Tyrone Johnson ... Has two sisters: Ayesha and Veronica ... Father, Tyrone, played junior college football ... Plans to double major in business management and criminology.
CAREER STATISTICS
Year RUSH YDS AVG TD LG REC YARDS AVG TD LG ALLPURP2008 Played season as cornerback 2009 129 906 7.0 7 70 4 -7 -1.8 0 2 8992010 108 613 5.7 9 50 9 80 8.9 1 39 693TOTALS 237 1519 6.35 16 70 13 73 7.1 1 39 1592
2010National Football Foundation All-Colorado (second-team)
2009All-Rocky Mountain Athletic Conference (third-team)National Football Foundation All-Colorado (second-team)
JOHNSON 2010 GAME-BY-GAME
Opponent RUSH YDS LG TD REC YDS LG TD ALLPURP@ Okla.Panhandle St. Did not play NW Okla St 17 73 1 27 3 53 1 39 126Adams St. 11 36 0 11 0 0 0 0 36@Fort Lewis 12 135 2 50 1 4 0 4 139Chadron St. 10 57 0 34 0 0 0 0 [email protected] 5 33 0 31 0 0 0 0 33Neb-Kearney 7 22 0 14 1 4 0 4 26@Mesa St. 16 61 2 9 2 9 0 10 70NM Highlands 9 103 2 45 0 0 0 0 103@Western St. 11 55 1 15 0 0 0 0 55@Western NM 10 38 1 7 2 10 0 6 48TOTALS 108 613 9 50 9 80 1 39 693
JOHNSON
21
JESSE
LEWIS #28RUNNING bAcK • 5’7” • 180 • JR-3l • lOVElAND, cOlO. (lOVElAND)
GENERAL: The nation’s leader in yardage per rush in 2010 is looking to establish himself as the nation’s top back in 2011.
2010: Had a standout junior season for the Thunderwolves in 2010 rushing for 1391 yards and 14 touchdowns while starting in 10 games, earning All-American honors ... Lewis averaged 7.9 yards per rush (1st in the nation) and 139.1 yard per game (3rd in the nation) ... Had a season-high 239 yards on 18 carries for one touchdown vs. Western State on Nov. 6 ... Scored three touchdowns while rushing for 141 yards on 16 carries vs. New Mexico Highlands on Oct. 30 ... Had a season-long 83-yard run vs. Fort Lewis on Sep. 25 ... Combined with Jamaal Johnson to lead the nations 16th-best rushing attack ... Eclipsed 100-yards rushing in eight games for the Pack in 2010 ... Finished the season gaining 1453 all-purpose yards in 2010.
2009: Led the Thunderwolves in rushing in 2009 with 1,064 rushing yards on 165 carries with nine touchdowns ... Rushed forover100yardsfivetimesin2009allof them coming in the second half of the season ... Had a season-high 233 yards and three touchdowns vs. Western New Mexico on Oct. 31 ... Led the Thunder-wolves with 1,382 all purpose yards in 2009 ... Caught 16 passes for 318 yards and three touchdowns, including a 96 yard touchdown pass vs. NW Oklahoma State on Sep. 5 ... Led the Pack in scoring with 12 touchdowns in 2009 ... Played in all 11 games while starting in 10 of them for the Pack in 2009.
2008: Played all 10 games at tailback, earning one start for the ThunderWolves in 2008 ... Ran for 178 yards on 56 car-ries, second on the team ... Burst onto the scene in a big way vs. Fort Lewis
2011Consensus Draft Services Preseason All-AmericanD-II vs NAIA Bowl Preseason All-AmericanPreseason All-Rocky Mountain Athletic Conference
2010Associated Press Little All-America (third-team)Don Hansen’s Football Gazette All-America (third-team)National Strength & Conditioning Association All-AmericanDon Hansen’s Football Gazette All-Region (first-team)Daktronics All-Super Region 3 (second team)All-Rocky Mountain Athletic Conference (first-team)National Football Foundation All-Colorado (first-team)
2009All-Rocky Mountain Athletic Conference (first-team)National Football Foundation All-Colorado (first-team)
LEWIS 2010 GAME-BY-GAME
Opponent RUSH YDS LG TD REC YDS LG TD ALLPURP@ Okla.Panhandle St. 24 151 2 41 0 0 0 0 151NW Okla St Did not play Adams St. 15 70 1 20 2 29 0 18 99@Fort Lewis 13 178 2 83 0 6 0 0 184Chadron St. 18 119 1 18 2 15 0 11 [email protected] 10 38 0 12 3 9 0 0 47Neb-Kearney 19 151 1 71 1 3 0 3 154@Mesa St. 23 119 0 27 0 0 0 10 119NM Highlands 16 141 3 44 0 0 0 0 141@Western St. 18 239 1 70 0 0 0 0 239@Western NM 20 185 3 69 0 0 0 0 185TOTALS 176 1391 14 83 8 62 0 18 1453
CAREER STATISTICS
Year RUSH YDS AVG TD LG REC YDS AVG TD LG ALLPURP2008 56 178 3.2 1 41 8 57 7.1 0 16 4832009 165 1064 6.4 9 80 16 318 19.9 3 96 13822010 176 1391 7.9 14 83 8 62 7.8 0 18 1453TOTALS 397 2633 6.6 24 83 32 437 13.7 3 96 3318
Sept. 13, gaining 63 yards, 41 of which coming on a game-breaking touchdown rumble ... Was the Pack’s top kick returner, gaining 248 yards on 12 returns ... Accounted for 483 all-purpose yards, third most on the team ... Accumulated 136 all-purpose yards vs. Mesa State Oct. 11.
High School: Was all-state and all-area selection for Loveland High School in Love-land, Colo. as a senior ... Was an all-state, all-Colorado and all-area select for junior season...Alsocompetedintrackandfield...Ownsthe100meterdashrecordforthe Indians with a 10.59 time.
Personal: Foster son of Beth and Mark Waldman ... Has three siblings: Darlene, AJ and Wayne ... Enjoys lifting and playing with his dog ... Plans to major in business management with a minor in excercise science.
22
KYLE
MAJOR #10PlAcEKIcKER • 6’3” • 230 • SR-3l • lITTlETON, cOlO. (HERITAGE)
GENERAL: Having established himself asthefinestkickerinCSU-Pueblohistory, Major has the range to hit from beyond 50 yards.2010: Resumed full-time kicking duties for the Thunderwolves in 2010, hitting 16-23 fieldgoals,settingtheall-timeCSU-Puebloscoringrecord...Went2-for-2onfieldgoals vs. NW Oklahoma State, including a season-long 47-yarder ... Was also effective handling kick off duties tallying 26 touchbacks on the year.2009: Major was a valuable asset to the Thunderwolvesin2009,hitting8-16field-goals,comingwithinonefield-goaloftheall-time CSU-Pueblo single season record for a second straight year ... Had a season long52yardfield-goalvs.AdamsStateonNov. 7 and three touchbacks ... kicked six touchbacks as a kicker ... Also punted for the Pack, kicking 30 punts this season for an average of 37.8 yards per punt while keepingfivepuntsinsidetheopponents20yard line.
2008: Was a two-time Rocky Mountain Athletic Conference Special Teams Player of the Week, named to the honors following athreefield-goal,four-PATperformancevs.FortLewisSept.13,andatwofield-goal,two-PAT performance vs. Western State Oct.25...Nailedthegame-winningfieldgoal in overtime in the Pack’s 20-17 win over Western State Oct. 25, securing the program’sfirsteverovertimewin...Hita49-yardfieldgoalincoldconditionsvs.MesaStateOct.11...Hiseightfieldgoalsin2008were just one away from the all-time CSU-Pueblo single season record ... Saw time as a punter, booting 52 punts for an average of 34.0 yards per kick.High School: Was all-state selection for Heritage High School in Littleton, Colo. ... Selected for all-conference team for Eagles ... Also competed in basketball, soccer and track ... Was DECA President.Personal: Son of Kathy Sullivan and Jim Major ... Has one younger brother, Colin Major.
2011D-II vs. NAIA Bowl Preseason All-AmericanPreseason All-Rocky Mountain Athletic Conference
2010All-Rocky Mountain Athletic Conference (second-team)National Football Foundation All-Colorado (first-team)
MAJOR 2010 GAME-BY-GAME
Opponent FGM-FGA Lg XP-XPA Blk 2Pt Pts@ Okla.Panhandle St. 1-2 33 3-3 0 0 6NW Okla St 2-2 47 7-7 0 0 13Adams St. 2-2 32 3-3 0 0 9@Fort Lewis 0-3 0 7-7 0 0 7Chadron St. 4-5 39 3-3 0 0 [email protected] 1-2 32 1-1 0 0 4Neb-Kearney 1-2 30 3-3 0 0 6@Mesa St. 2-2 43 2-3 0 0 8NM Highlands 1-1 42 9-9 0 0 12@Western St. 1-1 31 4-4 0 0 7@Western NM 1-1 21 6-6 0 0 9TOTALS 16-23 47 48-49 0 0 96
CAREER STATISTICS
Year FGM-FGA Pct 01-19 20-29 30-39 40-49 50+ Lg Blk2008 8-13 61.5 0-0 4-6 2-2 2-4 0-1 49 12009 8-16 50.0 0-0 5-5 0-2 2-6 1-3 52 12010 16-23 70.0 0-0 2-3 10-12 4-6 0-2 47 0TOTALS 32-52 60.5 0-0 11-14 12-16 8-16 1-6 52 2
23
LEE
MEISNER #36INSIDE lINEbAcKER • 6’0” • 240 • SR-3l • STERlING, cOlO. (STERlING)
GENERAL: The quarterback of the defense, his smarts and intense game speed make him one of the most feared linebackers in the country.
2010: Was a force on defense for the Thunder-wolvesbecomingafirst-teamall-RMACselec-tion ... Led the Pack with 124 tackles in 2010 ... In the season opener Mesiner announced himself with 16 tackles and an interception vs. Oklahoma Panhandle on Aug. 28 ... Had a season-high 17 tackles vs. Chadron State on Oct. 2 ... Recorded double-digit tackles in seven games in 2010 ... Started all 11 games for the Pack tallying 124 tackles, 1.5 sacks and 9.5 tackles for a loss.2009: Was a third-team all-RMAC selection ... Led the Pack with 90 tackles in 2009 ... Included eight tackles for a loss, which was third for the team ... Finished the year with two sacks and three interceptions, including one returned for a touchdown vs. Adams State on Nov.7...Recorded10+tacklesinfivegamesfor the 2009 season ... Also included four pass breakups and four quarterback hurries ... Had
a season-high 12 tackles vs. Colorado Mines Sep.26...AlsopuntedforthePackthefirsthalf of the season punting 29 times for 1006 yards ... Played in all 11 games for the Thun-derwolves while starting in all of them.2008: Was a candidate for the conference’s freshman of the year award before falling with an injury, starting seven games at inside line-backer for the Pack ... Recorded seven tackles, including two sacks, in the Pack’s 21-14 loss to Colorado Mines on Sept. 27 ... Recorded seven tackles, forcing two fumbles and recov-ering another in the Pack’s win over Fort Lewis Sept. 13 ... Despite not playing in the team’s finalthreegames,his37tackleswerethe7thmost on the team ... Was the team’s top punter before falling with an injury, booting 24 punts for an average of 37.6 yards per kick.High School: Was all-state and all-conference
MEISNER 2010 GAME-BY-GAME
Opponent UT-AT-TOT TFL/Yd Sack/Yd INT/Yds PBU QBH FF [email protected] St. 8-8-16 1.0/5 0/0 1/11 0 0 0 0NW Okla.St. 2-8-10 2.0/1 0.5/0 0/0 0 0 1 0Adams St. 1-6-7 1.0/5 0/0 0/0 0 0 0 0@Fort Lewis 6-6-12 0/0 0/0 0/0 1 0 0 0Chadron St. 5-12-17 1.5/3 0/0 0/0 1 0 0 [email protected] 7-3-10 2.0/7 1.0/3 0/0 0 0 0 0Neb-Kearney 4-10-14 0/0 0/0 0/0 0 0 0 0@Mesa St. 2-5-7 0.5/1 0/0 0/0 0 0 0 0NM Highlands 4-10-14 0.5/0 0/0 0/0 0 0 1 0@Western St. 5-3-8 0/0 0/0 0/0 0 0 0 0@Western NM 6-3-9 1.0/4 0/0 0/0 0 0 0 0TOTALS 50-74-124 9.5/26 1.5/3 1/11 2 0 2 0
CAREER STATISTICS
Year G UT-AT-TOT TFL/Yd Sack/Yd INT/Yds PBU QBH FF FR2008 7 17-20-37 5/23 3.0/20 0/0 3 0 2 12009 11 45-45-90 8.0/32 2.0/18 3/51 4 4 0 02010 11 50-74-124 9.5/26 1.5/3 1/11 2 0 2 0TOTALS 29 112-139-251 22.5/81 6.5/41 4/62 9 4 4 1
2011Sporting News Preseason All-AmericanConsensus Draft Services Preseason All-AmericanD-II vs. NAIA Bowl Preseason All-AmericanRocky Mountain Athletic Conference Preseason Defensive Player of the Year
2010Daktronics All-Super Region 3 (first team)All-Rocky Mountain Athletic Conference (first-team)National Football Foundation All-Colorado (first-team)Academic All-Rocky Mountain Athletic Conference (first-team)CoSIDA/ESPN The Magazine Academic All-District (first-team)
2009All-Rocky Mountain Athletic Conference (third-team)Academic All-Rocky Mountain Athletic Conference (first-team)
selection for senior year performance for Sterling High School in Sterling, Colo. ... Was all-conference selection for junior season ... Earned all-conference honorable mention as a sophomore ... Also com-peted in basketball and track ... Was on the conference championship track team his sophomore year ... Owns the school record for javelin throw at 147 feet ... Was all-state shotput and discus selection during senior year and all-state shotput during junior year ... Was an active member in FCCLA, FBLA and National Honor Society ... Honor roll student every quarter ... Graduated with a 4.2 GPA.Personal: Son of Roxanne and Richard Meisner ... Has one brother, Jake ... Cousin, Justin Wyckoff, played football for Chadron State College in Chadron, NE.
24
KOBY
WITTEK #80TIGHT END • 6’3” • 236 • SR-3l • GOlDEN, cOlO. (GOlDEN)
GENERAL: One of the RMAC’s top pass-catching tight ends, has shown he has a nose for the end zone in pressure situations.2010: Was a second team All-RMAC selection... Led all Pack tight ends with 24 receptions for 269 yards and three touchdowns...Hadfivecathesfor82yards vs. Western New Mexico on Nov. 13 ... Had four catches for 52 yards and a touchdown vs. Colorado School of Mines on Oct. 09 ... Played in all 11 games while starting in 10 games.2009: Led the Pack tight ends with eight receptions for 76 yards in 2009 ... Caught a 12 yard touchdown pass vs. Western New Mexico Oct. 31 ... Had two catches for 20 yards vs. NW Oklahoma State Sep. 5 ... Played in seven games for the Thunderwolves while starting in four of them. 2008: Was the Pack’s top pass-catching tight end, taking down eight receptions for 89 yards ... Played in all ten of the Pack’s games ... Caught an
11-yard touchdown pass vs. Western New Mexico Nov. 1 ... Caught two balls for 23 yards in the Pack’s season opener vs. Oklahoma Panhandle State Sept. 6. High School:Wasfirst-teamall-statetight end for Golden High School in Golden,Colo....Selectedforfirst-teamall-conference tight end ... Also played basketball. Personal: Son of Judy and Walter Wit-tek ... Has one sibling, Tanner ... Plans to major in business.
WITTEK 2010 GAME-BY-GAME
Opponent REC YDS LG TD RUSH YDS LG TD ALLPURP@ Okla.Panhandle St. 1 13 0 13 0 0 0 0 13NW Okla St 2 9 1 7 0 0 0 0 9Adams St. 0 0 0 0 0 0 0 0 0@Fort Lewis 1 9 0 9 0 0 0 0 9Chadron St. 3 27 1 16 0 0 0 0 [email protected] 4 52 1 25 0 0 0 0 52Neb-Kearney 3 22 0 11 0 0 0 0 22@Mesa St. 1 6 0 6 0 0 0 0 6NM Highlands 1 19 0 19 0 0 0 0 19@Western St. 3 30 0 13 0 0 0 0 30@Western NM 5 82 0 50 0 0 0 0 82TOTALS 24 269 3 50 0 0 0 0 269
CAREER STATISTICS
Year REC YDS AVG TD LG RUSH YDS AVG TD LG ALLPURP2008 8 89 11.1 1 19 0 0 0 0 0 902009 8 76 9.5 1 17 0 0 0 0 0 762010 24 269 11.2 3 50 0 0 0 0 0 269TOTALS 40 434 10.6 5 50 0 0 0.0 0 0 435
2011Preseason All-Rocky Mountain Athletic Conference
2010All-Rocky Mountain Athletic Conference (second-team)
25
JOSH
COSTA #26STRONG SAFETY • 5’8” • 185 • SR-3l • NANAKUlI, HAWAII (KAMEHAMEHA)
General: Showed his All-RMAC caliber play in 2010, looking to establish himself as a top safety in 2011.2010: Costa was named to the third-team RMAC defensive team in 2010 ... Was one of the Thunderwolves most productive play-makers in the secondary on defense in 2010 tying for second on the team in interceptions (4) ... Was also tied for team lead in pass breakups (7) and passes defended (11) ... Had three pass breakups, including an interception, and seven tackles vs. Chadron State on Oct. 2 ... Intercepted two passes in theseasonfinalevs.WesternNewMexicoon Nov. 13 ... Started 10 games for the Pack totaling 49 tackles, a fumble recovery and four interceptions.2009: Started midway through the 2009 season at Safety ... Had a big year posting 32 tackles, including 2.5 for a loss ... Costa had a season-high seven taclkes and one interception vs. Mesa State on Oct. 10 ... Had two forced fumbles while recovering one of those vs. NW Oklahoma State on Sep. 5 ... Also blocked one kick vs Western
State on Oct. 24 ... Played in all 11 games andstartedfivefortheThunderwolves2008: Was MVP defensive back during spring ball at CSU-Pueblo. High School: Was defensive back for Kamehameha High School in Honolulu, HI ... Also ran track ... Graduated with a 3.0 GPA. Personal: Son of Lee-Ann and George Costa ... Has three siblings: Isaac, Tita, and Kodie ... Plans to major in civil engineering ... Enjoys the beach and bodyboarding.
2011Preseason All-Rocky Mountain Athletic Conference
2010All-Rocky Mountain Athletic Conference (Third-team)
COSTA 2010 GAME-BY-GAME
Opponent UT-AT-TOT TFL/Yd Sack/Yd INT/Yds PBU QBH FF [email protected] St. 2-0-2 0/0 0/0 0/0 1 0 0 0NW Okla.St. 1-2-3 0/0 0/0 0/0 0 0 0 1Adams St. 4-3-7 0/0 0/0 0/0 0 0 0 0@Fort Lewis 4-1-5 0/0 0/0 0/0 0 0 0 0Chadron St. 5-2-7 0/0 0/0 1/3 3 0 0 [email protected] 5-2-7 0/0 0/0 0/0 1 0 0 0Neb-Kearney 5-2-7 2.0/4 0/0 0/0 1 0 0 0@Mesa St. 0-5-5 0/0 0/0 0/0 1 0 0 0NM Highlands 0-2-2 0/0 0/0 1/10 0 0 0 0@Western St. 3-1-4 0/0 0/0 0/0 0 0 0 0@Western NM 2-0-2 0/0 0/0 2/19 0 0 0 0TOTALS 31-18-49 2.0/4 0/0 4/32 7 0 0 1
CAREER STATISTICS
Year G UT-AT-TOT TFL/Yd Sack/Yd INT/Yds PBU QBH FF FR2008 5 0-0-0 0/0 0/0 0/0 0 0 0 02009 11 14-17-31 2.5/12 1.0/9 1/9 4 0 2 12010 11 31-18-49 2.0/4 0/0 4/32 7 0 0 1TOTALS 27 45-35-80 4.5/16 1.0/9 5/41 11 0 2 2
26
SCOTLANDCOYLE
center6’2” • 245• RFR-Rslongmont, colo.longmont hs
General: Is expected to work his way into the rotation at center.
High School: Was a two-time all-state selection at Longmont High School in Longmont, Colo. ... Was a three-time
all-conference selection ... Was also a standout wrestler, earning honorable mention all-state honors during his senior season, and earning all-conference honors twice ... Was 4A heavyweight state championasasenior...Alsocompetedintrack...Wasfirstteamall-conference in track while taking second place in discus at the state meet ... Coached by Doug Johnson ... Was an honor roll student, carrying a 3.0 GPA.
Personal: Son of Eric and Cyn Coyle and Collette and John Speidel ... Has three siblings: McCartney, Rebecca and Navy ... His father, Eric, played football at the University of Colorado from 1981-86.ROSSDAUSIN
quarterback6’5” • 230 • jR-1lsan antonio, tex.waRRen hsbutleR county (ks) c.c.General: A prototypical dropback passer, will battle once again for the starting quarterback position in the fall.
2010: Was9-2asafirstyearstarterfortheThunderwolves,winninghisfirstfivegamesin2010...Heexploded in his home debut, going 16-for-21, for a season-high 304 yards and three touchdowns in a win vs. NW Oklahoma State on Sep. 4 ... Had a strong performance passing vs. Nebraska-Kearney on Oct. 16, going 23-for-41 for 234 yards and two touchdowns ... Played fiveconsecutivegameswithoutthrowinganinterception,leadingtoa126.8passerefficiencyrating...Threwformultipletouchdownsinfourgames ... Finished the season passing for 1674 yards, 12 touchdowns and only six interceptions.
College: Quarterbacked Butler County Community College in El Dorado, Kan. to the 2009 Region VI Championship game ... Tossed 18 touchdowns for Butler, passing for 2,087 yards ... Threw for four touchdowns in Butler’s 51-7 win over Dodge City Community College Sept. 5 ... Butler was ranked number-10 in the NJCAA in 2009 ... Part of Butler’s 2008 NJCAA National Championship team.
High School: Passed for 1,169 yards during his senior season at Warren High School in San Antonio, Tex. ... Led Warren to a 10-2 record in his senior campaign.DAUSIN 2010 GAME-BY-GAMEOpponent Rush Yds TD Lg Comp-Att Yds TD Int [email protected] St. 5 -8 0 6 16-32 200 1 2 55NW Okla St 3 -23 0 0 16-21 304 3 0 63Adams St. 4 0 0 4 7-18 52 0 2 18@Fort Lewis 4 -4 1 1 10-16 148 0 1 42Chadron St. 4 -32 0 0 11-24 91 1 0 16@Colorado Mines 10 36 1 24 14-24 140 1 0 30Neb-Kearney 5 -13 0 6 23-41 234 2 0 32@Mesa St. 7 15 0 11 10-16 104 0 0 20NM Highlands 3 22 1 11 3-7 61 0 0 36@Western St. 2 -3 0 4 10-17 105 2 1 26@Western NM 0 0 0 0 15-23 235 2 0 50TOTALS 47 -10 3 24 135-239 1674 12 6 63
CAREER STATISTICSYear Rush Yds Avg. TD Lg Comp-Att Comp% Yds TD Int Lg Rating2008* Redshirt2009* 62 -186 -3.0 0 18 131-279 47 2,087 18 15 78 120.32010 47 -10 -0.8 3 24 135-239 56.5 1674 12 6 63 126.9TOTALS 47 -10 -0.8 3 24 135-239 56.5 1674 12 6 63 126.9
* At Butler County (KS)C.C. - NJCAA
STEPHANDICKENS
cornerback5’8” • 160 • so-1laurora, colo.cheRokee tRail hsGeneral: A physical corner, could be All-RMAC caliber as early as this season.
2010: Had a solid freshmen season for the Pack, making his debut against Colo-radoMinesonOct.9...Startedhisfirstcareer game the following week against
Nebraska-KearneyonOct.16,finishingthegamewithninetacklesandaforcedfumble...GrabbedhisfirstcareerinterceptionatMesaState on Oct. 23 ... Played in six games for the Pack, starting three of them,finishingtheseasonwith23tacklesandtwointerceptions.
High School: Was an academic all-state selection while at Cherokee Trail High School in Aurora, Colo. ... Was an all-city selection for the Cougars ... Coached by Montee Thelen ... Also competed in track and baseball.
Personal: Son of Loree Dickens ... Has two sisters: Lacee and Brianna ... Is in dentistry.LOUISFISHER
linebackeR6’2” • 205 • RFR-RsbRoomField, colo.bRoomField hsGeneral: Has the speed that CSU-Pueblo coaches crave and will look to translate that into playing time in 2011.
2010: Redshirted in 2010.
High School: Wasafirst-teamall-statetrackandfieldselectionatBroomfieldHighSchoolinBroomfield,Colo. ... Was an honor roll student, boasting a 3.0 GPA ... Coached by Gary Davies.
Personal: Son of Louis Fisher, Jr. and Jeanette Fisher ... Has one older brother, Greg, and one younger sister, Zoe ... Is majoring in business ... Enjoys movies, music, television and spending time with friends and family.JONATHANGAYE
Running back6’0” • 180 • RjR-1lhighlands Ranch, colo.mullen hscoloRado stateGeneral: Is expected to be one of the top candidates to spell Jesse Lewis and JamaalJohnsoninthebackfield.
2010: Saw action in three games in 2010 ...Finishedtheseasonwithfivecarriesfor13yards.
College: Played for two seasons, one as a redshirt, at Colorado State University in Fort Collins, Colo. ... Did not play in 2009, spending season on the roster as a varsity reserve ... Redshirted as a true freshman in 2008.
High School: A standout at Mullen High School in Denver, Colo., was rated by Rivals.com as the No. 1 running back and No. 13 overall prospect in Colorado...Finished his senior year with 606 yards on 64carries,scoringfiveTDs...Averaged9.5yardspercarryin2007,despitemissingfivegamesduringtheheartofMullen’sseasonwithaknee injury...Returned to help the Mustangs to a Centennial League title and a 12-1 season, which ended with a heartbreaking loss to DouglasCountyintheClass5Astatesemifinals...Inhisfirsttwoplayoff games, had seven carries for 79 yards against Legacy, and fivecarriesfor65yards,includinga45-yardTD,againstChatfield...Earlier in 2007 against eventual state champion Grandview, led the Mustangs to a 36-14 comeback win, with 212 yards on 12 carries; ran for three TDs, including 61- and 73-yard bursts in totaling the most yards allowed by the GHS defense during its championship campaign...Sustained the knee injury during practice the following
week, in preparations for rival Cherry Creek, then aggravated the injury during that game...Played only three games his junior year, when an ankle injury ended a promising season after 311 yards andfiveTDs...Totaledmorethan500rushingyardsineachofhisfreshman and sophomore seasons, averaging more than 10 yards per carry over that span...Lettered four years in football, a stretch in which Mullen went 50-6 and captured four Centennial League titles...Head coach was Dave Logan...Also lettered three years in track, where as a sophomore ran the 100-meter dash in 10.63 seconds to win the state championship...Contributed to a 2006 team state track champion-ship...Has 4.35 speed in the 40-yard dash...Chose Colorado State over offers from Illinois, Boise State, Wyoming, Air Force, New Mexico and UNLV; also received interest from Kansas State, Washington, Arizona, Boston College, Georgia and Wisconsin.
Personal: Parents are Joseph and Rosina Gaye...Has an older brother...Helped members of the Boys and Girls Club of Larimer County with homework and reading, and also participated in the club’s sports programs in March before the ‘10 season.TROYGRAHAM
quarterback6’5” • 230 • jR-2lchandleR, aRiz.basha hsnoRtheRn aRizona
General: Isfirmlyentrenchedasthenumber-threequarterback.
2010: Saw action in one game in 2010.
2009: Saw action in three games in 2009.
College: Redshirted one season at Northern Arizona Univer-sity in Flagstaff, Ariz.
High School: A 2008 graduate of Basha High School in Chandler, Ariz. ... Played for Head Coach Tim McBurney ... Threw for 3182 yards and 31 TDs ... Was team captain and MVP during his junior and senior seasons ... Was a two-time all-conferenceselection(firstteamandhonorablemention)... Started in the Arizona All-Star Game as a senior ... Led Basha to an 11-3 mark as a junior, earning a berth in the state semifinal...Wasnamedhonorablementionall-statehisjuniorseason ... Participated in Elite 11 Invite and Nike Camp Invite ... Was chosen West Coast MVP QB at Dave Schumann’s Underclassman Combine ... Also competed in Basketball and Track ... Was a three-year varsity starter in basketball and helpedleadteamtostatesemifinalsduringhisseniorseason... Graduated with 3.65 GPA
Personal: Son of Steve and Karen Graham ... Has one sister: Tatum ... Plans to study business. GRAHAM 2010 GAME-BY-GAMEOpponent Rush Yds TD Lg Comp-Att Yds TD Int [email protected] St. Did not play NW Okla St 0 0 0 0 1-2 12 0 0 12 Adams St. Did not play@Fort Lewis Did not playChadron St. Did not play@Colorado Mines Did not play Neb-Kearney Did not play@Mesa St. Did not playNM Highlands Did not play@Western St. Did not play@Western NM Did not playTOTALS 0 0 0 0 1-2 12 0 0 12 AREER STATISTICS – RUSHING/RECEIVIN
CAREER STATISTICSYear Rush Yds Avg. TD Lg Comp-Att Comp% Yds TD Int Lg Rating2008* Redshirt2009 2 -7 0 0 0 0-3 0 0 0 0 0 02010 0 0 0 0 0 1-2 50 12 0 0 12 100.4TOTALS 2 -7 0 0 0 1-5 20 12 0 0 12 40.16* At Northern Arizona University
2011 RETURNERS
#15 #45
#4
#16
2010Rocky Mountain Athletic Conference Academic Honor Roll
#71
27
JTHADDAN
guaRd/centeR6’2” • 285 • jR-2lcRaig, colo.moFFat county hs
General: Is easily considered one of the most versatile and effective line-men in the RMAC.
2010: Haddan was named tothethird-teamRMACoffensiveteamandwasalsoafirst-teamRMACAll-Academic selection ... Was also a third-team ESPN Academic District VIII selection ... Started all 11 games for the Thunderwolves on the offensive line ... A versatile player who started at both center and guard throughout 2010 ...
2009: Was a second-team National Football Foundation All-Colorado selection ... Moved from his 2008 position of fullback to center and guard, and was on the line for every snap in 2009 ... Helped the Pack’s rushing game be a resurgent unit, rising from a bottom-10 unit nationally in 2008 to the 14th-ranked rushing attack in the nation in 2009.
2008: Redshirted the 2008 season.
High School: Was an all-state honorable mention and all-conference selection for junior performance at Maffat County High School in Craig, Colo. ... Selected as all-conference honorable mention sophomore year ...Alsocompetedinbasketballandtrackandfield...Ownstheschoolrecordforshotputwith53’4.75”...Wasafirst-teamall-stateacademicselect during junior and senior year ... Graduated with a 3.9 GPA.
Personal: Son of Vicki and John Haddan ... Has two brothers: Zach and Colby...Enjoysgolfing.DYRELLHALLCY
linebackeR5’10” • 230 • sR-1ldenveR, colo.denveR east hsglendale (az) c.c.2010: Saw time as a reserve linebacker appearing in all 11 games for the Thun-derwolves ... Finished 2010 with four tackles.
Junior College: Played for one season at Glendale Community College in Glendale, Ariz. ...
High School: Was an all-conference linebacker at Denver East High School in Denver, Colo. ... Also competed in wrestling.
Personal: Son of Shelia Hallcy and Walter Benjamin ... Has one brother: Dyrian ... Uncle Bobby Joe Hallcy played football at Idaho State University in 1988 ... Enjoys cars.HALLCY 2010 GAME-BY-GAMEOpponent UT-AT-TOT TFL/Yd Sack/Yd INT/Yds PBU QBH FF [email protected] St. 0-0-0 0/0 0/0 0/0 0 0 0 0NW Okla.St. 1-0-1 0/0 0/0 0/0 0 0 0 0Adams St. 0-0-0 0/0 0/0 0/0 0 0 0 0@Fort Lewis 2-1-3 0/0 0/0 0/0 0 0 0 0Chadron St. 0-0-0 0/0 0/0 0/0 0 0 0 [email protected] 0-0-0 0/0 0/0 0/0 0 0 0 0Neb-Kearney 0-0-0 0/0 0/0 0/0 0 0 0 0@Mesa St. 0-0-0 0/0 0/0 0/0 0 0 0 0NM Highlands 0-0-0 0/0 0/0 0/0 0 0 0 0@Western St. 0-0-0 0/0 0/0 0/0 0 0 0 0@Western NM 0-0-0 0/0 0/0 0/0 0 0 0 0TOTALS 3-1-4 0/0 0/0 0/0 0 0 0 0
CAREER STATISTICSYear UT-AT-TOT TFL/Yd Sack/Yd INT/Yds PBU QBH FF FR2008* 1-0-1 0.0/0 0/0 0/0 N/A N/A 0 N/A2009* 13-24-37 1.0/3 0.0/0 0/0 N/A N/A 0 N/A2010 3-1-4 0/0 0/0 0/0 0 0 0 0TOTALS 3-1-4 0/0 0/0 0/0 0 0 0 0*At Glendale (AZ) C.C. - NJCAA
TYLERHAMLIN
tight end6’2” • 215 • jR-2llouisville, colo.monaRch hsGeneral: A key component in the Pack’s tight end rotation.
2010: Saw action in seven games in 2010.
2009: Hamlin recorded three catches for 64 yards ... Had a season long 35 yard catch vs. New Mexico Highlands on Oct. 17 ... Finished 2009 with 21.3 yards per catch, which was second for the Pack ... Also returned two kicks for the Pack for 22 yards ... Saw action in 10 games, while starting in seven of them.
2008: Redshirted in 2008.
High School: Was part of the 2008 state runner-up 4A team atMonarchHighSchoolinLouisville,Colo....Wasfirst-teamall-state selection in 2008 ... Was an honorable mention all-stateselectionfor2007season...Wasfirst-teamall-conference and all-county for 2007 and 2008 performances ... Holds the second-highest career tackles in Coyote history ... Was a two time academic all-state honorable mention ... Also competed in baseball and track ... Graduated with a 3.6 GPA.
Personal: Son of Leanne and Dennis Hamlin .. Has one brother, Ryan ... Plans to major in elementary education. HAMLIN 2010 GAME-BY-GAMEOpponent REC YDS TD LG RUSH YDS TD LG [email protected] St. Did not playNW Okla St Did not playAdams St. Did not play@Fort Lewis 0 0 0 0 0 0 0 0 0Chadron St. 0 0 0 0 0 0 0 0 [email protected] 0 0 0 0 0 0 0 0 0Neb-Kearney 0 0 0 0 0 0 0 0 10@Mesa St. 0 0 0 0 0 0 0 0 0NM Highlands 0 0 0 0 0 0 0 0 0@Western St. Did not play@Western NM 0 0 0 0 0 0 0 0 0TOTALS 0 0 0 0 0 0 0 0 10
CAREER STATISTICSYear REC YDS AVG TD LG RUSH YDS AVG TD LG ALLPURP2008 Redshirt2009 3 64 21.3 0 35 0 0 0.0 0 0 862010 0 0 0 0 0 0 0 0 0 0 10TOTALS 3 64 21.3 0 35 0 0 0.0 0 0 96
NICKHENDERSON
saFety5’10” • 180 • so-1lbeRthoud, colo.beRthoud hsGeneral: Experienced Safety looking for breakout year as a nickel back.
2010: Saw action in nine games for the Thunderwolves in 2010 ... Had a season-high four tackles and a blocked kick vs NW Oklahoma State on Sep. 4 ...
Finished 2010 with 12 tackles.
2009: Redshirted in 2009.
High School: Was selected as all-area, all-conference, and all-state in 2009 for Berthoud High School in Berthoud, Colo. ... Also was a wrestler for the Spartans.
Personal: Son of Sandra and Dan Henderson ... Has two siblings: Thomas and Kelli ... Plans to major in business. HENDERSON 2010 GAME-BY-GAMEOpponent UT-AT-TOT TFL/Yd Sack/Yd INT/Yds PBU QBH FF [email protected] St. 1-1-2 0/0 0/0 0/0 0 0 0 0NW Okla.St. 4-0-4 0/0 0/0 0/0 0 0 0 0Adams St. 0-1-1 0/0 0/0 0/0 0 0 0 0@Fort Lewis 2-1-3 0/0 0/0 0/0 0 0 0 0Chadron St. 0-0-0 0/0 0/0 0/0 0 0 0 [email protected] Did not playNeb-Kearney Did not play@Mesa St. 0-0-0 0/0 0/0 0/0 0 0 0 0NM Highlands 1-0-1 0/0 0/0 0/0 0 0 0 0
@Western St. 1-0-1 0/0 0/0 0/0 0 0 0 0@Western NM 0-0-0 0/0 0/0 0/0 0 0 0 0TOTALS 9-3-12 0/0 0/0 0/0 0 0 0 0
CAREER STATISTICSYear UT-AT-TOT TFL/Yd Sack/Yd INT/Yds PBU QBH FF FR2009 Redshirt2010 9-3-12 0.0/0 0.0/0 0/0 0 0 0 0TOTALS 9-3-12 0/0 0/0 0/0 0 0 0 0
JUSTINHERRERA
deFensive end6’3” • 220 • jR-1llittleton, colo.heRitage hsGeneral: Expected to start in 2011 after a very productive 2010.
2010: Filled in on the defensive line in 2010 seeing action in all 11 games, including starting in two games ... Had a
season-highfivetacklesandablockedkickvs.AdamsStateonSep.18...RecordedmultipletacklesinfivegamesfortheThunderwolves... Finished 2010 with 18 tackles, 2.5 going for a loss and 1.5 sacks.
2009: Was a big help on the Pack defensive line in 2009, registering 15 tackles ... Second amongst defensive linemen with 7.0 tackles for a loss ... Forced two fumbles and recovered a team-high four fumbles ... Had three sacks on the year ... Recorded a season-high seven tackles vs. Colorado Mines on Sep. 26 ... Played in all 11 games for the Pack while starting in seven of them.
2008: Redshirted in 2008.
High School: Helped lead Heritage High School in Littleton, Colo. toContinentalLeagueChampions...Wasfirst-teamall-continentalleague for senior year performance ... Owns the title to the Eagles sack record, along with two power clean records ... Selected for second-team all-continental league for junior season ... Three-time letterman ... Also competed in 110 hurdles, shot put and discus ... Was Student of the Month in 2007 and 2008 ... Graduated with a 3.0 GPA.
Personal: Son of Darlene and Eric Herrera ... Has two siblings: Tabitha and Isaiah ... Credits all his accomplishments to his family whom, he says, are the only people to believe he could accomplish big dreams, like making it to the collegiate level ... Enjoys snowboard-ing and cars ... Plans to major in engineering and business. HERRERA 2010 GAME-BY-GAMEOpponent UT-AT-TOT TFL/Yd Sack/Yd INT/Yds PBU QBH FF [email protected] St. 2-1-3 0/0 0/0 0/0 0 0 0 0NW Okla.St. 0-2-2 0/0 0/0 0/0 0 0 0 0Adams St. 3-2-5 0.5/1 0.5/1 0/0 0 0 0 0@Fort Lewis 1-2-3 0/0 0/0 0/0 0 0 0 0Chadron St. 0-0-0 0/0 0/0 0/0 0 0 0 [email protected] 0-0-0 0/0 0/0 0/0 0 0 0 0Neb-Kearney 0-0-0 0/0 0/0 0/0 0 0 0 0@Mesa St. 0-0-0 0/0 0/0 0/0 0 0 0 0NM Highlands 0-3-3 1.0/1 0/0 0/0 0 0 0 0@Western St. 1-0-1 1.0/1 1.0/1 0/0 0 0 0 0@Western NM 0-1-1 0/0 0/0 0/0 0 0 0 0TOTALS 7-11-18 2.5/3 1.5/2 0/0 0 0 0 0
CAREER STATISTICSYear UT-AT-TOT TFL/Yd Sack/Yd INT/Yds PBU QBH FF FR2008 Redshirt2009 10-5-15 7.0/31 3.0/20 0/0 0 3 2 42010 7-11-18 2.5/3 1.5/2 0/0 0 0 0 0TOTALS 17-16-33 9.5/34 4.5/22 0/0 0 3 2 4
2011 RETURNERS
#97
#60
2010All-Rocky Mountain Athletic Confer-ence (third-team)Academic All-Rocky Mountain Athletic Conference (first-team)CoSIDA/ESPN The Magazine Aca-demic All-District (third-team)
2009National Football Foundation All-Colorado (second team)RMAC Academic Honor Roll
#46
#43
#6
28
JERVOISEHOLLINS
nose guaRd6’1” • 228 • so-1laurora, colo.oveRland hsGeneral: After a breakout freshman season, Hollins can become the Pack’s top defensive lineman in 2011.
2010: Became entrenched as a starter in 2010, starting all 11 games as a freshmen
for the Thunderwolves ... Was a disruptive force alone the defensive line tallying 4.5 tackles for a loss and 2.5 sacks ... Had a career-high eight tackles vs. Chadron State on Oct. 2 ... Hollins had his most productivegamesvs.Nebraska-KearneyonOct.16finishingwithseven tackles including 1.5 for a loss and 1.5 sacks ... Finished 2010 with 38 total tackles.
High School: Was a two-time second-team all-conference selection at Overland High School in Aurora, Colo. ... Was also an all-city selection...Had64tacklesandfivesacksduringhisseniorseason... Averaged 51 tackles and 2 sacks during his sophomore and junior seasons ... Also played basketball.
Personal: Son of Erica Hollins ... Is majoring in computer information systems.HOLLINS 2010 GAME-BY-GAMEOpponent UT-AT-TOT TFL/Yd Sack/Yd INT/Yds PBU QBH FF [email protected] St. 1-0-1 0/0 0/0 0/0 0 0 0 0NW Okla.St. 0-3-3 0.5/1 0.5/1 0/0 0 0 0 0Adams St. 0-4-4 1.0/1 0.5/0 0/0 0 0 0 0@Fort Lewis 2-1-3 0/0 0/0 0/0 0 1 0 0Chadron St. 0-8-8 1.0/6 0/0 0/0 0 0 0 [email protected] 0-8-8 0/0 0/0 0/0 0 0 0 0Neb-Kearney 1-6-7 1.5/2 1.5/2 0/0 0 0 0 0@Mesa St. 2-2-4 0/0 0/0 0/0 0 0 0 0NM Highlands 0-2-2 0.5/1 0/0 0/0 0 0 0 0@Western St. 0-1-1 0/0 0/0 0/0 0 1 0 0@Western NM 1-5-6 0/0 0/0 0/0 0 1 0 0TOTALS 7-31-38 4.5/11 2.5/3 0/0 0 3 0 0
CAREER STATISTICSYear UT-AT-TOT TFL/Yd Sack/Yd INT/Yds PBU QBH FF FR2010 7-31-38 4.5/11 2.5/3 0/0 0 3 0 0TOTALS 7-31-38 4.5/11 2.5/3 0/0 0 3 0 0
BENJACKSON
oFFensive guaRd6’1” • 265 • so-1lbRighton, colo.bRighton hsGeneral: A key special teams lineman and role player on the line.
2010: Saw action in all 11 games for the Thunderwolves in 2010.
2009: Redshirted the 2009 season.
High School: Wasfirstteamall-conferenceontheoffensivelineand defensive line for Brighton High School in Brighton, Colo. ... Nominated for all-state as a Dawg ... Holds the school squat record at 435 pounds ... Also competed in wrestling and basesball ... Was regional wrestling champion ... Selected for all-conference in baseball ... First team academic all-conference.
Personal: Son of Jennie and Tony Jackson ... Dad played on the 1984 CSU-Pueblo football team ... Has two younger brothers: Joe and Sam ... Majoring in business marketing.RYAN JENSEN
oFFensive tackle6’4” • 265 • so-1lFoRt moRgan, colo.FoRt moRgan hs
General: Has blossomed into arguably the team’s top lineman. Is a rock on the outside tackle position.
2010: Earned second-team all-RMAC honors and second-team all-Colorado honors by the National Football Foundation ... Returned in 2010 to start all 11 games on the offensive line for the Thunderwolves ... Helped the Pack rush for 2326 yards in 2010, which ranked 16th-best in the nation.
2009: Became an immediate starter as a true freshman, starting nine games for the Pack in 2009 ... Held down the left side for a resurgent Pack rushing game, which improved from a bottom-10 unit nationally in 2008 to the 14th-best rushing game in the nation in 2009.
High School: Wasafirst-teamall-stateselectionatFortMorganHighSchool in Fort Morgan, Colo. ... Was an all-conference selection ... Helped Fort Morgan to the Colorado 3A state championship game ... Had 86 tackles and 12 sacks as a senior ... Also competed in baseball ... Coached by Harrison Chisum.
Personal: Son of Jane and Dean Jensen ... Has one older brother, Seth, who played football at the University of Nebraska ... Plans ot major in business.NICJOHNSON
Fullback6’1” • 195 • RFR-RseveRgReen, colo.eveRgReen hsGeneral: A speedy fullback, will compete for playing time at the position in 2011.
2010: Redshirted in 2010.
High School: Wasatwo-timefirst-teamall-conference selection (both offense and
defense) at Evergreen High School in Evergreen, Colo. ... Won the “Mark Taylor Award” as Team MVP ... Logged 1,078 rushing yards and accumulated 53 percent of the team’s all-purpose yards ... As a defensive end, had nine sacks in just one half-season played on the defensive side of the football ... Coached by Rob Molholm ... Also ran track and played basketball.
Personal: Son of Mark and Susan Johnson ... Has two siblings: Halle and Jake ... His dad, Mark, played basketball at Minot State College from 1985-87 ... Enjoys music and playing guitar.
JONATHANJONES
center5’8” • 225 • jR-2lhouston, tex.westField hsGeneral: Don’t let his small frame fool you – Jones boasts some of the best technical talent on the offensive line, and would easily be a high-level Division-I center if he had the size.
2010: SawactioninfivegamesfortheThunderwolves in 2010.
2009: Rose through the ranks to become the starting center on the Pack during his true freshman season, starting four games ... In the games in which he started, CSU-Pueblo averaged 320 yards rushing per game ... Helped the resurgent Pack rushing unit to improve from a bottom-10 unit nationally in 2008 to the 14th-ranked rushing game in 2009.
High School: Wasathree-timeall-districtfirst-teamselectionatWestfieldHighSchoolinHouston,Tex....Wasnamedtheteam’sof-fensive lineman of the year as a junior ... Coached by Corby Meekins ...GraduatedfromWestfieldwithastellar4.1GPA...Alsorantrackin high school.
Personal: Son of Jonnie Jones, Dana Jones, and Gwen Cannon ... Has two older sisters: Attiya and Adlay ... Plans to major in pre-medicine and biology... Enjoys drawing, watching cartoons, and playing piano.TAYLORKELLY
oFFensive tackle6’5” • 245 • so-1lojai, caliF.noRdhoFF hs
General: Has quickly risen through the ranks to be pencilled in as a starter at tackle in 2011.
2010: Helped anchor the offensive line in 2010 seeing action in seven games.
2009: Redshirted in 2009.
High School: Wasatwo-timefirst-teamall-leagueselectionatNordhoff High School in Ojai, Calif. ... Was named all-Ventura County and all-academic Ventura County ... Was named team MVP ... As a senior, led the team in tackles ... Blocked for CSU-Pueblo teammate, Drew Rodriguez, at Nordhoff ... Part of Ventura County all-star team ... Graduated in the top ten of his class with a 4.33 GPA ... Coached by Tony Henney.
Personal: Son of Dan and Jane Kelly ... Has one older sister, Ashley ... Plans to major in business ... Enjoys snowboarding.
#7
#66
2011 RETURNERS#59
2010All-Rocky Mountain Athletic Confer-ence (second-team)National Football Foundation All-Colorado (second team)
#52
#54
2010Rocky Mountain Athletic Conference Academic Honor Roll
29
30
BRANDONKLIESEN
Punter5’10” • 200 • so-1lPueblo, colo.south hs
General: Afterfinishingsixthinthenationin punting in 2011, the sky’s the limit for this Pueblo-native.
2010: Stepped in as the full-time punter for the Thunderwolves in 2010 ... Punted 50 times averaging 43.2 yards per punt ... Pinned the opponent inside the 20-yard line 12 times ... Came up big on a fake puntvs.ChadronStateonOct.2,rushing11yardsforafirstdown... Also had nine punts that went for 50+ yards ... Was named to the RMAC academic honor roll.
2009: Redshirted in 2009.
High School: Was a spot-on kicker at Pueblo South High School in Pueblo, Colo. ... In two years of work as the team’s placekicker, was9-for-9onfieldgoalattempts,hislongestbeinga43-yarder...51-for-56 on extra points. KLEISEN 2010 GAME-BY-GAME PUNTINGOpponent No. Yards Avg. Long Blk TB FC 50+ [email protected] St. 6 265 44.2 58 0 2 2 1 1NW Okla St 6 218 36.3 44 0 0 0 0 0Adams St. 5 211 42.2 46 0 1 0 0 0@Fort Lewis 3 150 50.0 52 0 1 0 2 2Chadron St. 4 164 41.0 46 0 0 1 0 [email protected] 8 372 46.5 59 0 2 1 3 1Neb-Kearney 6 231 38.5 53 0 1 0 1 1@Mesa St. 2 99 49.5 52 0 0 0 1 2NM Highlands 1 44 44.0 44 0 0 1 0 1@Western St. 3 130 43.3 48 0 0 1 0 2@Western NM 6 274 45.7 53 0 1 1 1 1TOTALS 50 2158 43.7 59 0 8 7 9 12
CAREER PUNTING STATISTICSYear No. Yards Avg. Long Blk TB FC 50+ In202009 Redshirt2010 50 2158 43.7 59 0 8 7 9 12TOTALS 50 2158 43.7 59 0 8 7 9 12
JONKUZAVA
quarterback6’0” • 190 • jR-tRlittleton, colo.heRtiage hschadRon stateGeneral: A shorter but very speedy signal-caller, his arm and legs could win him the starting job in 2011.
2010: Sat out season as a transfer.
College: Played for one season at Chadron State College in Chadron, Neb. ... Played in spot duty for the Eagles, complet-ing one collegiate pass in his only passing attempt ... Was a Dean’s List student at CSC.
High School: Was a second-team all-state selection at Heritage High School in Littleton, Colo. ... Was an honorable mention all-Continental League selection and the team’s captain ... Broke 11 school records, including most TD passes in a season, highest completion percentage, and most passing yards in a season ... Recorded 1,848 yards and 22 touchdowns in his career ... Was the state of Colorado’s second-leading passer in 2006 ... Also played basketball ... Graduated with a 3.3 GPA.
Personal: Son of Kathy-Jo and Timothy Kuzava ... Has two siblings: Adam and Jenna ... Is majoring in business ... Enjoys golfingandplayingguitar.CAREER STATISTICS (Year Rush Yds Avg. TD Lg Comp-Att Comp% Yds TD Int Lg Rating2007* Redshirt2008* 2 -3 -1.5 0 5 1-1 100 11 0 0 11 192.42009 Did not play2010 Did not play/TransferedTOTALS 2 -3 -1.5 0 5 1-1 100 11 0 0 11 192.4* At Chadron State - NCAA D-II
JARRODLACY
saFety5’10” • 180 • RFR-Rsboynton beach, Fla.santaluces hs
General: A defensive back with tremen-dous raw talent, he could be a surprise in thedefensivebackfield.
2010: Redshirted in 2010.
High School: Wasafirst-teamall-conferenceselectionasarunningback at Santaluces Community High School in Boynton Beach, Fla. ... Was a second-team all-area selection ... Ran for 800 yards with 140 receiving yards and 15 total touchdowns for the Chiefs ... Coached by Darryl Drinkwater ... Also ran track.
Personal: Son of Larry and Gloria Lacy ... Has four siblings: Felicia, Joshua, Jasan and Kristie ... Enjoys playing basketball.LOUIELOZANO
linebackeR5’11” • 197 • so-1lwhitteR, caliF.la seRna hsGeneral: Easily starting material, is a more-than-capablefill-inatlinebacker.
2010: Filled in as a reserve linebacker for the Pack in 2010 seeing action nine games and starting in two games ... Had
a season-high eight tackles and one pass break-up vs. Oklahoma Panhandle on Aug. 28 ... Finished 2010 with 19 tackles, two of which were tackles for a loss.
2009: Redshirted the 2009 season.
High School: Wasafirst-teamall-CaliforniaInterscholasticFedera-tion selection at La Serna High School in Whittier, Calif. ... Was an all-area and all-league selection ... Was named to numerous team awards, including “Iron Man,” “Iron Knight,” and “Rookie of the Year” ... Was the team captain and MVP as a senior ... As a running back, ran for 868 yards on the ground ... Registered 105 tackles, forcing fivefumbles,andloggingfoursacksandtwointerceptions...Alsocompeted in track and basketball ... Graduated with a 3.3 GPA ... Earned “Math Analysis Honors” and was involved in the Business Academy ... Coached by Margarito Beltran.
Personal: Son of Maria Lozano and Jose Zazueta ... Has three sisters: Vanessa, Liz and Chloe ... Plans to major in mass communi-cations ... Enjoys music and sports.LOzANO 2010 GAME-BY-GAMEOpponent UT-AT-TOT TFL/Yd Sack/Yd INT/Yds PBU QBH FF [email protected] St. 5-3-8 1.0/4 0/0 0/0 1 0 0 0NW Okla.St. 0-0-0 0.0/0 0/0 0/0 0 0 0 0Adams St. Did not play@Fort Lewis Did not playChadron St. 0-8-8 1.0/6 0/0 0/0 0 0 0 [email protected] 0-0-0 0/0 0/0 0/0 0 0 0 0Neb-Kearney 0-1-1 0/0 0/0 0/0 0 0 0 0@Mesa St. 0-1-1 0/0 0/0 0/0 0 0 0 0NM Highlands 2-1-3 0/0 0/0 0/0 0 0 0 0@Western St. 0-1-1 0/0 0/0 0/0 0 0 0 0@Western NM 0-1-1 0/0 0/0 0/0 0 0 0 0TOTALS 19-9-19 2.0/5 0.0/0 0/0 1 0 0 0
CAREER STATISTICSYear UT-AT-TOT TFL/Yd Sack/Yd INT/Yds PBU QBH FF FR2009 Redshirt2010 19-9-19 2.0/5 0.0/0 0/0 1 0 0 0TOTALS 19-9-19 2.0/5 0.0/0 0/0 1 0 0 0
JOSHMACK
deFensive lineman6’3” • 267 • RsR-1lPueblo, colo.east hsnoRtheRn coloRadoGeneral: After sitting out 2010 with an injury, could be a welcome impact player in 2011.
2010: Redshirted the 2010 season.
2009: Helped the defensive front for the Pack ... Registered 15 tackles for 2009 ... Earned 1.5 sacks which is sixth on the team ... Blocked one kick and recorded a season-high three tackles in the 38-27 victory over Western State Oct. 24 ... Played in nine games for the Thunderwolves while starting in two of them.
2008 (Northern Colorado): Started six games for the UNC Bears ... Recorded 17 tackles, including three tackles vs. Purdue.
2007 (Northern Colorado): Played in 11 games at the Uni-versity of Northern Colorado, starting one at Cal Poly where he made a career-best seven tackles... Ended the year with 18 tackles, including 1.5 for loss.
High School: Earned three letters in football and one each in baseballandtrack&fieldfortheEagles...Wasathree-timeall-conference selection and an honorable mention all-state pick as a senior... Averaged nine tackles a game in his last year,recording10sacks,oneinterceptionandfiveforcedfumbles to go with 95 tackles.
Personal: Son of Roxana and Steve Mack ... Has two siblings: Jeremy Allen and Sheulyn Mack ... Plans to major in criminal justice.CAREER STATISTICSYear UT-AT-TOT TFL/Yd Sack/Yd INT/Yds PBU QBH FF FR2007* 8-10-18 1.5/1 0.0/0 0/0 0 0 0 02008* 7-10-17 1.0/7 0.0/0 0/0 3 1 0 02009 6-9-15 2.5/10 1.5/6 0/0 0 1 0 02010 RedshirtCSUP TOTALS 6-9-15 2.5/10 1.5/6 0/0 0 1 0 0COLL. TOTALS 21-29-50 5.0/18 1.5/6 0/0 3 2 0 0
* At NCAA FCS Northern Colorado
2011 RETURNERS
#5
#9
2010Rocky Mountain Athletic Conference Academic Honor Roll
#35
#38
#91
31
ADRIANMARQUEZ
linebackeR5’9” • 210 • sR-3ldenveR, colo.beaR cReek hsGeneral: Will be given every opportunity to win the team’s starting inside line-backer job as a senior in 2011.
2010: Appeared in seven games for the Thunderwolves, starting in three games ... Had a season-high seven tackles and
a pass break-up vs Mesa State on Oct. 23 ... Finished 2010 with 20 tackles.
2009: Recorded 12 tackles for the Thunderwolves ... Saw playing time in 10 games for the 2009 season ... Had a season-high three tackles vs. Fort Lewis on Sep. 12.
2008: Saw time in nine games for the Pack, playing on special teams and as a reserve linebacker ... Recorded 10 tackles for the Pack ... Saw extended time at linebacker vs. Western State Oct. 25, register-ingfivetackles.
High School: Coached by Tom Thenell at Bear Creek HS ... Gradu-atedwithhonorsandwasnamedAll-StatefirstteamAcademicforthreeyears...AlsonamedAll-Conferencefirstteamin2007.
Personal: SonofMariaDiazandGabrielMarquez...Hasfivesiblings: Gabriel, Daniella, Gaspar, Fey, and Diego ... Enjoys playing video games, weight lifting and eating. MARQUEz 2010 GAME-BY-GAMEOpponent UT-AT-TOT TFL/Yd Sack/Yd INT/Yds PBU QBH FF [email protected] St. 0-1-1 0/0 0/0 0/0 0 0 0 0NW Okla.St. 1-0-1 0/0 0/0 0/0 0 0 0 0Adams St. 0-0-0 0/0 0/0 0/0 0 0 0 0@Fort Lewis Did not playChadron St. Did not [email protected] Did not playNeb-Kearney Did not play@Mesa St. 2-5-7 0/0 0/0 0/0 1 0 0 0NM Highlands 0-2-2 0/0 0/0 0/0 0 0 0 0@Western St. 4-2-6 0/0 0/0 0/0 0 0 0 0@Western NM 2-1-3 0/0 0/0 0/0 0 0 0 0TOTALS 9-11-20 0/0 0/0 0/0 1 0 0 0
CAREER STATISTICSYear UT-AT-TOT TFL/Yd Sack/Yd INT/Yds PBU QBH FF FR2008 3-7-10 1.0/0 0.0/0 0/0 0 0 0 02009 7-5-12 0.0/0 0.0/0 0/0 0 0 0 02010 9-11-20 0/0 0/0 0/0 1 0 0 0TOTALS 19-23-42 1.0/0 0.0/0 0/0 1 0 0 0
KYLEMCCALL
linebackeR6’1” • 195 • sR-3laurora, colo.gRandview hsGeneral: The three-year letter-winner will continue as a key reserve at linebacker and on special teams.
2010: Played in 10 games for the Thun-derwolves as a reserve linebacker ... Had a season-high four tackles and a pass
break-up vs Fort Lewis on Sep. 25 ... Finished 2010 with 19 tackles.
2009: Movedfromthedefensivebackfieldtolinebacker,claiming14 tackles in 2009 ... Recorded a season high three tackles twice in 2009, against Western State Oct. 24 and against Adams State Nov. 7 ... Played in all 11 games for the Thunderwolves in 2009.
2008: Saw action in seven games for the ThunderWolves, primarily in nickel and dime packages in the secondary ... Came through with fivetacklesduringthePack’supsetbidvs.ColoradoMinesSept.27... Followed it up with a 7-tackle performance vs. Nebraska-Kearney Oct. 4 ... His 20 tackles were the sixth most in the Pack’s secondary ...Grabbedtwointerceptionswiththefirstvs.FortLewisSept.13andthe second vs. Nebraska-Kearney Oct 4.
High School: Was one of four team captains to lead Grandview High School in Aurora, Colo. to a 2007 state championship ... Was an all-state, all-Colorado and all-conference selection for the Wolves ... Holds the team record for most sacks ... Led the team in ‘big hits’
... Made two interceptions while on the championship team ... Was voted twice as Wolves’ Defensive MVP ... Also pitched and played third base for the baseball team.
Personal: Son of Kathy and Kurt McCall ... Has one older brother, Kobey ... Brother, Kobey, pitched at Colby Community College from 2003-2005 and then moved his athletic career to Regis University from2005-2007...Enjoyshunting,fishing,beingwithfamilyandfriendsandgoingbacktohishighschoolfieldstowatchthefootballand baseball teams ... Plans to major in criminal justice where he aspires to join the S.W.A.T. Team/FBI or Marines upon graduation.MCCALL 2010 GAME-BY-GAMEOpponent UT-AT-TOT TFL/Yd Sack/Yd INT/Yds PBU QBH FF [email protected] St. 1-0-1 0/0 0/0 0/0 0 0 0 0NW Okla.St. Did not playAdams St. 0-0-0 0/0 0/0 0/0 0 0 0 0@Fort Lewis 2-2-4 0/0 0/0 0/0 1 0 0 0Chadron St. 0-1-1 0/0 0/0 0/0 0 0 0 [email protected] 3-0-3 0/0 0/0 0/0 0 0 0 0Neb-Kearney 0-2-2 0/0 0/0 0/0 0 0 0 0@Mesa St. 0-1-1 0/0 0/0 0/0 0 0 0 0NM Highlands 1-2-3 0/0 0/0 0/0 0 0 0 0@Western St. 2-1-3 0/0 0/0 0/0 0 0 0 0@Western NM 0-1-1 0/0 0/0 0/0 0 0 0 0TOTALS 9-10-19 0/0 0/0 0/0 1 0 0 0
CAREER STATISTICSYear UT-AT-TOT TFL/Yd Sack/Yd INT/Yds PBU QBH FF FR2008 11-9-20 1.0/5 0.0/0 2/7 0 0 0 02009 8-6-14 0.0/0 0.0/0 0/0 0 0 0 02010 9-10-19 0/0 0/0 0/0 1 0 0 0TOTALS 28-25-53 1.0/5 0.0/0 2/7 1 0 0 0
MARQUISMCNEAL
Fullback5’8” • 230 • RFR-RscommeRce city, colo.pRaRie view hsGeneral: Fun Fact - Was the #1 Draft Pick for the team’s 2011 Spring Game.
2010: Redshirted in 2010.
High School: Was a two-time all-conference selection as a fullback at Prairie View High School in Commerce City, Colo. ... Earned recognition as a second-team all-conference linebacker for the Thunderhawks, as well as two all-conference honors as a running back (one second-team and one honorable mention) ... Also ran track and played basketball and lacrosse ... Graduated with a 3.2 GPA.
Personal: Son of Zimmeri McNeal, Jr. and Cherie McNeal ... Has two siblings: Cherie and Aaron.BELDYNSEKA
outside linebackeR6’1” • 216 • jR-2laurora, colo.cheRokee tRail hs2010: Played in 10 games for the Thunderwolves in 2010, starting at line-backer in eight of those games ... Was second on the team in tackles totaling 70 throughout the year ... Had a season-high 11 tackles vs. Colorado Mines on Oct. 9
... Finished 2010 with six tackles for a loss and three sacks.
2009: Saw action in nine games for the Thunderwolves in 2009, excelling a special teams sniper and reserve linebacker ... Recorded nine tackles throughout the season ... Earned a season-high four tackles and one tackle for a loss vs. Western New Mexico on Oct. 31 ... Against Western New Mexico, three of his tackles were on special teams coverage.
2008: Redshirted in 2008.
High School: Wasfirst-teamall-conferenceselectionforthe2007-2008 season at Cherokee Trail High School in Aurora, Colo. ... Also competed in track ... Was a 2008 Senior Citizenship Award recipient.
Personal: SonofClarissNseka...Hasfivesiblings:Glory,Michee,Nathan, Serge and Jake ... Enjoys lifting weights, watching movies and being outside.
NSEKA 2010 GAME-BY-GAMEOpponent UT-AT-TOT TFL/Yd Sack/Yd INT/Yds PBU QBH FF [email protected] St. Did not play NW Okla.St. 3-3-6 1.0/5 1.0/5 0 0 0 0 0Adams St. 4-5-9 0.5/1 0/0 0/0 0 0 0 0@Fort Lewis 0-7-7 0/0 0/0 0/0 0 0 0 0Chadron St. 2-5-7 1.0/1 0/0 0/0 0 0 0 [email protected] 5-6-11 0/0 0/0 0/0 0 0 0 0Neb-Kearney 2-2-4 0/0 0/0 0/0 0 2 0 0@Mesa St. 4-4-8 1.0/1 0/0 0/0 0 0 0 0NM Highlands 2-6-8 0.5/1 0/0 0/0 1 0 0 0@Western St. 2-1-3 1.0/8 1.0/8 0/0 0 0 0 0@Western NM 3-4-7 1.0/5 1.0/5 0/0 0 0 0 0TOTALS 27-43-70 6.0/22 3.0/18 0 1 2 0 0
CAREER STATISTICSYear UT-AT-TOT TFL/Yd Sack/Yd INT/Yds PBU QBH FF FR2008 Redshirt2009 4-5-9 1.0/7 0.0/0 0/0 0 0 0 02010 27-43-70 6.0/22 3.0/18 0 1 2 0 0TOTALS 31-48-79 7.0/29 3.0/18 0/0 1 2 0 0
JONATHANOWENS
wide ReceiveR6’2” • 180 • RjR-RstoPeka, kan.shawnee heights hsbutleR county (ks) c.c.2010: Saw action in two games for the Pack before his season ended with an injury..
Junior College: Played for two seasons at Butler County Community College in El Dorado, Kan. ... Helped Butler win the 2008 NJCAA National Championship ... Caught passes from fellow ThunderWolf, quarterback Ross Dausin.
High School: Prepped at Shawnee Heights High School in Topeka, Kan. ... Was an all-city selection at SHHS.
Personal: Son of Horace and Rachelle Owens ... Has three siblings: James, Latoya and LaRaisha ... Is majoring in sociology.CAREER STATISTICSYear REC YDS AVG TD LG RUSH YDS AVG TD LG ALLPURP2008* 1 18 18.0 1 18 0 0 0.0 0 0 182009* 6 94 15.7 1 30 0 0 0.0 0 0 942010 0 0 0.0 0 0 0 0 0.0 0 0 0TOTALS 7 112 16.0 2 30 0 0 0.0 0 0 112*Played at Butler County C.C. (NJCAA)
AUSTINPAYNE
oFFensive tackle6’6” • 238 • RFR-Rspueblo west, colo.pueblo west hsGeneral: Is expected to blossom into a strong tackle in the years to come.
2010: Redshirted in 2010.
High School: Was a two-time all-conference selection at Pueblo West
High School in Pueblo West, Colo. ... Helped West to the 2007 4A Colorado state championship ... Was a three-time letterman in football ... Also played baseball for three years and basketball for two ... Coached by Monte Pinkerton ... Was an honor roll student, carrying a 3.2 GPA.
Personal: Son of Carl and Joanna Payne ... Has one sister, Chelsey ... Is majoring in industrial engineering ... Enjoys basketball and fishing.
#47
2011 RETURNERS#41
#31
#44
#74
32
ROGERPFANNENSCHMID
tight end6’3” • 240 • RjR-2lPueblo, colo.centennial hs
General: Showed off his pass-catching skills in 2010,
2010: Was fourth on the team in receiving yards for the Pack with 212 yards... Had his best game vs. Western New Mexico when he recordedtworeceptionsfor57yardsandatouchdown...Startedfivegames while seeing action in all 11.
2009: Was the Pack’s starter at tight end before an injury ended his seasonintheteam’sfirstgame...CaughtonepassforfiveyardsvsEastern New Mexico Aug. 29.
2008: Redshirted in 2008.
High School: Wasafirst-teamall-conferenceandall-stateselectionat Centennial High School in Pueblo, Colo. ... Was named all-city three years in a row ... Was an all-conference honorable mention selection in 2007 ... Also competed on the basketball and baseball team.
Personal: Son of Roger and Lori Pfannenschmid ... Has two sisters: Corrie and Kacey, who is on the CSU-Pueblo women’s basketball team.PFANNENSCHMID 2010 GAME-BY-GAMEOpponent REC YDS TD LG RUSH YDS TD LG ALLPURP@ Okla.Panhandle St. 2 17 0 10 0 0 0 0 17NW Okla St 1 22 0 22 0 0 0 0 22Adams St. 0 0 0 0 0 0 0 0 0@Fort Lewis 2 50 0 42 0 0 0 0 50Chadron St. 0 0 0 0 0 0 0 0 [email protected] 0 0 0 0 0 0 0 0 0Neb-Kearney 2 40 0 25 0 0 0 0 40@Mesa St. 0 0 0 0 0 0 0 0 0NM Highlands 0 0 0 0 0 0 0 0 0@Western St. 1 26 1 26 0 0 0 0 26@Western NM 2 57 1 41 0 0 0 0 57TOTALS 10 212 2 42 0 0 0 0 212
CAREER STATISTICSYear REC YDS AVG TD LG RUSH YDS AVG TD LG ALLPURP2009 1 5 5.0 0 5 0 0 0.0 0 0 52010 10 212 21.2 2 42 0 0 0.0 0 0 212TOTALS 0 0 0 0 0 0 0 0.0 0 0 0
GIOVANNIRIDER
Fullback6’1” • 220 • jR-2lPueblo, colo.county hsGeneral: Will compete for the starting job at fullback after a successful season as the blocking back in 2010.
2010: Started four games while seeing action in nine games for the Pack... Had nine carries for 41 yards and a touchdown
in 2010.
2009: Saw limited action in 2009 while playing in only one game Sep. 12 vs. Fort Lewis ... Had one rush for 5 yards.
2008: Redshirted in 2008.
High School: Was honorable mention all-state for Pueblo County High School in Pueblo, Colo. ... Also competed in baseball, basketball and track ... Was an honor roll student graduating with a 3.0 GPA.
Personal: Son of Beth Ingo-Rider ... Has one twin sister, Gianna and one younger sister, Sammi ... Plans to major in athletic training. RIDER 2010 GAME-BY-GAMEOpponent RUSH YDS TD LG REC YDS TD LG ALLPURP@ Okla.Panhandle St. Did not play NW Okla St 1 1 1 1 0 0 0 0 1Adams St. 1 7 0 7 0 0 0 0 7@Fort Lewis 2 7 0 4 0 0 0 0 7Chadron St. 0 0 0 0 0 0 0 0 [email protected] 0 0 0 0 0 0 0 0 0Neb-Kearney 0 0 0 0 0 0 0 0 0@Mesa St. Did not playNM Highlands 2 14 0 11 0 0 0 0 14@Western St. 3 12 0 5 0 0 0 0 12@Western NM 0 0 0 0 0 0 0 0 0TOTALS 9 41 1 11 0 0 0 0 41
CAREER STATISTICSYear RUSH YDS AVG TD LG REC YDS AVG TD LG ALLPURP2008 Redshirt2009 1 5 5.0 0 0 0 0 0.0 0 0 52010 9 41 4.6 1 11 0 0 0.0 0 0 41TOTALS 10 46 4.8 1 11 0 0 0.0 0 0 46
c.J. ROBERTS
cornerback6’0” • 180 • RFR-Rsboynton beach, Fla.santaluces community hsGeneral: Is pencilled in as the starting cornerback in 2011.
2010: Redshirted in 2010.
High School: Was an all-area selection at Santaluces Community High School in Boynton Beach, Fla. ... Was also an all-conference and all-county selection ... Also played basketball ... Coached by Darryl Drinkwater.
Personal: Has one brother, Lamar ... Real name is Earnest Roberts.DREWRODRIGUEZ
saFety6’1” • 180 • so-1lojai, caliF.noRdhoFF hs2010: Played in two games for the Pack.
2009: Redshirted in 2009.
High School: Passed for 1,600 yards with 14 touchdowns at Nordhoff High School in Ojai, Calif. ... Was an all-county
andall-leaguefirstteamselection...Addedfiverushingtouchdowns... Represented the Rangers as part of the Ventura County all-star team...WasontheVenturaCountyPressall-countyfirstteam...Was on the Honor Roll all four years of high school, graduating with a 3.4 GPA ... Coached by Tony Henney ... Also competed in baseball.
Personal: Son of Pam and Paul Rodriguez, who played football at Cal State-Northridge ... Has one older brother, Aaron, who played football at Southern Utah University ... Plans to major in biology ... Enjoyshuntingandfishing.EVANRUPPERT
linebackeR6’0” • 225 • RFR-RscoloRado spRings, colo.cheyenne mountain hs2010: Redshirted in 2010.
High School: Was a two-time all-league selection at Cheyenne Mountain High School in Colorado Springs, Colo. ...
Logged 123 tackles during his senior season, notching two picks, one sack, two fumble recoveries and two forced fumbles en route to being named the team’s defensive MVP ... Earned all-city honors as a senior ... Had 68 tackles and two sacks during his junior season ... Also played basketball ... Coached by Kris Roberts.
Personal: Son of Nancy and Warren Ruppert, who played basketball at Western State in 1979 & 1980 ... Has one younger brother, Ryan ... Enjoys playing basketball.NICKSABYE
oFFensive tackle6’6” • 240 • sR-3lphoenix, aRiz.paRadise valley hs
General: A solid special teams sub who has been with the team since the beginning.
2010: Saw action in two games for the Pack.
2009: Played in nine games for the Pack in 2009 while starting in two ... Was one of the ThunderWolves’ top reserves on the offensive line and in special teams situations.
2008: Startedtheteam’sfinalthreegamesattacklefortheThunder-Wolves ... Saw action in four games overall for the Pack.
High School: Represented Paradise Valley High School in Phoenix, AZ as a starter in the Arizona all-star game ... Was named offensive lineman of the year ... Was all-conference OT selection ... Also competedinwrestlingandtrackandfield...Wasafouryearscholar-athlete ... Earned an academic letter ... Was an active member in the RLC Church Youth Group ... Graduated in the top 15 percent of his class with a 3.52 GPA.
Personal: Son of Alice and Glenn Sabye ... Has two siblings: Jessica and Joe ... Mother, Alice, played basketball for Peru State College in Peru, NE from 1981-1984 ... Enjoys playing the saxophone, video games and reading ... Plans to graduate with a degree in engineering.
2011 RETURNERS#82
2010Academic All-Rocky Mountain Ath-letic Conference (second-team)
2009Rocky Mountain Athletic Conference Academic Honor Roll
#32
#20
#51
#76
2010Rocky Mountain Athletic Conference Academic Honor Roll
2009Rocky Mountain Athletic Conference Academic Honor Roll
33
2011 RETURNERSJOSHSANDOVAL
wide ReceiveR6’1” • 180 • so-1lPueblo, colo.east hsGeneral: A big surprise as a true fresh-man, is arguably the team’s most talented pass-catcher.
2010: Played in 10 games while starting in one... Made a huge impact as a punt returner for the Pack ranking fourth in the
RMAC in punt return average... Ranked second on the team in receiv-ing yards and receptions with 284 yards and 27 receptions... Had six receptions for 66 yards and a touchdown vs. Nebraska-Kearney on Oct. 16...Saw action in 10 games while starting in one.
High School: Was an all-state selection at Pueblo East High School in Pueblo, Colo. ... Set East records and led the state with 61 catches for 1,335 yards during senior season ... Set a Pueblo city record for most receiving yards in a season ... Was an all-city selection and first-teamall-SCLselection...Wasajuniorescort(top25ofclass),graduating with 4.0 GPA ... Coached by David Ramirez ... Also competed in basketball and track.
Personal: Son of Angela Sandoval and Eddie Pennington ... Has four siblings: Cherrelle, Michael, Blanca and Zack ... is majoring in civil engineering.SANDOVAL 2010 GAME-BY-GAMEOpponent REC YDS TD LG RUSH YDS TD LG ALLPURP@ Okla.Panhandle St. Did not playNW Okla St 2 29 0 17 0 0 0 0 29Adams St. 3 2 0 4 0 0 0 0 2@Fort Lewis 1 20 0 20 0 0 0 0 20Chadron St. 2 14 0 9 0 0 0 0 [email protected] 4 54 0 30 0 0 0 0 96Neb-Kearney 6 66 1 22 0 0 0 0 85@Mesa St. 4 45 0 12 0 0 0 0 78NM Highlands 3 38 1 17 0 0 0 0 67@Western St. 0 0 0 0 0 0 0 0 0@Western NM 2 16 0 12 0 0 0 0 16TOTALS 27 284 2 30 0 0 0 0 458
CAREER STATISTICSYear REC YDS AVG TD LG RUSH YDS AVG TD LG ALLPURP2010 27 284 10.5 2 30 0 0 0.0 0 0 458TOTALS 27 284 10.5 2 30 0 0 0.0 0 0 458
DAMONSCHIELE
inside linebackeR6’0” • 220 • jR-2laurora, colo.gateway hs
General: His speed on defense and big play ability make him a shoo-in all-conference candidate in 2011.
2010: Ranked third on the team in tackles with 60 ... Had 8 tackles and two sacks vs. Okla. Panhandle St. on Aug. 28 ... Had a season high 14 tackles vs. Chadron State on Oct. 02 ... Placed 18th in the RMAC in tackles ... Picked off three passes this season ... Started eight games while seeing action in nine for the Pack.
2009: Schiele made his way into the starting lineup four weeks into the season and held on to that spot for the remainder of the year ... Finished the 2009 season with 35 tackles including four tackles for a loss ... Reached a season-high seven tackles in two straight games vs. Chadron State on Sep. 19 and Colorado Mines Sep. 26.
2008: Redshirted 2008 season.
High School: Played for Jeff Sweet at Gateway High School in Au-rora, Colo. ... Also competed in wrestling and track for the Olympians.
Personal: Son of Laura and Duane Schiele ... Has four siblings: Dain, Dustin, Latasha and T’phani ... Brother Dustin plays football at Midland Lutheran College in Fremont, Nebr. ... Plans to major in education.SCHIELE 2010 GAME-BY-GAMEOpponent UT-AT-TOT TFL/Yd Sack/Yd INT/Yds PBU QBH FF [email protected] St. 8-2-10 2.0/8 2.0/8 1/0 1 0 0 0NW Okla.St. 1-2-3 0/0 0/0 0/0 0 0 0 0Adams St. 3-3-6 2.5/6 0/0 1/39 0 0 0 0@Fort Lewis 2-3-5 0/0 0/0 0/0 0 0 0 0Chadron St. 0-14-14 0/0 0/0 0/0 0 0 0 [email protected] 3-4-7 0/0 0/0 1/11 1 1 1 0Neb-Kearney 1-2-3 1.0/12 1.0/12 0/0 0 0 0 0@Mesa St. Did not playNM Highlands Did not play @Western St. 4-1-5 0/0 0/0 0/0 0 0 0 0@Western NM 2-5-7 0/0 0/0 0/0 0 0 0 0TOTALS 24-36-60 5.5/26 3.0/20 3/50 2 1 1 0
CAREER STATISTICSYear UT-AT-TOT TFL/Yd Sack/Yd INT/Yds PBU QBH FF FR2008 Redshirt2009 17-18-35 4.0/19 0.5/8 0/0 1 1 0 02010 24-36-60 5.5/26 3.0/20 3/50 2 1 1 0TOTALS 41-54-95 9.5/45 3.5/28 3/50 3 2 1 0
DEXTERSCOTT
nose guaRd6’0” • 242 • jR-1lRex, ga.moRRow hsga. militaRy college
General: Is great at making the big hit, especiallyintheopenfield.
2010: Had 20 tackles in 2010... Had a season high six tackles vs. NW Oklahoma
State on Sept. 04... Saw action in all 11 games.
High School: Was a 5A all-region selection while prepping at Morrow High School in Morrow, Ga. ... Competed in wrestling winning the 5A regional title two years in a row for the Mustangs ... Competed in Track and Field.
Personal: Son of Sandra and Edward Scott ..
JARED SPERBER
wide ReceiveR6’3” • 195 • sR-1loakley, kan.oakley hsgaRden city (ks) c.c.General:
2010: Ranked fourth on the team in recep-tions with 16... Saw action in all 11 games.
Junior College: Was a two-year starter at Garden City Community College in Garden City, Kan. ... Caught 15 passes for 126 yards and a touchdown as a sophomore ... Was strong as a freshman, catching 22 passes for 210 yards.
High School: Was a two-time honorable mention all-state selection at Oakley High School in Oakley, Kan. ... Was a three-time all-league selection ... Helped Oakley to a 44-5 record during his high school ca-reer, recording 20 touchdown receptions ... Was an honor roll student and National Honor Society member, carrying a 4.87 high school GPA ... Coached by Randall Ruth ... Also competed in basketball and track ... Was an all-academic team selection in both football and track.
Personal: Son of Eric and Rhonda Sperber ... Has three siblings: Chase, Aaron and Audrey ... Comes from a long line of college foot-ball players, as both brothers, Chase and Aaron, and his father, Eric, all played junior college football ... Is majoring in chemistry ... Enjoys watching movies, playing sports and hanging out with friends.SPERBER 2010 GAME-BY-GAMEOpponent REC YDS TD LG RUSH YDS TD LG ALLPURP@ Okla.Panhandle St. 3 42 0 25 0 0 0 0 42NW Okla St 2 46 0 42 0 0 0 0 46Adams St. 1 12 0 12 0 0 0 0 12@Fort Lewis 0 0 0 0 0 0 0 0 0Chadron St. 0 0 0 0 0 0 0 0 [email protected] 0 0 0 0 0 0 0 0 0Neb-Kearney 3 33 0 11 0 0 0 0 33@Mesa St. 3 34 0 20 0 0 0 0 34NM Highlands 0 0 0 0 0 0 0 0 0@Western St. 2 18 0 9 0 0 0 0 18@Western NM 2 13 0 10 0 0 0 0 13TOTALS 16 198 0 42 0 0 0 0 198
CAREER STATISTICSYear REC YDS AVG TD LG RUSH YDS AVG TD LG ALLPURP2008* 22 210 9.5 1 21 0 0 0.0 0 0 2102009* 15 126 8.4 1 25 2 -3 -1.5 0 0 1302010 16 198 12.4 0 42 0 0 0 0 0 198TOTALS 16 198 12.4 0 42 0 0 0 0 0 198* Played at Garden City (KS) C.C. (NJCAA)
#11 #22
2010National Football Foundation All-Colorado (second-team)
#50
#13
34
2011 RETURNERSMARKSTERLING
cornerback6’0” • 185 • RjR-2lcoloRado spRings, colo.sieRRa hs2010: Saw action in all 11 games. Had 2 fumble recoveries this season... Had one fumble recovery and one interception that he returned 97 yards for a touchdown vs. Fort Lewis on Sept. 25... Ranked third in
the RMAC in interception return yards.
2009: Redshirted the 2009 season.
2008: Saw action in nine games for the Pack, playing in the defensive backfieldinprimarilynickelanddimesituations...Recordedsixtackles vs. Chadron State Sept. 20 ... Finished the season with 14 tackles.
High School:Wasfirst-teamall-stateandall-conferencedefensiveback for senior performance at Sierra High School in Colorado Springs,Colo....Selectedasfirst-teamall-conferencewidereceiveras a junior ... Also competed in basketball and track ... Was an honor roll student ... Graduated with a 3.0 GPA.
Personal: Son of Patricia and Mark Sterling ... Has three siblings: Chris, Xavier and Donovan ... Enjoys drawing, spending time with family and friends, traveling, playing video games and watching movies...Lovestospendmostofhistimeonthefootballfieldorbasketball court ... Plans to major in engineering. STERLING 2010 GAME-BY-GAMEOpponent UT-AT-TOT TFL/Yd Sack/Yd INT/Yds PBU QBH FF [email protected] St. 0-0-0 0/0 0/0 0/0 0 0 0 0NW Okla.St. 0-0-0 0/0 0/0 0/0 0 0 0 1Adams St. 0-0-0 0/0 0/0 0/0 0 0 0 0@Fort Lewis 0-0-0 0/0 0/0 1/97 0 0 0 0Chadron St. 0-0-0 0/0 0/0 0/0 0 0 0 [email protected] 0-0-0 0/0 0/0 0/0 0 0 0 0Neb-Kearney 0-1-1 0/0 0/0 0/0 0 0 0 0@Mesa St. 0-0-0 0/0 0/0 0/0 0 0 0 0NM Highlands 0-0-0 0/0 0/0 0/0 1 0 0 0@Western St. 0-1-1 0/0 0/0 0/0 0 0 0 0@Western NM 0-0-0 0/0 0/0 0/0 0 0 0 1TOTALS 0-2-2 0/0 0/0 1/97 1 0 0 2
CAREER STATISTICSYear UT-AT-TOT TFL/Yd Sack/Yd INT/Yds PBU QBH FF FR2008 12-2-14 0.0/0 0.0/0 0/0 1 0 0 02009 Redshirt2010 0-2-2 0/0 0/0 1/97 1 0 0 2TOTALS 12-4-16 0.0/0 0.0/0 1/97 1 0 0 2
DREWSWARTZ
oFFensive guaRd6’4” • 280 • jR-2lgilbeRt, aRiz.gilbeRt hs
General: Will move from tackle to guard in 2011.
2010: Was an anchor of the offensive line in 2010... Selected to All-RMAC second team along with National Football Foundation All-Colorado second team... Helped the Pack to a 16th ranked rush-ing attack in the nation... Started all 11 games for a second straight season.
2009: Was arguably the top lineman on an offensive line that ushered in a Renaissance in the running game, rising from a bottom-ten unit nationally in 2008 to the 14th-ranked unit in the nation in 2009 ... Was onthefieldforeveryoffensivesnapin2009,startingall11gamesat right tackle.
High School: Started three varsity seasons at Gilbert High School in Gilbert, Ariz. ... All-east valley selection ... Honored as two-way player of the year as a Tiger ... Named defensive MVP Fiesta Region ... Recorded 20.5 career sacks ... Was an Advanced Placement and honor student ... Grauated with a 3.59 GPA.
Personal: Son of Ellen MacMillan and Mark Swartz ... Has twin sisters: Steph and Ashley ... Plans to major in business ... Spends off time working out, playing basketball and bowling. BLAKESYLVESTER
linebackeR5’10” • 200 • RFR-Rssan antonio, txsmithson valley hs2010: Redshirted in 2010.
High School: Was an all-district defen-sive end for the Smithson Valley High School in San Antonio, Texas ... Also earned all-Comal County honors for the Rangers ... Coached by Larry Hill ... Was
successful in the classroom while maintaining a 3.1 GPA and earning AcademicAll-Districthonors...Alsocompetedintrackandfield.
Personal: Son of John and Patty Sylvester ... has two siblings: Meredith and Calvin ... Plans to major in Biology ... Enjoys playing video games.TRENTTHOMPSON
tight end6’4” • 205• RFR-RsPueblo, colo.pueblo centRal hs
General: Can rise to the top of the Pack’s crop of tight ends after an impressive spring.
2010: Redshirted in 2010.
High School: Wasafirst-teamall-stateselectionatPuebloCentralHigh School in Pueblo, Colo. ... Was a two-time all-Southern League selection at tight end as well as the Southern League Defensive MVP ... Earned all-city honors twice ... Had 114 tackles during his senior campaign ... Had 44 catches for 794 yards during his junior season ... Carried a 3.8 GPA ... Coached by Dave Craddock ... Also played basketball and ran track.
Personal: Son of Kent and Kisi Thompson ... Has one brother, Tate.EMMANUELTOTTRESS
deFensive end6’3” • 230 • RjR-1laurora, colo.gateway hs2008-10: Was a member of the Thunder-Wolves’ scout team at defensive end.
High School: Was an honorable mention all-league selection at Gateway High School in Aurora, Colo. ... Helped team to the league championship in 2005 and the
quarterfinalsin2006...Alsotookpartintrackandwrestling.
Personal: Son of Jacquelyn and Emery Tottress ... Has one brother, Emery, Jr. ... Is majoring in exercise science.
R.J.TRIONE
oFFensive guaRd5’11” • 240 • Rso-1lwheat Ridge, colo.wheat Ridge hsGeneral: Will be looking to bounce back after an injury ended his 2010 season.
2010: Started two games in 2010 before ending his season with an injury.
2009: Was a consistent starter as a redshirt freshman in 2009, getting the starting nod in nine games ... Provided effective guard play on a line that improved from a bottom-ten unit nationally in 2008 to the 14th-ranked running game in the nation in 2009.
2008: Redshirted in 2008.
High School: One of the top lineman in the state of Colorado as a prep, R.J. is a two-time all-state selection by The Denver Post, and was an all-state selection by The Rocky Mountain News as a senior ...Earneddualall-conferencehonorsasasenior,earningfirst-teamhonors as both an offensive lineman and defensive lineman ... Was alsoanall-conferencefirst-teamerasajuniorin2006...HelpedWheat Ridge High School in Wheat Ridge, Colo. to the 2006 4A Colorado state football championship ... Also competed in baseball and basketball ... Helped Wheat Ridge get to the brink of a state baseballtitlein2007,finishingasthe5Astaterunner-up...Helpedhis basketball team to a conference championship, as well ... Gradu-ated with a 3.25 GPA.
Personal: Son of Kim and Ron Trione ... Has three older siblings: Nathan, Hollie and Candice ... His brother, Nathan, played football at Hastings College in 2005 ... Plans to major in physical education and becomeaP.E.teacher...Enjoysplayingsports,fishing,hunting,andhanging out with friends.JAMESVICARS
oFFensive tackle6’9” • 340 • RsR-1ltoRRance, caliF.toRRance hslos angeles haRboRGeneral: Will be competing for playing time and potentially an opportunity to start at tackle
2010: Contributed to the outstanding rushing attack of the Pack by seeing action in all 11 games on the offensive line.
2009: Redshirted the 2009 season.
College: Lead the team in pancakes while playing two years for Harbor Junior College in Wilmington, Cali. ... Blocked one kick as a Seahawk.
High School: Registered 48 pancakes and didn’t allow any sacks at Torrance High School in Torrance, Cali. ... Returned a punt for eight yards along with catching a pass for 10 yards ... Nominated as most improvedinfootball,basketballandfieldandtrack...OneoftheBlacket Award winners in basketball ... Honored as best thrower in trackandfield.
Personal: Son of Debbie and Richard Vicars ... Has one brother, Jon ... Jon joins him in the trenches at Colorado State University-Pueblo ... Majoring in socioogy ... Enjoys weight lifting, working on cars and staring at the stars.
#68
2010All-Rocky Mountain Athletic Confer-ence (second-team)National Football Foundation All-Colorado (second-team)
#37
#49
#61
#69
#12
#93
35
2011 RETURNERSETHANWARD
deFensive end6’3” • 230 • RFR-Rspueblo west, colo.pueblo west hs2010: Redshirted in 2010.
High School:Wasafirst-teamall-statedefensive end at Pueblo West High School in Pueblo West, Colo. ... Was 2008 and 2009first-teamall-conferenceselection...
Helped the Cyclones to the 2007 4A State Championship ... Coached by Monte Pinkerton ... Maintained a 3.3 GPA throughout high school.
Personal: Son of Allyn and Kathy Ward ... Has two Siblings: Peter and Sarah.
CHRISWARREN
guaRd/centeR6’2” • 265 • RjR-2lwalnut, caliF.walnut hs2010: Saw action in six games for the Pack in 2010.
2009: Played in one game in 2009 vs. Western New Mexico Oct. 31.
2008: Redshirted in 2008.
High School: Was all-area honorable mention for Walnut High School inWalnut,CA...Selectedforfirst-teamall-league...Endedcareerwith35 tackles, 1.5 sacks and 65 knockdowns ... Also ran track ... Gradu-ated with a 3.1 GPA.
Personal: Son of Betsy and Ralph Warren ... Has two older sisters: Kimberly and Teresa ... Father, Ralph, played football at Adams State College in Alamosa, Colo. from 1973-1975 ... Enjoys golf and bowling during down time ... Plans to major in sociology.
MARCIALWILLIAMSON
wide ReceiveR6’1” • 190 • RjR-1llakewood, wash.lakes hsaiR FoRce pRepGeneral: Will return in 2011 after sitting out 2010 season.
2009: Saw action in each game in 2011, catching passes in eight of 11 games ... Finished season with nine catches for
108 yards.
2008: Saw action in four games for the Pack in 2008 ... Had two receptions for nine yards vs. Mesa State Oct. 11 ... Finished the season with three catches for 22 yards.
College: Spent one year at the Air Force Academy Prep. School before coming to CSU-Pueblo.
High School:CoachedbyDaveMilleratLakesHS...Namedfirstteam All-League and second team All-Area ... Captained the team at Lakes ... Maintained a 3.5 GPA in high school.
#95 #70 #21
DONOVANBOWENS
tailback6’0” • 197 • jR.-jcaRvada, colo.pomona hssouth dakota2010 (At South Dakota): Played in all 11 games as a reserve running back and on special teams...rushed 27 times for 120 yards...averaged 4.4 yards per carry...posted a season-long carry of 22 yards...
alsomadefivetacklesonspecialteams...namedUSD’sSpecialTeams Player of the Week once during the season.
2009 (South Dakota): RedshirtedhisfirstseasonintheUSDpro-gram...named USD’s Scout Offensive Player of the Week twice and Scout Special Teams Player of the Week once during the season...selected as USD’s Offensive Scout of the Year after the season.
High School: Namedfirst-teamAll-StatebytheDenverPostin2008 while at Pomona High School in Arvada, Colo.…a two-time All-Colorado selection…a two-time All-Conference selection…also namedAll-Statein2007...finishedwith1,465rushingyardsand22touchdownsasasenior…finishedwithcareerstatsof3,272rushingyards and 43 touchdowns…averaged 8.0 yards per carry...listed as a two-star recruit by Rivals.com…also participated in track.
Personal: Son of Craig Bowens...Is a Mass Communications major.CAREER OFFENSIVE STATISTICS (SOUTH DAKOTA – NCAA FCS)Year RUSH YDS AVG TD LG REC YDS AVG TD LG ALLPURP2009 Redshirted2010 27 124 4.4 0 22 0 0 0.0 0 0 120TOTALS 27 124 4.4 0 22 0 0 0.0 0 0 120
FRANEXDORT
cornerback5’11” • 176 • jR.-jclake woRth, Fla. santaluces hsmt. san jacinto (ca) jcJunior College: Played for two seasons at Mt. San Jacinto Junior College in California ... Made the President’s list for academics.
High School: While playing for Santaluces High School in Lake Worth, Fla., rushed for over 800 yards and had two interceptions for theChiefs...GarneredfirstteamAll-ConferenceandsecondteamAll-State ... Coached by Mike Drinkwater.
Personal: Is the son of Ismaelle and Fanor Dort ... Has four siblings: Islande, Phanel, Fradlet, and Ashley.CAREER DEFENSIVE STATISTICS (MT. SAN JACINTO – CCCAA)Year UT-AT-TOT TFL/Yd Sack/Yd INT/Yds PBU QBH FF FR2009 4-0-4 1.0/11 0/0 0/0 0 0 0 02010 0-0-0 0.0/0 0/0 0/0 0 0 0 0TOTALS 4-0-4 1.0/11 0/0 0/0 0 0 0 0
CAREER OFFENSIVE STATISTICS (MT. SAN JACINTO – CCCAA)Year RUSH YDS AVG TD LG REC YDS AVG TD LG ALLPURP2009 155 781 5.0 6 38 3 18 6.0 0 10 8682010 212 1261 5.9 14 66 11 36 3.3 0 11 1292TOTALS 367 2042 5.6 20 66 14 54 3.9 0 11 2160
JUSTINJACKSON
Running back5’8” • 225 • jR-jcpueblo west, colo.gaRden city (ks) c.c.General: His combination of side and speed make him a prime candidate for time at tailback behind Jesse Lewis and Jamaal Johnson.
Junior College: Attended Garden City Community College in Garden City, Kan.
for two seasons.
High School: Was on the 2007 Colorado state championship team at Pueblo West High School in Pueblo, Colo. ... Was an all-state performer for the Cyclones ... Coached by Monte Pinkerton ... Also played basketball.
Personal: Son of Sylvester and Tamera Jackson ... Has three siblings: Lachelle, Brandon and Derek.
COYLETLOW
saFety6’0” • 202 • jR.-tRhayden, colo.hayden hsnoRtheRn coloRadoCollege: Was a member of the University of Northern Colorado team from 2009-10 season
High School: From Hayden, Colorado...While at Hayden HS, was recognized as All-Conference and All-State for 3 years...rushed for over 4,000 yds at Hatden HS...Led team to 3 State playoff appearances. Was coached by Shawn Baumgartner.
Personal: Son of Angela and Mike Letlow. Is the older brother of Treyben Letlow, also a member of the Pack football team. Is an exercise science major.ANTHONYMARSHALL
deFensive end6’3” • 205 • jR.-jcsan FRancisco, caliF.geoRge washington hs laney (ca) collegeCollege: Is a transfer from Laney College in Oakland, California. Was selected as linebacker of the year in 2010. Led the defense in sacks both his freshman and sophopmore years. Was named to the
All-Conference team twice.
High School: Attended George Washington HS in San Franciso, CA. Was named All-Metro and Top 5 Athlete in 2006. Was 3 time wide receiver of the year for the Eagles. Also participated in wrestling and track.
Personal: Is the son of Wanda and Craig Marshall. Great uncle Ollie Matson, is a NFL Hall of Famer and two time Olympic medalist in 1952.CAREER STATISTICS (LANEY COLLEGE - CCCAA)Year UT-AT-TOT TFL/Yd Sack/Yd INT/Yds PBU QBH FF FR2009 13-6-19 5.5/23 4/21 0/0 1 1 0 12008 8-3-11 2.0/8 3/13 0/0 1 0 0 1TOTALS 21-9-30 7.5/31 7/34 0/0 2 1 0 2
2011 TRANSFERS#27 #23
#39
#94
36
D.J.MORMON
linebackeR6’0” • 225 • jR.-tRcoloRado spRings, colo. haRRison hs valley city state (nd)General: His speed makes him a great option at inside linebacker.
College: Played in spot duty for two seasons at Valley City State University in North Dakota.
High School:Wasafirst-teamall-stateselectionatHarrisonHighSchool in Colorado Springs, Colo. ... Logged over 350 tackles during high school career, including 181 during senior campaign and 133 during junior year ... Also a receiver, was sixth in the city of Colorado Springs in receiving yards ... Earned all-area honors in back-to-back seasons and was a three-time all-conference selection ... Also played basketball and ran track ... Coached by Al Melo.
Personal: Son of Tinsley and Deanna Morman ... Has four siblings: Asheley, Andrea, Michael and Anna-Lisa ... Is majoring in business.CAREER STATISTICS (VALLEY CITY STATE - NAIA)Year UT-AT-TOT TFL/Yd Sack/Yd INT/Yds PBU QBH FF FR2009 8-9-17 0.0/0 0.0/0 0/0 N/A N/A N/A N/A2010 2-7-9 1.0/4 1.0/4 0/0 N/A N/A N/A N/ATOTALS 10-16-26 1.0/4 1.0/4 0/0 N/A N/A N/A N/A
COREYORTH
deFensive end6’5” • 255 • jR.-tRbuena vista, colo. buena vista hs wyoming/easteRn aRiz.General: Is expected to be an immediate starter on the defensive line in 2011.
At Eastern Arizona College (2010): Was afirst-teamAll-Arizonaselection...Was
alsoafirstteamall-WesternStatesselection.
At Wyoming (2009): Played in nine games as a redshirt-freshman withFBSUniversityofWyoming...Loggedfivetacklesandafumblerecovery.
At Wyoming (2008): Redshirted. Orth graduated early from Buena Vista High School in Buena Vista, Colo., and enrolled in classes at the University of Wyoming in January 2008 to get a head start on the 2008 season. He participated in `08 spring drills.
High School: Following his senior year at Buena Vista High School, he was selected as a 2A All-State defensive lineman by both the Rocky Mountain News and Denver Post. As a junior, he was an Hon-orable Mention All-State selection, earned All-Conference accolades and was selected as his conference’s defensive MVP. He recorded 100 tackles, 12 sacks and three fumble recoveries as a junior. As a senior, he made 140 tackles, 121 of which were solo tackles. He also had16sacks,recoveredninefumblesandblockedsixfieldgoalsand four punts. He was chosen to participate in the 2008 Colorado Coaches All-State Game which was held in the summer of 2008 in Greeley, Colo. His high school coach was Robert Marken. He was also recruited by Colorado, Colorado State and Kansas State.
Personal: Born Feb. 14, 1990, he is the son of Tammy and Ken Orth. He is majoring in criminal justice.CAREER STATISTICSYear UT-AT-TOT TFL/Yd Sack/Yd INT/Yds PBU QBH FF FR2008* Sat out season as redshirt2009* 2-3-5 0.0/0 0.0 0/0 0 0 0 12010** 24-9-33 N/A 6.0 0/0 N/A N/A 0 0
* At University of Wyoming (NCAA FBS) ** At Eastern Arizona College (ACCAC)
BUSTERTHEDE
inside linebackeR6’0” • 210 • jR.-tRaRvada, colo.pomona hswesteRn new mexicoGeneral: Provides depth and experience at the inside linebacker spot, tutoring under preseason All-American, Lee Meisner.
College: Played for two seasons for RMAC foe, Western New Mexico ... Took an interception 57 yards for a touchdown against Chadron State in 2008 ... Was third on the team in tackles as a sophomore (53) and second on the squad as a freshman (65).
High School: Prepped at Pomona High School in Arvada, Colo. ... Was a two-time all-conference selection ... Coached by Jay Madden.
Personal: Son of Lisa and Joe Thede ... Has two older siblings: Laura and John ... Is majoring in business.CAREER STATISTICS (WESTERN NEW MEXICO - NCAA-II)Year UT-AT-TOT TFL/Yd Sack/Yd INT/Yds PBU QBH FF FR2008 42-23-65 9.5/37 1.0/8 0/0 0 3 1 02009 22-31-53 6.0/18 0.5/6 1/49 2 0 0 0TOTALS 64-54-118 15.5/55 1.5/14 1/49 2 3 1 0
2011 TRANSFERS#55 #30
37
2011 FRESHMENDARIUS ALLENdeF. lineman • 6’0” • 200pueblo, colo. (east)Was the South Central League Defensive Line MVP at Pueblo East High School in Pueblo, Colo.
CHRIS ASHEtailback • 6’1” • 190coloRado spRings, colo. (wideField)Wasanall-stateselectionatWidefieldHighSchoolinWidefield,Colo....Ranfor2,143yards as a senior, scoring 29 touchdowns ... Earned all-area and all-conference honors ...
Was an honorable mention academic all-state selection with a 3.35 GPA ... Coached by Fred Marjerrison ... Also played basketball and was on the track team.
PATRICK BARNESoFFensive lineman6’3” • 285san diego, caliF. (toRRey pines)Was an all-league selection at Torrey Pines High School in San Diego, Calif. ... Was once named the TPHS Falcon of the Week and
Offensive Player of the Week ... Coached by Scott Ashby.WES BENNETTlinebackeR • 6’2” • 185longmont, colo. (longmont chRistian)Was a running back and linebacker for Longmont Christian High School in Longmont, Colo. ... Earned Class A-8 Man all-state honors by The Denver Post.
MATT BIERYsaFety • 6’2” • 185kiowa, colo. (elizabeth)Was an all-state running back at Elizabeth High School in Kiowa, Colo. ... Helped lead Elizabeth to 3A state championship ... Played on both sides of the ball as starting defensive back during his junior season, then as starting
tailback as a senior ... Was a two-time CHSAA Academic All-State selection ... Was a four-year letterman ... Graduated with a 4.0 GPA ... Also played basketball, baseball and ran track ... Coached by Chris Cline.
TONY CAMPTONdeFensive lineman6’0” • 270littleton, colo. (columbine)Was an all-state selection at Columbine High School in Littleton, Colo ... Was a two-time all-conference selection ... Was a three-year
letterman at Columbine ... Helped Columbine to a 10-2 record ... Logged 75 tackles during senior season ... Also competed in wrestling and track ... Holds the junior squad record at 515 pounds.
KEVIN CUFFlinebackeR • 6’0” • 215toRRey pines, caliF. (toR-Rey pines)Wasafirst-teamAll-CIFselectionatTorreyPines High School in Torrey Pines, Calif. ... Named the Palomar League Defensive Player of the Year ... During his senior season,
had106tackles,foursacks,fourfumblerecoveriesandfiveforcedfumbles ... Also had 650 rushing yards and 12 touchdowns during se-nior season ... Added 98 tackles during junior season ... Coached by Scott Ashby ... Graduated with a 3.7 GPA ... Also played basketball.
GARY DIXONoFF. lineman • 6’3” • 280Fontana, caliF. (summit)Was an all-CIF-Southern Section selection at Summit High School in Fontana, Calif. ... Was also an all-area selection.
BEN ESTICAlinebackeR • 6’1” • 196palm beach, Fla. (santa-luces)Was a two-time all-conference selection at Santaluces High School in Lantuna, Fla. ... Was named his team’s defensive MVP ... Was an honor student, earning honors in U.S. Gov-
ernment, Economics and advanced topics in math ... Also wreslted at Santaluces ... Coached by Daryl Drinkwater.
ALEX FENLONFullback • 6’0” • 200woodland paRk, colo. (woodland paRk)Was an honorable mention all-conference selection as a junior and senior at Woodland Park High School in Woodland Park, Colo. ... Was a four-year football letterman, three-year
baseball letterman and two-year track letterman ... Excelled as a two-way player, earning the team’s defensive player of the year honor as a junior and offensive player of the year as a senior.
TUFF GIBSONlinebackeR • 6’0” • 195meRino, colo. (meRino)Was a two-time all-state selection as a senior at Merino High School in Merino, Colo. ... Was also a state runner-up wrestler at Merino ... Earned three all-conference football honors ... Also played baseball in addition to wrestling
and football at Merino ... Was active in FFA, FBLA and FCCLA at Merino.
DOMINIQUE GRIMESdeF. back • 5’8” • 165nashville, tenn. (east liteRatuRe)Prepped at East Literature High School in Nashville, Tenn. ... Logged over 1,000 all-purpose yards and scored 14 touchdowns ...
Also had six interceptions.AUSTIN HUFFwide ReceiveR • 6’1” • 170aurora, colo. (cheRokee tRail)Caught 20 passes for 347 yards during senior season at Cherokee Trail High School in Aurora, Colo. ... Helped lead Cherokee Trail to the5Astatequarterfinalsandaleaguetitle...Averaged 17.4 yards per catch.MARIO KINOSHITAcenteR • 6’0” • 230san antonio, tex. (bRandeis)Was a three-time all-district selection at Bran-deis High School in San Antonio, Tex. ... Owns school record for 12 pancakes in one game ... Coached by John Campbell ... Also ran track
... Graduated with a 3.2 GPA.
JUSTIN LABORDEdeFensive end • 6’0” • 215pueblo west, colo. (pueblo west)Was an all-state selection at Pueblo West High School in Pueblo West, Colo. ... Also named all-city and team MVP ... Coached by Monte Pinkerton ... Also wrestled and ran
track ... Graduated with 3.1 GPA.TREYBEN LETLOWtight end • 6’4” • 225hayden, colo. (hayden)Wasatwo-timefirst-teamall-stateselectionat Hayden High School in Hayden, Colo. ... Earned two all-conference honors, and was the 2010 all-conference punter and MVP ... Also an all-conference wrestler for three
seasons, he was the 2010 215-pound 2A state champion ... Logged the most tackles in a single season in Hayden history with 181 ... Also scored 10 touchdowns as a senior ... Has the most all-state honors among Hayden student-athletes in school history ... Also participated in track ... Coached by Shawn Baumgartner.
ZACK MARTINEZoFFensive lineman6’4” • 254Redlands, caliF. (Redlands east valley)Wasafirst-teamall-leagueselectionatRed-lands East Valley High School in Redlands, Calif. ... Was a scholar-athlete and an honor
roll student ... Graduated with a 3.5 GPA ... Coached by Kurt Bruich with the Wildcats.
J.b. MATHEWStailback • 5’11” • 178auRoRa, colo. (Rangeview)Was an all-state honorable mention selection at Rangeview High School in Aurora, Colo. ... Was an all-conference selection as a senior ... Named the team’s offensive MVP as a junior ... Had 1,394 yards on 231 carries as a junior,
scoring 14 touchdowns ... Ran for 1,464 yards on 164 attempts as a senior, scoring 24 touchdowns ... Coached by Dave Gonzales ... Also ran track.
BRODE MCDONALDQuaRteRback • 6’0” • 200FoRt collins, colo. (Rocky mountain)Was an honorable mention all-state selection as a senior at Rocky Mountain High School in Fort Collins, Colo. ... Was a two-time all-conference selection ... Helped the Lobos
to two conference championships ... Finished his career with about 3,000 yards passing, 25 touchdown passes and seven interceptions, and 1,800 rushing yards and six rushing touchdowns ... Was a three-time academic all-state selection ... A four-year member of the honor roll ... Graduated with a 3.68 GPA ... Coached by Mark Brook ... Also competed in basketball, track and baseball ... Was active in Link Crew, choir, Key Club, and calculus club.
38
RONELL MCNEALcoRneRback • 5’9” • 165auRoRa, colo. (pRaiRie view)Was an honorable mention all-conference selection at Prairie View High School in Aurora, Colo. ... Was a multiple threat in high school, rushing for over 500 yards, logging over 800
receiving yards, and passing for over 1,100 yards while also averaging four tackles per game as a defensive back ... Was named his team’s MVP and team captain in football, as well as basketball ... Was a first-teamall-conferencebasketballstandoutatPrairieView...Wasnamed a national academic player of the month selection in March 2008 ... Was also an honor roll and academic all-conference selection at Prairie View.
GREG O’DONNEllkickeR • 6’0” • 158monument, colo. (st. maRy’s)Was an all-state selection at St. Mary’s High School in Colorado Springs, Colo. ... Hit all of hisPATattemptsandwas8-for-12onfieldgoalattempts during senior season ... Had a long
fieldgoalof48yards...Recorded27kickoffsfortouchbacks...Wasan all-city and all-conference selection ... Also played baseball.
KEVIN PARKSdeF. back • 5’10” • 178Fountain, colo. (Fountain-Ft. caRson)Was selected as All-Area, Peak Performer, and All-Conference for the Fountain-Fort Carson Trojans, in Fountain, Colo... His 86 tackles, 6 interceptions, and 432 yds on punt returns
for 4 touchdowns helped lead the team to the 2011 Conference Championship... Was on the principals honor roll... Was coached by Mitch Johnson.
JARRED RADEBAUGHQuaRteRback • 6’0” • 185tHornton, colo. (noRthglenn)Was a two-time all-conference selection at Northglenn High School in Thornton, Colo. ... Was a two-time team MVP ... Accumulated 3,000 yards of total offense in one season
(2,007 yards passing, 1,165 yards rushing), becoming just third player in Northglenn history to pass and run for 1,000 yards in a season ... Was named the North Metro Regional Player of the Year ... Coached by Scott Gallas ... Also ran track and played basketball.
JEFF RICHARDSlinebackeR • 6’00” • 210pueblo, colo. (south)Was an All-Conference selection for the Pueblo South Colts his junior season...was member of the Division championship team in 2010.
JOE ROSENBROCKlinebackeR • 5’10” • 185bRush, colo. (bRush)Was an all-state selection at Brush High School in Brush, Colo. Helped lead the Beetdiggers to two League Championships and State runner-ups in 2010. Selected All-Conference and All-State. Graduated class salutatorian. Was
coached by Randy Drietz.
PAT SMITHguaRd • 6’3” • 275pueblo, colo. (east)Wasafirst-teamall-stateselectionatPuebloEast High School in Pueblo, Colo. ... Was an all-conference lineman selection and participated in the all-state game ... Also a wrestler, was a two-time all-state selection and
holds East’s all-time pin record ... Coached by David Ramirez ... Also participated in track.
bRYSON ‘KANA’ SOUZAQuaRteRback • 5’11” • 180maui, hawaii (kamehameha maui)Prepped at Kamehameha Maui High School in Maui, Hawaii.NIK SPINUZZIquarterback5’11” • 180pueblo, colo. (south)Wasafirst-teamall-conferenceselectionatPueblo South High School in Pueblo, Colo. ... Coached by Mark Haering and Ryan Goddard ... Carried a 3.5 GPA.JORDEN ST. lOUISdeFensive back5’11” • 175lantuna, Fla. (santaluces)Wasafirst-teamall-conferenceselectionatSantaluces High School in Lantuna, Fla. ... Coached by Darryl Drinkwater.TYRELL STRICKLANDcoRneRback • 6’1” • 180FoRt woRth, tex. (Rich-land)Was an All-District selection senior season for the Richland HS in Fort Worth, Tex... During his senior season he made 47 tackles and had 1 interception. Was also a member of the
Trackandfieldteam...WascoachedbyEugeneWeir...TIVA TATOFIlinebackeR • 6’0” • 205kaneohe, hawaii (kamehameha)Helped lead Kamehameha High School to a Hawaii state title ... was an honorable mention all-conference selection ... Recorded 72 tackles, two forced fumbles, two interceptions,
14 tackles for loss and seven sacks ... Coached by David Stant ... Also participated in golf ... Carried a 3.0 GPA.
JARRED THOMPSONdeFensive back5’10” • 165bRighton, colo. (pRaiRie view)Was an all-conference selection at Prairie View High School in Aurora, Colo. ... Had 96 tackles during his senior season ... Was named
Academic All-Conference, carrying a 3.25 GPA ... Also ran track and played basketball ... Coached by Rocky Schneider.
KEANU TRUJILLOoFF. lineman • 6’2” • 260Raton, n.m. (Raton)Earned All-District, All-State, All-North Region as an Offensive Lineman ... Selected to the All-Star (North Squad) and was captain ... Senior captain in high schoool ... Coached by Brock Walton ... Football team were 2-time district champs.DESMOND TURNER-GONZALESdeF. back • 5’10” • 185denveR, colo. (gateway)Was a member of the 2005 Conference Champion Gateway Olympians...Received All-Conference honorable mention... Recognized as one of the Mile High scholars... Participated
in basketball, track and rugby... Was coached by Jeff Sweet.JOHN VELAtailback • 5’7” • 160pueblo, colo. (centennial)Was the two-time conference offensive player of the year at Centennial High School in Pueblo, Colo. ... Set numerous school records at Centennial, rushing for a record 1,916 yards and 25 touchdowns as a junior ... added 1,700
and 17 touchdowns as senior in only seven games played ... His rushing marks broke Pueblo high school city records ... Earned three all-conference honors ... Was an honor roll student, holding a 4.0 GPA ... Coached by Mike Palumbo ... Also ran track.
AUSTIN WARRENdeFensive end6’2” • 235lubbock, tex. (monteRey)Was an All-South Plains selection at Monterey High School in Lubbock, Tex. ... Played both defensive end and fullback.RILEY WHITEsaFety6’1” • 205castle Rock, colo. (douglas county)Was a member of the State Championship teams at Douglas County HS in Castle Rock, Colo. Earned All-Conference distinction as
a linebacker.TOMAS ZEPEDAlinebackeR • 6’1” • 225denveR, colo. (geoRge washington)Prepped at George Washington High School in Denver, Colo. ... Played multiple defensive positions as well as fullback.
2011 FRESHMEN
39
2011 OPPONENTS WEST TEXAS A&M
NORTHWEST OKLAHOMA STATE ADAMS STATE
FORT LEWISPAGE 40
CHADRON STATE COLORADO SCHOOL OF MINES
UNIVERSITY OF NEBRASKA-KEARNEY MESA STATE
PAGE 41NEW MEXICO HIGHLANDS
WESTERN STATE WESTERN NEW MEXICO
OPPONENT SID CONTACTSPAGE 42
40
GAME 1
WEST TEXAS A&MBUFFALOES
School: West Texas A&MLocation: Canyon, TX 79016 Founded: 1910Enrollment: 7,843Nickname: BuffaloesSchool Colors: Maroon and White Stadium: Kimbrough Memorial StadiumStadium Capacity: 20,000Affiliation: NCAA IIConference: Lone Star ConferencePresident: Dr. J. Patrick O’BrienAthletics Director: Michael McBroom2010 Overall Record (Conference Record): 8-4 (8-2) Head Coach: Don Carthel (Eastern New Mexico, ‘74)Record at OPSU: 59-16 (6th season) Overall Record: 105-62-1Assistant Coaches: Colby Carthel (DC),
Billy Best (Assoc.HC/OL), Nick Paremski (Assoc.HC/DB),Derrick Homer (RB), Joel Hinton (WR), Devario Dorsey (OL),
Matt Landers & Wendell Davis (ILB), Jared May (QB), Brandon Romero (DL), Eric White (SP), Brandon Smith (OLB),
Bo Bryant & Arseel Shakur (DB), John Whitefield (LB)Offensive Starters Returning: 5Defensive Starters Returning: 8
GAME 2
NORTHWESTERN OKLAHOMA STATE
RANGERS
School: Northwestern Oklahoma StateLocation: Alva, OKFounded: 1897Enrollment: 2,233Nickname: RangersSchool Colors: Red and BlackStadium: Ranger FieldStadium Capacity: 6,000Affiliation: NAIAConference: Central States LeaguePresident: Dr. Janet Cunningham Northwestern Oklahoma St., 1976Athletics Director: Bob Battisti Minnesota State-Mankato, 1981
2010 Overall Record: 8-3 2010 Conference Record: 5-0 (N/A, CSFL)Head Coach: Keith Barefield Evangel (MO), 1978Record at NWOSU: 30-14 (5th season) Overall Record: 96-47-2 (14 seasons)Assistant Coaches: Chad
Adams (DC), Justin Iske (OL), Matt Brand, Josh Cheek, Kyle Culwell, Waleed Gaines, Robbie Gaskill, Kyle Koricanek, Shane Lewis, Marcus
Mead, Mike Skvor, Kevin McDonald, Offensive Starters Returning: N/ADefensive Starters Returning: N/A
GAME 3
ADAMS STATE COLLEGE
GRIZZLIES
School: Adams State CollegeLocation: Alamosa, CO, 81102Founded: 1921Enrollment: 3,421Nickname: GrizzliesSchool Colors: Green & WhiteStadium: Rex FieldStadium Capacity: 6,000Affiliation: NCAA IIConference: Rocky MountainPresident: Dr. David Svaldi Northern Colorado, 1970 Athletics Director: Larry Mortensen Adams State, 1988
2010 Overall Record: 5-6 2010 Conference Record/Finish: 4-5 (5th)Head Coach: Marty Heaton Adams State, 1982Record at ASC: 10-12 (3rd season)Overall Record: 10-12 (2 seasons)Assistant Coaches: Manny Wasinger (OC),
Nic Pasquale (WRs), Ernesto Villasenor (DL),Aaron Tuioti-Mariner (RB) Brandon Alconcel (OL),
George Holley (DB’s)Offensive Starters Returning: 8Defensive Starters Returning: 5
GAME 4 (Homecoming)
FORT LEWIS COLLEGE
SKYHAWKS
School: Fort Lewis CollegeLocation: Durango, CO, 81301Founded: 1911Enrollment: 3,685Nickname: SkyhawksSchool Colors: Navy, Light Blue & GoldStadium: Ray Dennison Memorial FieldStadium Capacity: 4,000Affiliation: NCAA IIConference: Rocky MountainPresident: Dr. Dene Kay Thomas SW Minnesota StateAthletics Director: Kelly Higgins South Dakota, 1981
2010 Overall Record: 3-7 2010 Conference Record/Finish: 3-6 (7th)Head Coach: Cesar Rivas-Sandoval UC-Davis, 2000 Record at FLC: 3-7 (2nd season)Overall Record: 3-7 Assistant Coaches: Ben Cullen (DC,DL),
Matt Steinfeldt (OC, QB), Dave Varnell (SP, RB), Brad Wilson (OL), Mark Meng (LB), Ryan Scherling (WR),
Doug Brady (TE)Offensive Starters Returning: 8Defensive Starters Returning: 6
WEST TEXAS A&M2011 SCHEDULE
Sept.1 CSU-PUEBLO 6 p.m. CSTSep. 17 Texas A&M - Kingsville* 8 p.m. CST (at Cowboys Stadium - Arlington, TX)Sep. 24 INCARNATE WORD (TX)* 6 p.m. CSTOct.1 at Tarleton St. (TX)* 7 p.m. CSTOct. 8 ANGELO ST. (TX)* 6 p.m. CSTOct. 15 at Abilene Christian (TX)* 2 p.m. CSTOct. 22 EASTERN NEW MEXICO 6 p.m. CSTOct. 29 CENTRAL WASHINGTON 6 p.m. CSTNov. 5 at Midwestern State (TX)* 2 p.m. CSTNov. 12 TEXAS A&M - COMMERCE 1 p.m. CST* Lone Star Conference South Division game
WEST TEXAS A&M2010 RESULTS
(2010 Record: 8-4; 8-2 LSC [South])Sep. 2 at #2 - Grand Valley St. (MI) L, 31-34Sep. 11 at SW Okla. St. W, 77-14Sep. 18 SE OKLA. ST. W, 41-17Sep. 25 at Angelo St. (TX)* W, 37-27Oct. 2 at Northeastern St. (OK)* W, 34-22Oct. 9 TARLETON ST.* W, 48-17Oct. 16 at #9 - Texas A&M - Kingsville* L, 24-28Oct. 23 #13 - MIDWESTERN ST. (TX)* W, 42-29Oct. 30 at Incarnate Word (TX)* W, 49-10Nov. 6 #2 - ABILENE CHRISTIAN (TX)* L, 34-41Nov. 13 EAST CENTRAL (OK) W, 52-21Nov.20 ! at #12 Central Missouri L, 35-55* Lonestar Conference South Division game! NCAA Division II Playoffs
2011 OPPONENTS
Sept. 1, 2011 • 6 p.m. CSTKIMBROUGH MEMORIAL STADIUM
CANYON, TEX.
LIVE VIDEO http://www.gobuffsgo.com/showcase
LIVE AUDIO CSU-Pueblo Radio: 590-AM in Pueblo and streaming live at GoThunderWolves.com
NORTHWEST OKLAHOMA ST.2011 SCHEDULE
Sep. 1 SOUTHWESTERN OKLA. ST. 7 p.m CSTSep. 10 at CSU-Pueblo 6 p.m. MSTSep. 17 at South Dakota 4 p.m CSTSep. 24 at Texas College* 2 p.m. CST Oct. 1 MISSOURI S&T 3 p.m. CST Oct. 8 SOUTHERN NAZARENE* 2 p.m. CSTOct. 15 at Bacone (OK)* 2 p.m. CSTOct. 22 LANGSTON (OK)* 2 p.m. CSTOct. 29 SW ASSEMBLIES (TX)* 2 p.m. CSTNov. 5 OKLA. PANHANDLE 2 p.m CST* Central States Football League game
NORTHWEST OKLAHOMA ST.2010 RESULTS
(2010 Record: 8-3; 5-0 CSFL)Sep. 4 at CSU-Pueblo L, 13-55Sep. 18 at South Dakota L, 14-48Sep. 25 TEXAS COLLEGE* W, 79-20Oct.1 at Missouri S&T W, 43-14Oct. 9 at Southern Nazerene* W, 62-42Oct. 16 BACONE (OK)* W, 51-14Oct. 23 at Langston (OK)* W, 20-13Oct. 30 at SW Assemblies (TX)* W, 44-7Nov. 6 OKLA. PANHANDLE ST. W, 31-7Nov. 13 SOUTHERN OREGON W, 31-26Nov. 20 at Sioux Falls (SD) L, 14-33* Central States Football League game
Sept. 10, 2011 • 6 p.m. MSTNETA & EDDIE DEROSE THUNDERBOWL
PUEBLO, COLO.
LIVE VIDEO Streaming Live on America One Networks
LIVE AUDIO CSU-Pueblo Radio: 590-AM in Pueblo and streaming live at GoThunderWolves.com
ADAMS STATE2011 SCHEDULE
Sep. 3 at Dixie St. (UT) 6 p.m. MSTSep. 10 at Black Hills St. (SD) 1 p.m. MSTSep. 17 CSU-PUEBLO* 7 p.m. MSTSep. 24 at Chadron State* 12 p.m. MSTOct. 1 NEBRASKA-KEARNEY* 1 p.m. MSTOct. 8 at N.M. Highlands* 6 p.m. MSTOct. 15 WESTERN N.M.* 1 p.m. MSTOct. 22 at Fort Lewis* TBAOct. 29 COLORADO MINES* 1 p.m. MSTNov. 5 at Mesa State* 12 p.m. MSTNov. 12 WESTERN STATE* 1 p.m. MST* Rocky Mountain Athletic Conference game
ADAMS STATE2010 RESULTS
(2010 Record: 5-6; 4-5 RMAC)Aug. 28 DIXIE STATE (UT) W, 34-14Sep. 4 at Northern Colorado L, 0-54Sep. 18 * at CSU-Pueblo L, 10-27Sep. 25 * CHADRON STATE L, 10-21Oct. 2 * at #17 Nebraska-Kearney L, 17-27Oct. 9 * N.M. HIGHLANDS W, 55-0Oct. 16 * at Western New Mexico W, 14-10Oct. 23 * FORT LEWIS L, 7-14Oct. 30 * at #16 Colorado Mines L, 17-24Nov. 6 * MESA STATE W, 41-34 (2 OT)Nov. 13 * at Western State W, 28-19 * Rocky Mountain Athletic Conference game
Sept. 17, 2011 • 7 p.m. MSTREX FIELD
aLaMOSa, COLO.
LIVE VIDEO Streaming Live on America One Networks
LIVE AUDIO CSU-Pueblo Radio: 590-AM in Pueblo and streaming live at GoThunderWolves.com
FORT LEWIS2011 SCHEDULE
Sep. 3 SOUTH DAKOTA MINES 1 p.m. MSTSep. 10 at Northern Arizona 3:05 p.m. MSTSep. 17 WESTERN N.M.* 1 p.m. MSTSep. 24 at CSU-Pueblo* 6 p.m. MSTOct. 1 at Colorado Mines* 12 p.m. MSTOct. 8 MESA STATE* 1 p.m. MSTOct. 15 at WESTERN STATE* 1 p.m. MSTOct. 22 ADAMS STATE* 1 p.m. MSTOct.29 at Chadron State* TBANov. 5 NEBRASKA-KEARNEY* 1 p.m. MSTNov. 12 at N.M. Highlands TBA* Rocky Mountain Athletic Conference game
FORT LEWIS2010 RESULTS
(2010 Record: 3-7; 3-6 RMAC)Sept. 4 at Montana St. L, 10-59Sept. 18 at Western N.M.* W, 30-27Sep. 25 * CSU-PUEBLO L, 14-49 Oct. 2 * COLORADO MINES L, 28-38 Oct. 9 * at Mesa State L, 14-31 Oct. 16 * WESTERN STATE L, 24-27 OTOct. 23 * at Adams State W, 14-7Oct. 30 * CHADRON STATE L, 7-38Nov. 6 * at Nebraska-Kearney L, 21-48Nov.13 * N.M. HIGHLANDS W, 36-13* Rocky Mountain Athletic Conference game
Sept. 24, 2011 • 6 p.m. MSTNETA & EDDIE DEROSE THUNDERBOWL
PUEBLO, COLO.
LIVE VIDEO Streaming Live on America One Networks
LIVE AUDIO CSU-Pueblo Radio: 590-AM in Pueblo and streaming live at GoThunderWolves.com
41
2011 OPPONENTSGAME 5
CHADRON STATE COLLEGE EAGLES
School: Chadron State College Location: Chadron, NE, 69337Founded: 1911Enrollment: 2,800Nickname: EaglesSchool Colors: Cardinal and WhiteStadium: Elliott Field at Don Beebe StadiumStadium Capacity: 3,800Affiliation: NCAA IIConference: Rocky MountainPresident: Dr. Janie C. Park Athletics Director: Brad Smith
2010 Overall Record: 8-3 2010 Conference Record/Finish: 7-2 (4th)Head Coach: Bill O’Boyle Western Illinois, 1987Record at CSC: 46-13 (5th season) Overall Record: 46-13 (4 seasons)Assistant Coaches: Todd Auer (DC), Chris
Stein (QBs), Craig Jersild (DB), Jack Hiett (DL), Shawn Eisenreich (WR), Jeff Wilkerson (WR), Scott Phaydavong (RB),
Gino Polastri (DL), Chase Olsen (OL), Tanner Tetrault (DB), Ben Martin (LB)
Offensive Starters Returning: 9Defensive Starters Returning: 4
GAME 6
COLORADO SCHOOL OF MINES
OREDIGGERS
School: Colorado School of Mines Location: Golden, CO, 80401Founded: 1874Enrollment: 4,800Nickname: OrediggersSchool Colors: Silver and BlueStadium: Campbell FieldStadium Capacity: 4,000Affiliation: NCAA IIConference: Rocky MountainPresident: Dr. Myles W. (Bill) Scoggins University of Tulsa, 1972 Athletics Director: Tom Spicer Fort Hays State, 19722010 Overall Record: 9-3 2010 Conference Record/Finish: 8-1 (T-1st)Head Coach: Bob Stitt Doane College, 1986Record at CSM: 76-49 (12th season) Overall Record: 76-49 (11 seasons)Assistant Coaches: Bob Benson (DC & DB),
Satyen Bhakta (DL), Scott Carey (OL), Bob Bodor (ST), Clement Grinstead (RB), Adam Long (ILB),
Nolan Swett (WR)Offensive Starters Returning: 10Defensive Starters Returning: 7
GAME 7
UNIVERSITY OF NEBRASKA-KEARNEY
LOPERS
School: University of Nebraska at KearneyLocation: Kearney, NE, 68849Founded: 1905Enrollment: 6,753Nickname: Antelopes (Lopers)School Colors: Royal Blue & Old GoldStadium: Ron & Carol Cope Stadium at Foster FieldStadium Capacity: 5,500Affiliation: NCAA IIConference: Rocky MountainChancellor: Doug Kristensen (Drake, 1980) Athletics Director: Jon McBride
2010 Overall Record: 9-2 2010 Conference Record/Finish: 8-1 (T-1st)Head Coach: Darrell Morris N.W. Missouri State, 1983Record at UNK: 82-37 (12th season) Overall Record: 82-37 (11 seasons)Assistant Coaches: Russ Martin (OC & QBs),
Bob Crocker (DC & DBs), Matt Martin (ILBs), Tom Everson (DLs), Scott Hoffman (WR), Chad Bauder (ILBs),
Mike Medina (OLBs), Travis Wegener (RB)Offensive Starters Returning: 7Defensive Starters Returning: 8
GAME 8
MESA STATE COLLEGE
MAVERICKS
School: Mesa State College Location: Grand Junction, CO, 81501Founded: 1925Enrollment: 7,751Nickname: MavericksSchool Colors: Maroon & WhiteStadium: Stocker StadiumStadium Capacity: 8,000Affiliation: NCAA IIConference: Rocky MountainPresident: Tim Foster B.A. Kenyon College; M.S. Colorado School of Mines; J.D.: University of Denver College of Law Athletics Director: Butch Miller
B.A. Mesa State College; M.S. Colorado Christian Univ. 2010 Overall Record: 3-72010 Conference Record/Finish: 3-6 (8th)Head Coach: Joe Ramunno Wyoming, 1984Record at MSC: 73-63 (13th season) Overall Record: 73-63 (12 seasons)Assistant Coaches: Shawn Marsh (OC),
Darin Robidoux & Bill Stafford (Co-DC), Miles Kochevar (SP), Donnie Holmes (WR), Jack Harmon (TE),
Chad Simpson (Asst.), Phil Johnston (Asst.) Offensive Starters Returning: 6Defensive Starters Returning: 4
October 1, 2011 • 1:30 p.m. MSTELLIOT FIELD AT DON BEEBE STADIUM
CHaDRON, NEB.
LIVE VIDEO Streaming Live on America One Networks
LIVE AUDIO CSU-Pueblo Radio: 590-AM in Pueblo and streaming live at GoThunderWolves.com
October 6, 2011 • 6 p.m. MSTNETA & EDDIE DEROSE THUNDERBOWL
PUEBLO, COLO.
LIVE TV CBS College Sports Network, NCAA.com
LIVE AUDIO CSU-Pueblo Radio: 590-AM in Pueblo and streaming live at GoThunderWolves.com
CHADRON STATE2011 SCHEDULE
Sep. 1 at Univ. of Mary (ND) 6 p.m. MSTSep. 10 at ANGELO STATE (TX) 12 p.m. MSTSep. 17 at Western State* 1 p.m. MSTSep. 24 ADAMS STATE* 12 p.m. MSTOct. 1 CSU-PUEBLO* 1:30 p.m. MSTOct. 8 at Nebraska-Kearney* 12 p.m. MSTOct. 15 N.M. HIGHLANDS* 12 p.m. MSTOct. 22 at Western N.M.* 12 p.m. MSTOct. 29 FORT LEWIS* 12 p.m .MSTNov. 5 at Colorado Mines* 12 p.m. MSTNov. 12 MESA STATE* 12 p.m. MST* Rocky Mountain Athletic Conference game
CHADRON STATE2010 RESULTS
(2010 Record: 8-3; 7-2 RMAC)Aug. 28 UNIV. OF MARY (ND) W, 35-3Sept. 4 at Pittsburgh State (KS) L, 3-14Sept. 18 * WESTERN STATE W, 40-7Sep. 25 * at Adams State W, 21-10 Oct. 2 * at CSU-Pueblo L, 30-33 (OT) Oct. 9 * #14 NEBRASKA-KEARNEY L, 21-35Oct. 16 * at N.M. Highlands W, 41-19Oct. 23 * WESTERN N.M. W, 31-7Oct. 30 * at Fort Lewis W, 38-7Nov. 6 * #16 COLORADO MINES W, 38-31Nov. 13 * at Mesa State W, 31-21 * Rocky Mountain Athletic Conference game
October 15, 2011 • 12 p.m. MSTRON & CAROL COPE STADIUM AT FOSTER FIELD
KEARNEY, NEB.
LIVE VIDEO Streaming Live on America One Networks
LIVE AUDIO CSU-Pueblo Radio: 590-AM in Pueblo and streaming live at GoThunderWolves.com
MESA STATE2011 SCHEDULE
Sep. 1 HUMBOLDT STATE (CA) 7 p.m. MSTSep. 10 at Dixie State (UT) 6 p.m. MSTSep. 17 NEBRASKA-KEARNEY* 12 p.m. MSTSep. 24 at N.M. Highlands* 12 p.m. MSTOct. 1 WESTERN N.M.* 1 p.m. MSTOct. 8 at Fort Lewis* 12 p.m. MSTOct. 15 COLORADO MINES* 1 p.m. MSTOct. 22 at CSU-Pueblo* 6 p.m. MSTOct. 29 at Western State* 1 p.m. MSTNov. 5 ADAMS STATE* 1 p.m. MSTNov. 12 at Chadron State* 1 p.m. MST* Rocky Mountain Athletic Conference game
MESA STATE2010 RESULTS
(2010 Record: 3-7; 3-6 RMAC)Sep. 2 at Missouri Western St. L, 3-36Sep. 18 * at Nebraska-Kearney L, 9-31Sep. 25 * N.M. Highlands W, 40-6Oct. 2 * at Western N.M. L, 10-20Oct. 9 * FORT LEWIS W, 31-14Oct. 16 * at Colorado Mines L, 10-46Oct. 23 * CSU-PUEBLO L, 14-26 Oct. 30 * WESTERN STATE W, 33-28Nov. 6 * at Adams State L, 34-41 (2OT)Nov. 13 * CHADRON STATE L, 21-31* Rocky Mountain Athletic Conference game
October 22, 2011 • 6 p.m. MSTNETA & EDDIE DEROSE THUNDERBOWL
PUEBLO, COLO.
LIVE VIDEO Streaming Live on America One Networks
LIVE AUDIO CSU-Pueblo Radio: 590-AM in Pueblo and streaming live at GoThunderWolves.com
COLORADO MINES2011 SCHEDULE
Sep. 3 at William Jewell College (MO) 12 p.m. MSTSep. 10 SOUTH DAKOTA MINES 12 p.m. MSTSep. 17 N.M. HIGHLANDS* 12 p.m. MSTSep. 24 at Western N.M.* 12 p.m. MSTOct. 1 FORT LEWIS* 12 p.m. MSTOct. 6 at CSU-Pueblo* 6 p.m. MSTOct. 15 at Mesa State* 12 p.m. MSTOct. 22 WESTERN STATE* 12 p.m. MSTOct. 29 at Adams State* 1 p.m. MSTNov. 5 CHADRON STATE* 12 p.m. MSTNov. 12 at Neb.-Kearney* 12 p.m. MST* Rocky Mountain Athletic Conference game
COLORADO MINES2010 RESULTS
(2010 Record: 9-3; 8-1 RMAC)Aug. 28 WASHBURN (KS) L, 29-34Sep. 4 at S.D. Mines & Tech W, 52-24Sep. 18 * at N.M. Highlands W, 49-21Sep. 25 * WESTERN N.M. W, 43-0Oct. 2 * at Fort Lewis W, 38-28 Oct. 9 * CSU-PUEBLO W, 19-16Oct. 16 * MESA STATE W, 46-10Oct. 23 * at Western State W, 39-13Oct. 30 * ADAMS STATE W, 24-17 Nov. 6 * at Chadron State L, 31-38 Nov. 13 * NEBRASKA-KEARNEY W, 55-53Nov. 20 ! at Grand Valley State L, 13-35* Rocky Mountain Athletic Conference game! NCAA Division II Playoffs
NEBRASKA-KEARNEY2011 SCHEDULE
Sep. 1 at Wayne State (NE) 6 p.m. CSTSep. 10 NORTHEASTERN ST. UNIV. (OK) 12 p.m. CSTSep. 17 at Mesa State* 1 p.m. CST Sep. 24 WESTERN STATE* 1 p.m. CSTOct. 1 at Adams State* 2 p.m. CSTOct. 8 CHADRON STATE* 12 p.m. CSTOct. 15 CSU-PUEBLO* 1 p.m. CSTOct. 22 at N.M. Highlands* 1 p.m. CSTOct. 29 WESTERN N.M.* 1 p.m. CSTNov. 5 at Fort Lewis* 1 p.m. CSTNov. 12 COLORADO MINES* 1 p.m. CST* Rocky Mountain Athletic Conference game
NEBRASKA-KEARNEY2010 RESULTS
(2010 Record: 9-2; 8-1 RMAC)Aug. 28 WAYNE STATE (NE) L, 17-24 (OT)Sep. 4 at Nebraska-Omaha W, 32-29Sep. 18 * MESA STATE W, 31-9Sep. 25 * at Western State W, 13-6Oct. 2 * ADAMS STATE W, 27-17Oct. 9 * at Chadron State W, 35-21Oct. 16 * at CSU-Pueblo W, 38-24 Oct. 23 * N.M. HIGHLANDS W, 38-13Oct. 30 * at Western N.M. W, 56-31Nov. 6 * FORT LEWIS W, 48-21Nov. 13 * at Colorado Mines L, 53-55 (3OT)* Rocky Mountain Athletic Conference game
42
2011 OPPONENTSGAME 9
NEW MEXICO HIGHLANDS COWBOYS
School: New Mexico Highlands UniversityLocation: Las Vegas, NM, 87701Founded: 1893Enrollment: 3504Nickname: CowboysSchool Colors: Purple & WhiteStadium: Perkins StadiumStadium Capacity: 5,000Affiliation: NCAA IIConference: Rocky MountainPresident: Dr. James Fries (University of Iowa) Athletics Director: Ed Manzanares (New Mexico)
2010 Overall Record: 1-102010 Conference Record/Finish: 1-8 (T-10th)Head Coach: Eric Young (Univ. of Montana))Record at NMHU: 0-0 (1st season) Overall Record: 28-32 (6 seasons at College of Siskiyous
{JUCO})Assistant Coaches: Chad Raymond (OL),
Sheldon Cross (OC/QB), Robbie Quinn (DC), Tony Pavlic (DL),Kenny Jackson (WR), Ivan Cordova (LB), Art Abreu Jr. (TE),
Chris Ferragamo (Asst.)
Offensive Starters Returning: N/ADefensive Starters Returning: N/A
GAME 10
WESTERN STATE COLLEGE
MOUNTAINEERS
School: Western State College of Colorado Location: Gunnison, CO, 81231Founded: 1901Enrollment: 2,300Nickname: MountaineersSchool Colors: Crimson & SlateStadium: Mountaineer BowlStadium Capacity: 4,000Affiliation: NCAA IIConference: Rocky MountainPresident: Dr. Jay Helman Santa Clara University Athletics Director: Greg Waggoner Western State College
2010 Overall Record: 1-10 2010 Conference Record/Finish: 1-8 (T-10th)Head Coach: Jas Bains (Fresno St.) (Assistant Coach, Western State College, 2010)Record at WSC: 0-0 (1st season) Overall Record: 0-0 (1st season)Assistant Coaches: Mike Aimone (DL),
Tony Case (OL/Run-Game Coord.), Kelly Ledwith (DC/DB), Ryan McDonough (QB/Pass-Game Coord.)
Offensive Starters Returning: N/ADefensive Starters Returning: N/A
GAME 11
WESTERN NEW MEXICO UNIVERSITY
MUSTANGS
School: Western New Mexico UniversityLocation: Silver City, NM, 88062Founded: 1893Enrollment: 3,337Nickname: MustangsSchool Colors: Purple & GoldStadium: Ben Altamirano Memorial StadiumStadium Capacity: 3,000Affiliation: NCAA IIConference: Rocky MountainPresident: Dr. Joseph Shepard (B.A.-Northern Ariz. Univ.; MBA-Univ. of North Texas;
Ph.D - Florida International Univ.) Athletics Director: Scott Woodard Western New Mexico, 1983
2010 Overall Record: 4-72010 Conference Record/Finish: 3-6 (6th)Head Coach: Adam Clark (St. Ambrose, 2002)Record at WNMU: 4-7 (2nd season) Overall Record: 4-7Assistant Coaches: Brandon Guzman (RB & TE),Kamalei Magnani (LB), Chuck Kelly (DL), Nick Lucey (OC), Ron-
nie McDougle (DB), Frank Allison (OLB), James Thomas (WR), Luke Knauf (OL)
Offensive Starters Returning: 11Defensive Starters Returning: 11
October 29, 2011 • 6 p.m. MSTPERKINS STADIUM LAS VEGAS, NM.
LIVE VIDEO Streaming Live on America One Networks
LIVE AUDIO CSU-Pueblo Radio: 590-AM in Pueblo and streaming live at GoThunderWolves.com
Nov. 5, 2011 • 2 p.m. MSTNETA & EDDIE DEROSE THUNDERBOWL
PUEBLO, COLO.
LIVE VIDEO Streaming Live on America One Networks
LIVE AUDIO CSU-Pueblo Radio: 590-AM in Pueblo and streaming live at GoThunderWolves.com
NEW MEXICO HIGHLANDS2011 SCHEDULE
Sep. 3 at E. New Mexico 7 p.m. MSTSep. 10 OKLA. PANHANDLE ST. 7 p.m. MSTSep. 17 at Colorado Mines* 12 p.m. MSTSep. 24 MESA STATE* 1 p.m. MSTOct. 1 at Western State* 1 p.m. MSTOct. 8 ADAMS STATE* 6 p.m. MSTOct. 15 at Chadron State* 12 p.m. MSTOct. 22 NEBRASKA-KEARNEY* 1 p.m MSTOct. 29 CSU-PUEBLO* 6 p.m. MSTNov. 5 at Western N.M.* 12 p.m. MSTNov. 12 FORT LEWIS* 1 p.m. MST* Rocky Mountain Athletic Conference game
NEW MEXICO HIGHLANDS2010 RESULTS
(2010 Record: 1-10; 1-8 RMAC)Sep. 2 #17 - MIDWESTERN ST. (TX) L, 6-52Sep. 11 at Okla. Panhandle St. L, 6-14Sep. 18 * COLORADO MINES L, 21-49Sep. 25 * at Mesa State L, 6-40Oct. 2 * WESTERN STATE W, 32-31Oct. 9 * at Adams State L, 0-55Oct. 16 * CHADRON STATE L, 19-41Oct. 23 * at #12 Nebraska-Kearney L, 13-38 Oct. 30 * at CSU-Pueblo L, 0-66Nov. 6 * WESTERN N.M. L, 13-38Nov. 13 * at Fort Lewis L, 13-36 * Rocky Mountain Athletic Conference game
Nov. 12, 2011 • 2 p.m. MSTNETA & EDDIE DEROSE THUNDERBOWL
PUEBLO, COLO.
LIVE VIDEO Streaming Live on America One Networks
LIVE AUDIO CSU-Pueblo Radio: 590-AM in Pueblo and streaming live at GoThunderWolves.com
WESTERN STATE2011 SCHEDULE
Sep. 3 ANGELO STATE (TX) 1 p.m. MSTSep. 10 at Idaho State 3:30 p.m. MSTSep. 17 CHADRON STATE* 1 p.m. MSTSep. 24 at Nebraska-Kearney* 12 p.m. MSTOct. 1 N.M. HIGHLANDS* 1 p.m. MSTOct. 8 at Western N.M.* 1 p.m. MSTOct. 15 FORT LEWIS* 1 p.m. MSTOct. 22 at Colorado Mines* 12 p.m. MSTOct. 29 MESA STATE* 1 p.m. MSTNov. 5 at CSU-Pueblo* 2 p.m. MSTNov. 12 at Adams State* 1 p.m. MST* Rocky Mountain Athletic Conference game
WESTERN STATE2010 RESULTS
(2010 Record: 1-10; 1-8 RMAC)Aug. 28 at Fort Hays State L, 20-45Sep. 4 at Montana L, 2-73Sep. 18 * at Chadron State L, 7-40Sep. 25 * #19 - NEBRASKA-KEARNEY L, 6-13Oct. 2 * at N.M. Highlands L, 31-32Oct. 9 * WESTERN N.M. L, 7-25Oct. 16 * at Fort Lewis W, 27-24 (OT)Oct. 23 * #20 - COLORADO MINES L, 13-39Oct. 30 * at Mesa State L, 28-33Nov. 6 * CSU-PUEBLO L, 3-37Nov. 13 * ADAMS STATE L, 19-28 * Rocky Mountain Athletic Conference game
WESTERN NEW MEXICO2011 SCHEDULE
Sep. 3 SUL ROSS ST. (TX) 12 p.m. MSTSep. 10 at San Diego (CA) 6 p.m. MSTSep. 17 at Fort Lewis* 1 p.m. MSTSep. 24 COLORADO MINES* 12 p.m. MSTOct. 1 at Mesa State* 12 p.m. MSTOct. 8 WESTERN STATE* 1 p.m. MSTOct. 15 at Adams State* 1 p.m. MSTOct. 22 CHADRON STATE* 12 p.m. MSTOct. 29 at Nebraska-Kearney* 12 p.m. MSTNov. 5 N.M. HIGHLANDS* 12 p.m. MSTNov. 12 at CSU-Pueblo* 2 p.m. MST* Rocky Mountain Athletic Conference game
WESTERN NEW MEXICO2010 RESULTS
(2010 Record: 4-7; 3-6 RMAC)Sep. 2 at Northern Arizona L, 0-48Sep. 11 at Sul Ross St. (TX) W, 35-32Sep. 18 * FORT LEWIS L, 27-30Sep. 25 * at Colorado Mines L, 0-43Oct. 2 * MESA STATE W, 20-10Oct. 9 * at Western State W, 25-7Oct. 16 * ADAMS STATE L, 10-14Oct. 23 * at Chadron State L, 7-31Oct. 30 * NEBRASKA-KEARNEY L, 31-56 Nov. 6 * at N.M. Highlands W, 38-13Nov. 13 * CSU-PUEBLO L, 17-45 * Rocky Mountain Athletic Conference game
CSU-PUEBLO OPPONENT SID CONTACTSWEST TEXAS A&M UNIV.Dameon Myres Email: [email protected]: (806) 651-4406Website: www.gobuffsgo.com
NORTHWESTERN OKLAHOMA STATE UNIV.Ryan Hintergardt Email: [email protected]: (580) 327-8639Website: www.nwosu.edu/athletics
ADAMS STATE COLLEGEScott Kretzmann Email: [email protected]: (719) 587-7825Website: www.ASCGrizzlies.com
FORT LEWIS COLLEGEChris Aaland Email: [email protected]: (970) 247-7381Website: www.GoSkyhawks.com
CHADRON STATE COLLEGEAlex Helmbrecht Email: [email protected]: (308) 432-6212Website: www.csc.edu/athletics
COLORADO SCHOOL OF MINESJeff Duggan Email: [email protected]: (303) 273-3095Website: www.CSMOrediggers.com
UNIVERSITY OF NEBRASKA-KEARNEYPeter Yazvac Email: [email protected]: (308) 865-8334Website: www.Lopers.com
MESA STATE COLLEGETish Elliott Email: [email protected]: (970) 248-1143Website: www.MesaMavs.com
NEW MEXICO HIGHLANDS UNIVERSITYGavino Archuleta Email: [email protected]: (505) 426-2017Website: www.NMHUCowboys.com
WESTERN STATE COLLEGE OF COLORADOJared Verner Email: [email protected]: (970) 943-2831Website: www.WSCAthletics.com
WESTERN NEW MEXICO UNIVERSITYTBA Email: TBAOffice: (575) 538-6214Website: www.WNMUMustangs.com
43
2010 YEAR-IN-REVIEW CSU-PUEBLO SEASON STATISTICS
PAGE 44GAME RECAPS
PAGE 49ROCKY MOUNTAIN ATHLETIC CONFERENCE
PAGE 60
44
2010 SEASON STATISTICSRECORD: OVERALL HOME AWAY NEUTRALALL GAMES 9-2-0 4-1-0 5-1-0 0-0-0CONFERENCE 7-2-0 3-1-0 4-1-0 0-0-0NON-CONFERENCE 2-0-0 1-0-0 1-0-0 0-0-0
DATE OPPONENT W/L SCORE ATTENDAug 28, 2010 at Okla. Panhandle St. W 26-14 2500Sep 04, 2010 NW OKLAHOMA STATE W 55-13 6723*Sep 18, 2010 ADAMS STATE W 27-10 6068*Sep 25, 2010 at Fort Lewis W 49-14 1335*Oct 02, 2010 CHADRON STATE WOT 33-30 6431*Oct 09, 2010 at Colorado Mines L 16-19 3216*Oct 16, 2010 #13 NEBRASKA-KEARNEY L 24-38 5905*Oct 23, 2010 at Mesa State W 26-14 529*Oct 30, 2010 NEW MEXICO HIGHLANDS W 66-0 5268*Nov 06, 2010 at Western State W 37-3 440*Nov 13, 2010 at Western New Mexico W 45-17 652
RUSHING GP Att Gain Loss Net Avg TD Long Avg/GJesse Lewis 10 176 1439 48 1391 7.9 14 83 139.1Jamaal Johnson 10 108 633 20 613 5.7 9 50 61.3Bernard Jackson 11 34 176 10 166 4.9 1 23 15.1Dominique Harris 2 19 73 15 58 3.1 1 18 29.0Giovanni Rider 9 9 41 0 41 4.6 1 11 4.6Justin McCash 5 1 20 0 20 20.0 0 20 4.0Marquise Enoch 11 4 17 0 17 4.2 1 6 1.5Josh Salazar 6 5 16 0 16 3.2 1 6 2.7Jonathan Gaye 3 5 14 1 13 2.6 0 4 4.3Brandon Kliesen 11 1 11 0 11 11.0 0 11 1.0Chris Brown 11 1 2 0 2 2.0 0 2 0.2TEAM 2 1 0 2 -2 -2.0 0 0 -1.0Sebastian Trujillo 6 1 0 10 -10 -10.0 0 0 -1.7Ross Dausin 11 47 131 141 -10 -0.2 3 24 -0.9Total.......... 11 412 2573 247 2326 5.6 31 83 211.5Opponents...... 11 396 1707 299 1408 3.6 5 46 128.0
PASSING G Effic Cmp-Att-Int Pct Yds TD Lng Avg/GRoss Dausin 11 126.87 135-239-6 56.5 1674 12 63 152.2Sebastian Trujillo 6 129.50 19-28-1 67.9 190 1 42 31.7Bernard Jackson 11 52.10 2-4-0 50.0 1 0 3 0.1Jamaal Johnson 10 111.70 1-4-0 25.0 2 1 2 0.2Troy Graham 1 100.40 1-2-0 50.0 12 0 12 12.0Total.......... 11 125.64 158-277-7 57.0 1879 14 63 170.8Opponents...... 11 113.96 211-371-23 56.9 2401 17 73 218.3
RECEIVING G No. Yds Avg TD Long Avg/GBernard Jackson 11 32 453 14.2 3 55 41.2Josh Sandoval 10 27 284 10.5 2 30 28.4Koby Wittek 11 24 269 11.2 3 50 24.5Jared Sperber 11 16 198 12.4 0 42 18.0Da’Quan Cartwright 7 12 124 10.3 2 63 17.7Roger Pfannenschmid 11 10 212 21.2 2 42 19.3Derek Gainey 7 10 138 13.8 1 32 19.7Jamaal Johnson 10 9 80 8.9 1 39 8.0Jesse Lewis 10 8 62 7.8 0 18 6.2Josh Bredl 9 3 19 6.3 0 11 2.1Marquise Enoch 11 3 8 2.7 0 8 0.7Justin McCash 5 2 19 9.5 0 11 3.8Josh Salazar 6 1 7 7.0 0 7 1.2Austen Lott 6 1 6 6.0 0 6 1.0Total.......... 11 158 1879 11.9 14 63 170.8Opponents...... 11 211 2401 11.4 17 73 218.3
TEAM STATISTICS CSUP OPPSCORING 404 172 Points Per Game 36.7 15.6FIRST DOWNS 208 195 Rushing 95 74 Passing 86 105 Penalty 27 16RUSHING YARDAGE 2326 1408 Yards gained rushing 2573 1707 Yards lost rushing 247 299 Rushing Attempts 412 396 Average Per Rush 5.6 3.6 Average Per Game 211.5 128.0 TDs Rushing 31 5PASSING YARDAGE 1879 2401 Att-Comp-Int 277-158-7 371-211-23 Average Per Pass 6.8 6.5 Average Per Catch 11.9 11.4 Average Per Game 170.8 218.3 TDs Passing 14 17TOTAL OFFENSE 4205 3809 Total Plays 689 767 Average Per Play 6.1 5.0 Average Per Game 382.3 346.3KICK RETURNS: #-Yards 34-873 45-998PUNT RETURNS: #-Yards 38-376 25-106INT RETURNS: #-Yards 23-455 7-87KICK RETURN AVERAGE 25.7 22.2PUNT RETURN AVERAGE 9.9 4.2INT RETURN AVERAGE 19.8 12.4FUMBLES-LOST 15-5 15-6PENALTIES-Yards 83-792 84-787 Average Per Game 72.0 71.5PUNTS-Yards 50-2158 61-2301 Average Per Punt 43.2 37.7 Net punt average 38.6 30.6TIME OF POSSESSION/Game 28:08 31:503RD-DOWN Conversions 52/137 59/170 3rd-Down Pct 38% 35%4TH-DOWN Conversions 7/11 7/21 4th-Down Pct 64% 33%SACKS BY-Yards 35-171 19-118MISC YARDS 2 0TOUCHDOWNS SCORED 51 22FIELD GOALS-ATTEMPTS 16-23 7-14ON-SIDE KICKS 0-2 0-0RED-ZONE SCORES 40-49 82% 20-33 61%RED-ZONE TOUCHDOWNS 28-49 57% 13-33 39%PAT-ATTEMPTS 48-49 98% 19-22 86%ATTENDANCE 30395 8672 Games/Avg Per Game 5/6079 6/1445 Neutral Site Games 0/0
TOTAL OFFENSE G Plays Rush Pass Total Avg/GRoss Dausin 11 286 -10 1674 1664 151.3Jesse Lewis 10 176 1391 0 1391 139.1Jamaal Johnson 10 112 613 2 615 61.5Sebastian Trujillo 6 29 -10 190 180 30.0Bernard Jackson 11 38 166 1 167 15.2Dominique Harris 2 19 58 0 58 29.0Giovanni Rider 9 9 41 0 41 4.6Justin McCash 5 1 20 0 20 4.0Marquise Enoch 11 4 17 0 17 1.5Josh Salazar 6 5 16 0 16 2.7Jonathan Gaye 3 5 13 0 13 4.3Troy Graham 1 2 0 12 12 12.0Brandon Kliesen 11 1 11 0 11 1.0Chris Brown 11 1 2 0 2 0.2TEAM 2 1 -2 0 -2 -1.0Total.......... 11 689 2326 1879 4205 382.3Opponents...... 11 767 1408 2401 3809 346.3
45
PUNT RETURNS No. Yds Avg TD LongMarquise Enoch 21 164 7.8 0 36Josh Sandoval 14 174 12.4 0 29Justin McCash 1 14 14.0 0 14Aaron Hernandez 1 13 13.0 0 0Grant Crunkleton 1 11 11.0 0 11Total.......... 38 376 9.9 0 36Opponents...... 25 106 4.2 0 25
KICK RETURNS No. Yds Avg TD LongMarquise Enoch 20 497 24.9 1 97Derek Gainey 7 217 31.0 0 70Bernard Jackson 4 102 25.5 0 37Justin McCash 2 47 23.5 0 25Tyler Hamlin 1 10 10.0 0 10Total.......... 34 873 25.7 1 97Opponents...... 45 998 22.2 0 40
ALL PURPOSE G Rush Rec PR KOR IR Tot Avg/GJesse Lewis 10 1391 62 0 0 0 1453 145.3Bernard Jackson 11 166 453 0 102 0 721 65.5Jamaal Johnson 10 613 80 0 0 0 693 69.3Marquise Enoch 11 17 8 164 497 0 686 62.4Josh Sandoval 10 0 284 174 0 0 458 45.8Derek Gainey 7 0 138 0 217 0 355 50.7Koby Wittek 11 0 269 0 0 0 269 24.5Roger Pfannenschmid 11 0 212 0 0 0 212 19.3Jared Sperber 11 0 198 0 0 0 198 18.0Grant Crunkleton 11 0 0 11 0 130 141 12.8Da’Quan Cartwright 7 0 124 0 0 0 124 17.7Justin McCash 5 20 19 14 47 0 100 20.0Mark Sterling 11 0 0 0 0 97 97 8.8Chris Brown 11 2 0 0 0 90 92 8.4Dominique Harris 2 58 0 0 0 0 58 29.0Damon Schiele 9 0 0 0 0 50 50 5.6Jon Bailey 11 0 0 0 0 43 43 3.9Giovanni Rider 9 41 0 0 0 0 41 4.6Josh Costa 11 0 0 0 0 32 32 2.9Josh Salazar 6 16 7 0 0 0 23 3.8Josh Bredl 9 0 19 0 0 0 19 2.1Jonathan Gaye 3 13 0 0 0 0 13 4.3Aaron Hernandez 11 0 0 13 0 0 13 1.2Lee Meisner 11 0 0 0 0 11 11 1.0Brandon Kliesen 11 11 0 0 0 0 11 1.0Tyler Hamlin 7 0 0 0 10 0 10 1.4Austen Lott 6 0 6 0 0 0 6 1.0Jason Campbell 11 0 0 0 0 2 2 0.2Ross Dausin 11 -10 0 0 0 0 -10 -0.9Sebastian Trujillo 6 -10 0 0 0 0 -10 -1.7Total.......... 11 2326 1879 376 873 455 5909 537.2Opponents...... 11 1408 2401 106 998 87 5000 454.5
| - - - - - - - PAT - - - - - - - |SCORING TD FGs Kick Rush Rcv Pass DXP Saf PointsKyle Major 0 16-23 48-49 0-0 0 0-0 0 0 96Jesse Lewis 14 0-0 0-0 0-0 0 0-0 0 0 84Jamaal Johnson 10 0-0 0-0 0-0 0 0-0 0 0 60Bernard Jackson 4 0-0 0-0 0-0 0 0-1 0 0 24Grant Crunkleton 3 0-0 0-0 0-0 0 0-0 0 0 18Ross Dausin 3 0-0 0-0 0-0 0 0-1 0 0 18Koby Wittek 3 0-0 0-0 0-0 0 0-0 0 0 18Da’Quan Cartwright 2 0-0 0-0 0-0 0 0-0 0 0 12Roger Pfannenschmid 2 0-0 0-0 0-0 0 0-0 0 0 12Josh Sandoval 2 0-0 0-0 0-0 0 0-0 0 0 12Marquise Enoch 2 0-0 0-0 0-0 0 0-0 0 0 12Damon Schiele 1 0-0 0-0 0-0 0 0-0 0 1 8Giovanni Rider 1 0-0 0-0 0-0 0 0-0 0 0 6Dominique Harris 1 0-0 0-0 0-0 0 0-0 0 0 6Derek Gainey 1 0-0 0-0 0-0 0 0-0 0 0 6Josh Salazar 1 0-0 0-0 0-0 0 0-0 0 0 6Mark Sterling 1 0-0 0-0 0-0 0 0-0 0 0 6Total.......... 51 16-23 48-49 0-0 0 0-2 0 1 404Opponents...... 22 7-14 19-22 0-0 0 0-0 0 0 172
FIELD GOALS FGM-FGA Pct 01-19 20-29 30-39 40-49 50-99 Lg BlkKyle Major 16-23 69.6 0-0 2-3 10-12 4-6 0-2 47 0
FG SEQUENCE CSU-Pueblo OPPONENTSOkla. Panhandle St. 32,(33) 39NW Oklahoma State (47),(40) -Adams State (27),(32) 34,(23),42Fort Lewis 46,34,40 54,39Chadron State (36),23,(39),(32),(34) (23),(23),(24)Colorado Mines (32),64 34Nebraska-Kearney 52,(30) (36)Mesa State (43),(36) 25New Mexico Highlands (42) -Western State (31) (35)Western New Mexico (21) (25)Numbers in (parentheses) indicate field goal was made.
PUNTING No. Yds Avg Long TB FC I20 BlkdBrandon Kliesen 50 2158 43.2 59 6 7 12 0Total.......... 50 2158 43.2 59 6 7 12 0Opponents...... 61 2301 37.7 58 3 4 10 3
KICKOFFS No. Yds Avg TB OB Retn Net YdLnKyle Major 73 4766 65.3 26 0 Total.......... 73 4766 65.3 26 0 998 44.5 25Opponents...... 39 2359 60.5 4 1 873 36.1 33
INTERCEPTIONS No. Yds Avg TD LongChris Brown 5 90 18.0 0 49Grant Crunkleton 4 130 32.5 3 40Josh Costa 4 32 8.0 0 19Damon Schiele 3 50 16.7 1 39Stephan Dickens 2 0 0.0 0 0Jon Bailey 2 43 21.5 0 26Lee Meisner 1 11 11.0 0 11Jason Campbell 1 2 2.0 0 2Mark Sterling 1 97 97.0 1 97Total.......... 23 455 19.8 5 97Opponents...... 7 87 12.4 0 40
FUMBLE RETURNS No. Yds Avg TD LongTotal.......... 0 0 0.0 0 0Opponents...... 0 0 0.0 0 0
SCORE BY QUARTERS 1st 2nd 3rd 4th OT TotalCSU-Pueblo 97 84 110 100 13 404Opponents 23 58 16 65 10 172
2010 SEASON STATISTICS
46
| - - - - - - - - Tackles - - - - - - - - | | - Sacks - | | - - - Pass Defense - - - | | - - Fumbles - - | Blk DEFENSIVE LEADERS GP Solo Ast Total TFL/Yds No-Yards Int-Yds BrUp QBH Rcv-Yds FF Kick Saf36 Lee Meisner 11-11 50 74 124 9.5-26 1.5-3 1-11 2 . . 2 . .47 Beldy Nseka 10-8 27 43 70 6.0-22 3.0-18 . 1 2 . . . .22 Damon Schiele 9-8 24 36 60 5.5-26 3.0-20 3-50 2 1 . 1 . 188 Grant Jansen 11-11 19 33 52 14.5-49 7.0-28 . 2 . . 1 1 .18 Jon Bailey 11-11 23 29 52 0.5-1 . 2-43 1 . . . . .48 Jason Campbell 11-11 24 26 50 11.0-42 5.0-32 1-2 . . 1-0 . . .26 Josh Costa 11-10 31 18 49 2.0-4 . 4-32 7 . 1-0 . . .23 Grant Crunkleton 11-11 28 18 46 3.5-17 2.0-15 4-130 7 1 . . . .7 Jervoise Hollins 11-11 7 31 38 4.5-11 2.5-3 . . 3 . . . .50 Dexter Scott 11-0 20 14 34 4.0-11 . . 1 . . . . .24 Chris Brown 11-8 20 13 33 . . 5-90 6 . . . . .4 Beau Martin 11-9 13 18 31 10.5-50 7.5-42 . . 1 1-0 1 . .27 Aaron Hernandez 11-1 16 11 27 2.0-7 . . 1 . . 1 1 .20 Stephan Dickens 6-3 12 11 23 1.0-4 . 2-0 3 . . 1 . .41 Adrian Marquez 7-3 9 11 20 . . . 1 . . . . .38 Louie Lozano 9-2 10 9 19 2.0-5 . . 1 . . . . .31 Kyle McCall 10-0 9 10 19 . . . 1 . . . . .97 Justin Herrera 11-2 7 11 18 2.5-3 1.5-2 . . . . . 1 .29 Denzel Williams 9-0 9 6 15 1.0-8 1.0-8 . . . . . . .90 G. Martin-Proctor 11-1 3 10 13 0.5-1 . . . 2 . . . .35 Nick Henderson 9-0 9 3 12 . . . . . . . 1 .53 Tahir James 3-0 4 8 12 0.5-1 . . . . 1-0 . . .56 Sam Collins 9-0 2 6 8 . 1.0-0 . 2 . . 1 2 .98 Darryl Montelongo 9-0 3 3 6 . . . . . . . . .46 Dyrell Hallcy 11-0 3 1 4 . . . . . . . . .11 Josh Sandoval 10-1 3 . 3 . . . . . . . . .12 Mark Sterling 11-0 . 2 2 . . 1-97 1 . 2-0 . . .80 Koby Wittek 11-10 2 . 2 . . . . . . . . .21 Spencer Torrez 1-0 . 1 1 . . . . . . . . .42 Joe Campton 11-0 1 . 1 . . . . . . . . .68 Drew Swartz 11-11 1 . 1 . . . . . . . . .85 Da’Quan Cartwright 7-4 1 . 1 . . . . . . . . .82 Roger Pfannenschmid 11-5 1 . 1 . . . . . . . . .78 Daveon Ackinsanya 11-0 1 . 1 . . . . . . . . .TM TEAM 2-0 1 . 1 . . . . . . . . .28 Jesse Lewis 10-10 1 . 1 . . . . . . . . .6 Marquise Enoch 11-0 . 1 1 . . . . . . . . .58 Ben Hicks 3-0 . 1 1 . . . . . . . . .87 Josh Bredl 9-0 1 . 1 . . . . . . . . . Total.......... 11-0 395 458 853 81-288 35-171 23-455 39 10 6-0 8 6 1 Opponents...... 11-0 347 439 786 57.0-218 19-118 7-87 30 6 5-0 4 . .
Opponent QB RB FB WR WR TE LT LG C RG RTOkla. Panhandle St. Dausin Lewis Cartwright (WR) Ber.Jackson Sperber Wittek R. Jensen Jo. Vicars Haddan Trione SwartzNW Oklahoma St. Dausin Johnson Rider Ber.Jackson Cartwright Wittek R. Jensen Jo. Vicars Haddan Trione SwartzAdams State Dausin Lewis Sandoval (WR) Ber.Jackson Cartwright Gainey (WR) R. Jensen Jo. Vicars Haddan Kelly SwartzFort Lewis Dausin Lewis Rider Ber.Jackson Cartwright Wittek R. Jensen Jo. Vicars Haddan Kelly SwartzChadron State Dausin Lewis Rider Ber.Jackson Sperber Wittek R. Jensen Jo. Vicars Haddan Kelly SwartzColorado Mines Dausin Lewis Rider Ber.Jackson Gainey Wittek R. Jensen Jo. Vicars Haddan Kelly SwartzNebraska-Kearney Dausin Lewis Pfannenschmid (TE) Ber.Jackson Sperber Wittek R. Jensen Haddan Jones Kelly SwartzMesa State Dausin Lewis Rider Ber.Jackson Gainey Wittek R. Jensen Haddan Jones Jo. Vicars SwartzN.M. Highlands Lewis (RB) Johnson Salazar Ber.Jackson Hamlin (TE) Wittek R. Jensen Jo. Vicars Jones Haddan SwartzWestern State Dausin Lewis Pfannenschmid (TE) Ber.Jackson Sperber Wittek R. Jensen Haddan Jones Jo. Vicars SwartzWestern N.M. Dausin Lewis Salazar Sperber Pfannenschmid (TE) Wittek R. Jensen Haddan Jones Jo. Vicars SwartzOpponent LDE NG RDE LOLB LILB RILB ROLB LCB RCB FS SSOkla. Panhandle St. Herrera Hollins Jansen Lozano Meisner Schiele Campbell Brown Crunkleton J. Bailey CostaNW Oklahoma St. Herrera Hollins Jansen Lozano Meisner Schiele Campbell Brown Crunkleton J. Bailey CostaAdams State B. Martin Hollins Jansen Nseka Meisner Schiele Campbell Brown Crunkleton J. Bailey CostaFort Lewis B. Martin Hollins Jansen Nseka Meisner Schiele Campbell Brown Crunkleton J. Bailey CostaChadron State B. Martin Hollins Jansen Nseka Meisner Schiele Campbell Brown Crunkleton J. Bailey CostaColorado Mines B. Martin Hollins Jansen Nseka Meisner Schiele Campbell Brown Crunkleton J. Bailey CostaNebraska-Kearney B. Martin Hollins Jansen Nseka Meisner Schiele Campbell Dickens Crunkleton J. Bailey CostaMesa State B. Martin Hollins Jansen Nseka Meisner James Campbell Dickens Crunkleton J. Bailey CostaN.M. Highlands B. Martin Hollins Jansen Nseka Meisner Marquez Campbell Brown Crunkleton J. Bailey HernandezWestern State B. Martin Hollins Martin-Proctor Jansen (DE) Meisner Marquez (LOLB) Campbell Dickens Crunkleton J. Bailey CostaWestern N.M. B. Martin Hollins Jansen Nseka Meisner Schiele Campbell Brown Crunkleton J. Bailey Costa
2010 DEFENSIVE STATISTICS
2010 CSU-PUEBLO STARTING LINEUPS
47
|---RUSHING---| |--RECEIVING--| |-------PASSING-------| |--KICK RET--| |--PUNT RET--| totDate Opponent No. Yds TD Lg No. Yds TD Lg Cmp-Att-Int Yds TD Lg No Yds TD Lg No Yds TD Lg offAug 28, 2010 at Okla. Panhandle St. 30 149 2 41 16 200 1 55 16-32-2 200 1 55 4 57 0 26 1 14 0 14 349Sep 04, 2010 NW OKLAHOMA STATE 39 86 2 27 19 316 4 63 19-26-0 316 4 63 2 34 0 18 6 48 0 36 402Sep 18, 2010 ADAMS STATE 44 164 1 20 7 52 0 18 7-19-2 52 0 18 2 99 1 97 2 47 0 36 216Sep 25, 2010 at Fort Lewis 34 324 5 83 13 157 0 42 13-21-1 157 0 42 3 112 0 70 3 0 0 1 481Oct 02, 2010 CHADRON STATE 44 239 2 34 11 91 1 16 11-25-0 91 1 16 4 101 0 57 3 51 0 22 330Oct 09, 2010 at Colorado Mines 31 127 1 31 14 140 1 30 14-24-0 140 1 30 4 78 0 27 3 42 0 16 267Oct 16, 2010 NEBRASKA-KEARNEY 32 172 1 71 26 251 2 32 26-44-0 251 2 32 6 167 0 52 3 19 0 8 423Oct 23, 2010 at Mesa State 47 193 2 27 12 119 0 20 12-19-1 119 0 20 3 82 0 35 3 33 0 17 312Oct 30, 2010 NEW MEXICO HIGHLANDS 42 331 8 45 9 168 1 42 9-16-0 168 1 42 1 24 0 24 7 107 0 33 499Nov 06, 2010 at Western State 36 310 3 70 15 146 2 26 15-25-1 146 2 26 1 17 0 17 4 14 0 8 456Nov 13, 2010 at Western New Mexico 33 231 4 69 16 239 2 50 16-26-0 239 2 50 4 102 0 37 3 1 0 9 470 Totals 412 2326 31 83 158 1879 14 63 158-277-7 1879 14 63 34 873 1 97 38 376 0 36 4205 Opponent 396 1408 5 46 211 2401 17 73 211-371-23 2401 17 73 45 998 0 40 25 106 0 25 3809
Games played: 11 Avg per rush: 5.6 Avg per catch: 11.9 Pass efficiency: 125.64 Kick ret avg: 25.7 Punt ret avg: 9.9 All purpose avg/game: 537.2 Total offense avg/gm: 382.3
|---------TACKLES---------| |-SACKS-| |-FUMBLE-| Pass Blkd XPTSDate Opponent Solo Ast Total TFL-Yds No-Yds FF FR-Yds Int-Yds QBH Brk Kick Att-Mad Run Rcv Saf PtsAug 28, 2010 at Okla. Panhandle St. 45 26 71 7.0-36 5.0-27 0 0-0 3-11 0 6 0 3-3 0 0 1 26Sep 04, 2010 NW OKLAHOMA STATE 38 36 74 5.0-16 3.0-14 1 2-0 1-30 0 3 1 7-7 0 0 0 55Sep 18, 2010 ADAMS STATE 28 40 68 8.0-23 2.0-6 0 0-0 4-90 0 3 2 3-3 0 0 0 27Sep 25, 2010 at Fort Lewis 41 38 79 6.0-35 3.0-22 1 1-0 3-144 2 6 0 7-7 0 0 0 49Oct 02, 2010 CHADRON STATE 32 76 108 13.0-37 2.0-10 1 0-0 2-20 1 4 0 3-3 0 0 0 33Oct 09, 2010 at Colorado Mines 50 26 76 5.0-20 3.0-9 2 0-0 2-37 2 4 2 1-1 0 0 0 16Oct 16, 2010 NEBRASKA-KEARNEY 33 62 95 7.0-24 4.0-16 1 1-0 0-0 2 3 0 3-3 0 0 0 24Oct 23, 2010 at Mesa State 24 40 64 5.0-8 0.0-0 0 0-0 2-40 0 4 0 3-2 0 0 0 26Oct 30, 2010 NEW MEXICO HIGHLANDS 26 52 78 14.0-40 5.0-25 1 1-0 1-10 0 3 1 9-9 0 0 0 66Nov 06, 2010 at Western State 37 24 61 6.0-31 5.0-30 0 0-0 2-49 1 1 0 4-4 0 0 0 37Nov 13, 2010 at Western New Mexico 41 38 79 5.0-18 3.0-12 1 1-0 3-24 2 2 0 6-6 0 0 0 45 Totals 395 458 853 81.0-288 35.0-171 8 6-0 23-455 10 39 6 49-48 0 0 1 404 Opponent 347 439 786 57.0-218 20.0-118 4 5-0 7-87 6 30 0 22-19 0 0 0 172
|------------------PUNTING------------------| |--FIELD GOALS--| |------KICKOFFS------|Date Opponent No Yds Avg Long Blkd TB FC 50+ I20 Att-Made Lg Blkd No Yds Avg TB OBAug 28, 2010 at Okla. Panhandle St. 6 265 44.2 58 0 0 2 1 1 2-1 33 0 5 261 52.2 0 0Sep 04, 2010 NW OKLAHOMA STATE 6 218 36.3 44 0 0 0 0 0 2-2 47 0 10 699 69.9 6 0Sep 18, 2010 ADAMS STATE 5 211 42.2 46 0 1 0 0 0 2-2 32 0 5 342 68.4 1 0Sep 25, 2010 at Fort Lewis 3 150 50.0 52 0 1 0 2 2 3-0 0 0 8 527 65.9 4 0Oct 02, 2010 CHADRON STATE 4 164 41.0 46 0 0 1 0 1 5-4 39 0 5 312 62.4 1 0Oct 09, 2010 at Colorado Mines 8 372 46.5 59 0 2 1 3 1 2-1 32 0 4 280 70.0 3 0Oct 16, 2010 NEBRASKA-KEARNEY 6 231 38.5 53 0 1 0 1 1 2-1 30 0 4 257 64.2 1 0Oct 23, 2010 at Mesa State 2 99 49.5 52 0 0 0 1 2 2-2 43 0 6 377 62.8 0 0Oct 30, 2010 NEW MEXICO HIGHLANDS 1 44 44.0 44 0 0 1 0 1 1-1 42 0 11 728 66.2 4 0Nov 06, 2010 at Western State 3 130 43.3 48 0 0 1 0 2 1-1 31 0 7 490 70.0 4 0Nov 13, 2010 at Western New Mexico 6 274 45.7 53 0 1 1 1 1 1-1 21 0 8 493 61.6 2 0 Totals 50 2158 43.2 59 0 6 7 9 12 23-16 47 0 73 4766 65.3 26 0 Opponent 61 2301 37.7 58 3 3 4 8 10 14-7 36 2 39 2359 60.5 4 1
2010 TEAM GAME-BY-GAME
48
THE lAST TIME cSU-PUEblO HAD...PASSING20 completions – (23) Ross Dausin vs. Nebraska-Kearney, 10/16/201030 or more completions – Never40 attempts – (41) Ross Dausin vs. Nebraska-Kearney, 10/16/201050 ore more attempts – Never300 yards – (304) Ross Dausin vs. Northwestern Oklahoma State, 9/4/2010400 or more yards – NeverPass over 80 yards – (96) Colin Clancy to Jesse Lewis at Northwestern Oklahoma State, 9/5/20094 touchdowns – (4) John Wristen, vs. Western State, 10/22/19835 or more touchdowns – Never
RECEIVING100 yards – (107) Bernard Jackson, vs. New Mexico Highlands, 10/30/2010150 yards – (207) John Trahan, vs. Mesa State, 9/18/1982200 yards – (207) John Trahan, vs. Mesa State, 9/18/1982Reception over 80 yards – (96) Colin Clancy to Jesse Lewis at Northwestern Oklahoma State, 9/5/200910 receptions – (12) John Trahan, vs. Mesa State, 9/18/19823 Receiving Touchdowns – (3) Roy Thomas, vs. Southern Utah, 10/2/1982
RUSHING100 yards – (185) Jesse Lewis at Western New Mexico, 11/13/2010200 yards – (239) Jesse Lewis at Western State, 11/6/2010300 yards – (304) Frank Hester, vs. Emporia State, 10/16/1965Two players over 100 yards – Jesse Lewis (141) and Jamaal Johnson (102) vs. New Mexico Highlands, 10/30/2010Rush of 75 yards – (83) Jesse Lewis vs. Fort Lewis, 9/25/20103 rushing touchdowns in one game – (3) Jesse Lewis at Western New Mexico, 11/13/20104 rushing touchdowns in one game – (4) Joe Pannunzio, vs. Western New Mexico, 10/11/1980
DEFENSEInterception Return for a TD – Grant Crunkleton (40 yards) at Mesa State, 10/23/2010Fumble Return for a TD – Jon Bailey (25 yards) at Fort Lewis, 9/13/20083 Interceptions in one game – (3) Dale Cephers, Oklahoma Panhandle State, 11/15/19803 Sacks in one game – (4.5) Chase Vaughn vs. Oklahoma Panhandle State, 9/6/2008Scored a safety – Damon Schiele, vs. Northwestern Oklahoma State, 10/28/2010
SPECIAL TEAMSField goal of 50 yards – (52) Kyle Major at Adams State, 11/7/2009Kickoff return of 80 yards – (97) Marquise Enoch vs. Adams State, 9/18/2010Blocked a PAT – Sam Collins, vs. Colorado Mines, 10/9/2010Blocked a Field Goal – Sam Collins, vs. Colorado Mines, 10/9/2010Blocked a Punt – Aaron Hernandez, vs. New Mexico Highlands, 10/30/2010Kickoff Return for a Touchdown – (97) Marquise Enoch vs. Adams State, 9/18/2010Did Not Punt – Not availablePunt Return for a TD – Markus Turner (61 yards) vs. Oklahoma Panhandle State, 9/6/2008Three Field Goals in a Game – (4) Kyle Major vs. Chadron State, 10/2/2010Punt for 60 yards – (63) Kyle Major vs. Nebraska-Kearney, 10/4/2008Punt for 70 yards – (70) Pat Rollison vs. Adams State, 10/12/1966
LAST TIME A CSUP OPPONENT HAD:
PASSING30 completions – (38) Clay Garcia, Colorado Mines, 10/9/201040 completions – (45) J.J. Harp, Eastern New Mexico, 8/29/200940 attempts – (78) J.J. Harp, Eastern New Mexico, 8/29/200960 attempts – (61) Clay Garcia, Colorado Mines, 10/9/20105 touchdowns – (8) Kevin Kott, Eastern New Mexico, 10/6/1984Pass for 80 yards – (85) Scott Loveland to Adrian Andrews, Central Missouri, 9/3/1983300 yards – (410) Jake Spitzelberger, Nebraska-Kearney, 10/16/2010400 yards – (410) Jake Spitzelberger, Nebraska-Kearney, 10/16/2010500 yards – (513) J.J. Harp, Eastern New Mexico, 8/29/2009
RECEIVING100 yards – (282) Kyle Kaiser, Nebraska-Kearney, 10/16/2010150 yards – (282) Kyle Kaiser, Nebraska-Kearney, 10/16/2010200 yards – (282) Kyle Kaiser, Nebraska-Kearney, 10/16/2010Reception over 80 yards – (85) Adrian Andrews from Scott Loveland, Central Mis-souri, 9/3/198310 receptions – (11) Jerrod Doucet, Colorado Mines, 10/9/20103 Receiving Touchdowns – (3) Kyle Kaiser, Nebraska-Kearney, 10/16/2010
RUSHING100 yards – (133) Rustin Dring, Nebraska-Kearney, 10/16/2010200 yards – (237) Bobby Coy, Mesa State, 10/11/2008300 yards – (332) Tom Evans, Fort Hays State, 10/31/1970Rush of 75 yards – (98) Rustin Dring, Nebraska-Kearney, 10/4/20083 rushing touchdowns in one game – Ed Goodlow, Central State, 9/8/1984
DEFENSEInterception Return for a TD – Randy Preston (100 yards), Central State, 11/13/1982Fumble Return for a TD – Rocco DeLorenzen (6 yards), Adams State, 11/8/2008Scored a safety – Team, Adams State, 11/8/2008
SPECIAL TEAMSField goal of 50 yards – NeverKickoff return of 80 yards – (88) Milt Cherry, Western New Mexico, 11/1/2008Blocked a PAT – Texavier Henry, Eastern New Mexico, 8/29/2009Blocked a Field Goal – Omer Tamir, Western State, 10/24/2009Blocked a Punt – Shane Carraher, Nebraska-Kearney, 10/3/2009Kickoff Return for a Touchdown – N/APunt Return for a TD – Mike Scialla, Colorado Mines, 10/27/1984Three Field Goals in a Game – (3) Kevin Berg, Chadron State, 10/2/2010Four Field Goals in a Game – (4) Jared Keating, Mesa State, 10/11/2008Punt for 60 yards – (60) Greg Rivara, New Mexico Highlands, 10/17/2009
49
a 21-point first quarter carries thunderwolves to 26-14 win
goodwell, okla. – Though the game had its share of first-game jitters, CSU-Pueblo had an of-fensive explosion with 21 first quarter points, pro-viding enough mileage to claim a 26-14 win over Oklahoma Panhandle State Saturday.
The Pack responded to a well-organized game-opening touchdown scoring drive by the Aggies, shrugging off the early 7-0 deficit to score three touchdowns, two coming on big gains.
After Jesse Lewis (Jr., Loveland, Colo.) ran in a 10-yard score on a pretty drive that saw quarter-back Ross Dausin (So., San Antonio, Tex.) hit his tight ends for three huge receptions, the game was tied at 7.
On the next possesion, which started with a pick by cornerback Grant Crunkleton (Sr., Denver, Colo.), Lewis culminated the drive with a 41-yard touchdown run to give the Pack a 14-7 lead.
After a three-and-out possesion by the Aggies, Dausin connected on his first Division II touchdown pass with a 55-yard strike to Bernard Jackson (Sr., Corona, Calif.), taking a 21-7 lead and leaving the Aggies to play catchup.
2010 SEASON-IN-REVIEW: GAME 1CSU-PUEBLO AT OKLAHOMA PANHANDLE STATEsatuRday, august 28, 2010 • caRl wooten Field • goodwell, okla. • (2,500)
14
26
Members of the Pack offensive line, including guard J.T. Haddan (left) and tackles Ryan Jensen (center) and Drew Swartz (right) helped pave the way toward 149 rushing yards vs. Oklahoma Panhandle State. Photo by Bill Sabo, Pro Action Photos
csu-pueblo 21 2 0 3 – 26okla. panhandle st. 7 0 0 7 – 14scoRing summaRy:
1st quarter08:45 OPSU Doug Williams 5 yd pass from Kevin Lauchland (Kevin Lauchland kick) Drive: 12 plays, 64 yards, TOP 6:15 CSUP 0 - OPSU 7 06:12 CSUP Jesse Lewis 10 yd run (Kyle Major kick) Drive: 7 plays, 71 yards, TOP 2:23 CSUP 7 - OPSU 7 02:03 CSUP Jesse Lewis 41 yd run (Kyle Major kick) Drive: 4 plays, 51 yards, TOP 0:37 CSUP 14 - OPSU 7 00:00 CSUP Bernard Jackson 55 yd pass from Ross Dausin (Kyle Major kick) Drive: 1 play, 74 yards, TOP 0:26 CSUP 21 - OPSU 7
2nd quarter 08:40 CSUP Damon Schiele safety Drive: N/A CSUP 23 - OPSU 7
4th quarter12:50 OPSU Isaiah Warren 22 yd pass from Kevin Lauchland (Carlos Nieto kick) Drive: 5 plays, 51 yards, TOP 2:10 CSUP 23 - OPSU 14 09:57 CSUP Kyle Major 33 yd field goal Drive: 6 plays, 41 yards, TOP 3:01 CSUP 26 - OPSU 14
team statistics: CSUP OPSUFIRST DOWNS 20 20RUSHES-YARDS (NET) 30-149 32-108PASSING YDS (NET) 200 233Passes Att-Comp-Int 32-16-2 44-24-3TOTAL OFFENSE PLAYS-YARDS 62-349 76-341Fumble Returns-Yards 0-0 0-0Punt Returns-Yards 1-14 3-26Kickoff Returns-Yards 4-57 5-52Interception Returns-Yards 3-11 2-49Punts (Number-Avg) 6-44.2 4-38.2Fumbles-Lost 0-0 0-0Penalties-Yards 12-105 17-161Possession Time 25:51 34:03Third-Down Conversions 1 of 11 6 of 17Fourth-Down Conversions 1 of 2 1 of 4Red-Zone Scores-Chances 2-4 1-2Sacks By: Number-Yards 5-27 2-13
individual stats:RUSHING: CSU-Pueblo-Jesse Lewis 24-151; Marquise Enoch 1-6; Ross Dausin 5-minus8. Okla. Panhandle St.-Jose Mendoza 9-38; Steve Olopo 1-28; Zacchaeus McCaskill9-19; Kevin Lauchland 8-10; Darryl Brister 3-9; Carlos Perez 1-2; Leon King 1-2.PASSING: CSU-Pueblo-Ross Dausin 16-32-2-200. Okla. Panhandle St.-Kevin Lauchland24-44-3-233. RECEIVING: CSU-Pueblo-Bernard Jackson 4-77; Jared Sperber 3-42; Da’QuanCartwright 3-19; Derek Gainey 2-30; Roger Pfannenschmid 2-17; Koby Wittek 1-13;Marquise Enoch 1-2. Okla. Panhandle St.-Doug Williams 8-70; Tyler Northcut 6-49;Tyler Bennett 3-16; Zacchaeus McCaskill 2-18; Steve Olopo 1-25; Isaiah Warren1-22; Jose Mendoza 1-18; Joffrey Wallace 1-14; Christopher Person 1-1. INTERCEPTIONS: CSU-Pueblo-Lee Meisner 1-11; Grant Crunkleton 1-0; Damon Schiele1-0. Okla. Panhandle St.-Christopher Robinson 1-40; Jose Huerta 1-9. FUMBLES: CSU-Pueblo-None. Okla. Panhandle St.-None.
The lead was extended the second quarter when a punt by Brandon Kliesen (RFr., Pueblo, Colo.) pinned Panhandle in-side their own 5-yard line and led to a safety by Damon Schiele (RSo., Aurora, Colo.), padding the Pack’s advantage even further.
Though the second half was anemic for the Pack, CSU-
Pueblo was helped along by its tenacious defense that kept the Aggies in check, as well as gifts in the form of penalties by the Aggies. Panhandle was charged with mind-boggling 264 yards in penalties on the night.
The Pack was led by Lewis, who ran for 133 yards and two scores, and Jackson, who converted 64 receiving yards.
50
pack becomes first Rmac team to move to 2-0 with convincing win.
pueblo, colo. – In 2009, CSU-Pueblo travelled to Alva, Okla. to take on a Northwestern Oklahoma State team regarded as one of the top NAIA teams in the nation, and lost a heartbreaker 34-28.
Saturday night, CSU-Pueblo showed what it looked like to purge a 365-day-old grudge, an-nihilating Northwestern Oklahoma State 55-13 at the Neta and Eddie DeRose ThunderBowl in the Pack’s 2010 home opener.
The win vaulted the Pack to 2-0 on the young season, putting them in the enviable position of being the only RMAC squad to be undefeated through two weeks of the season.
The Pack started slow, enduring a few three-and-outs and a lackluster running game before the passing game and defense helped lift the team to the stratosphere.
The first strike came on a 63-yard touchdown toss from Ross Dausin (So., San Antonio, Tex.) to Da’Quan Cartwright (Jr., Pueblo, Colo.), to give the Pack a 7-0 first quarter lead.
In the second quarter, the ThunderWolves all
2010 SEASON-IN-REVIEW: GAME 2NORTHWESTERN OKLAHOMA STATE AT CSU-PUEBLOsatuRday, septembeR 4, 2010 • neta & eddie deRose thundeRbowl • pueblo, colo. • (6,723)
55
13
In his first home start, CSU-Pueblo quarterback Ross Dausin nearly broke a single game record for passing yardage with 304 yards, going a very efficient 16-for-21 passing. Photo by Bill Sabo, Pro Action Photos
nw oklahoma state 0 6 0 7 – 13csu-pueblo 7 24 17 7 – 55scoRing summaRy:
1st quarter01:42 CSUP Da’Quan Cartwright 63 yd pass from Ross Dausin (Kyle Major kick)Drive: 1 play, 63 yards, TOP 0:11 NWOSU 0 - CSUP 7
2nd quarter 13:29 CSUP Kyle Major 47 yd field goal Drive: 4 plays, 9 yards, TOP 1:33 NWOSU 0 - CSUP 10 11:03 CSUP Da’Quan Cartwright 2 yd pass from Ross Dausin (Kyle Major kick) Drive: 3 plays, 28 yards, TOP 1:10 NWOSU 0 - CSUP 17 07:40 NWOSU J. Jackson 36 yd pass from K. Jech (E. Colmenares kick failed) Drive: 10 plays, 83 yards, TOP 3:18 NWOSU 6 - CSUP 17 02:10 CSUP Koby Wittek 2 yd pass from Jamaal Johnson (Kyle Major kick) Drive: 5 plays, 47 yards, TOP 3:14 NWOSU 6 - CSUP 24 01:16 CSUP Grant Crunkleton 30 yd interception return (Kyle Major kick) Drive: N/A NWOSU 6 - CSUP 31
3rd quarter 11:30 CSUP Jamaal Johnson 39 yd pass from Ross Dausin (Kyle Major kick) Drive: 8 plays, 75 yards, TOP 3:24 NWOSU 6 - CSUP 38 05:40 CSUP Kyle Major 40 yd field goal Drive: 8 plays, 34 yards, TOP 3:34 NWOSU 6 - CSUP 41 01:44 CSUP Jamaal Johnson 27 yd run (Kyle Major kick) Drive: 5 plays, 80 yards, TOP 2:49 NWOSU 6 - CSUP 48
4th quarter 07:23 CSUP Giovanni Rider 1 yd run (Kyle Major kick) Drive: 4 plays, 21 yards, TOP 2:19 NWOSU 6 - CSUP 55 04:15 NWOSU J. Jackson 5 yd run (E. Colmenares kick) Drive: 9 plays, 80 yards, TOP 3:08 NWOSU 13 - CSUP 55
team statistics: NWOSU CSUPFIRST DOWNS 17 16RUSHES-YARDS (NET) 40-152 39-86PASSING YDS (NET) 148 316Passes Att-Comp-Int 31-13-1 26-19-0TOTAL OFFENSE PLAYS-YARDS 71-300 65-402Fumble Returns-Yards 0-0 0-0Punt Returns-Yards 4--28 6-48Kickoff Returns-Yards 4-78 2-34Interception Returns-Yards 0-0 1-30Punts (Number-Avg) 10-37.1 6-36.3Fumbles-Lost 3-2 3-0Penalties-Yards 9-70 6-65Possession Time 26:12 33:42Third-Down Conversions 4 of 16 6 of 14Fourth-Down Conversions 0 of 1 0 of 1Red-Zone Scores-Chances 1-1 4-4Sacks By: Number-Yards 2-21 3-14
individual stats:RUSHING: NW Oklahoma State-J. Jackson 16-85; N. Guillory 14-52; K. Williams3-11; C. Smith 1-9; K. Jech 6-minus 5. CSU-Pueblo-Jamaal Johnson 17-73;Dominique Harris 14-28; Bernard Jackson 2-5; Marquise Enoch 1-2; Giovanni Rider1-1; Josh Salazar 1-0; Ross Dausin 3-minus 23. PASSING: NW Oklahoma State-K. Jech 13-31-1-148. CSU-Pueblo-Ross Dausin16-21-0-304; Troy Graham 1-2-0-12; Bernard Jackson 1-2-0-minus 2; Jamaal Johnson1-1-0-2. RECEIVING: NW Oklahoma State-J. Jackson 3-51; K. Williams 3-19; C. Womack 2-41;K. McDonald 1-12; M. Lebeda 1-12; M. Frame 1-12; B. Wardlaw 1-1; N. Guillory1-0. CSU-Pueblo-Bernard Jackson 4-78; Da’Quan Cartwright 3-71; Jamaal Johnson3-53; Jared Sperber 2-46; Josh Sandoval 2-29; Koby Wittek 2-9; RogerPfannenschmid 1-22; Derek Gainey 1-10; Marquise Enoch 1-minus 2. INTERCEPTIONS: NW Oklahoma State-None. CSU-Pueblo-Grant Crunkleton 1-30. FUMBLES: NW Oklahoma State-J. Jackson 1-0; K. Jech 1-1; C. Jones 1-1.
but put the game away, converting another touchdown toss from Dausin to Cartwright, then breaking the Rangers’ back when Grant Crunkleton (Sr., Denver, Colo.) scored on a pick-six interception return, part of a 24-point second quarter by CSU-Pueblo. The Pack carried a 31-6 lead into halftime and never looked back.
By the time the smoke cleared, CSU-Pueblo had netted 55 points, the most points scored by a ThunderWolf squad since it hung 57 on Fort Lewis in 1965, and the passing game came within a hair of busting school records. Dausin turned in one of the most efficient passing games in school history, going 16-for-21 with 304 yards, five yards shy of a school record, and three touchdown tosses. As a unit, the ThunderWolves passed 19-for-26 for four scores and 316 yards, also three yards shy of a school record.
Offensively, the Pack turned in 402 total yards, and held NWOSU quarterback, Kyle Jech, to just a 13-for-31 day with one pick. The Rangers’ All-American tailback, Nate Guillory, mustered just 52 yards after torching the Pack for 130 a year ago.
With the win, CSU-Pueblo will get a bye week before hitting the field again in its RMAC opener Sept. 18 against Adams State, also at the ThunderBowl. Despite the fast start, CSU-Pueblo coach, John Wristen, said no level of cockiness is set-ting in, even after putting up 55.
“We’re very excited about our offensive personnel, espe-cially with our defense playing lights out,” Wristen said. “But this doesn’t send any message to the RMAC. We still have to show up and get ready for conference play.”
51
halftime deadlock broken open by special teams, defensive scores.
pueblo, colo. – With a sparkling defensive effort and stellar special teams play, the ThunderWolves were able to open RMAC play with a decisive 27-10 victory over Adams State.
The first half proved to be a defensive merry-go-round with each team exchanging positions constant-ly throughout the half. Both defenses were stout, only giving up a field goal apiece after one half of play.
The Pack passing game struggled, gaining only 34 yards the first half, even having a long would-be touchdown reception axed because of a penalty. Pack head coach John Wristen had to tell his team to put the lackluster half in perspective and move on.
“I just told the guys to mentally flush the half down the toilet,” he said.
The comment seemed to spark the Thunder-Wolves, especially on special teams. To begin the second half, Marquise Enoch (Sr., Denver, Colo.) returned the opening kickoff 97 yards and taking it to the house, outrunning would-be tacklers in a sideline sprint, putting the Pack up 10-3.
“We practiced (setting up special teams) this whole week to make the defense pursue the inside of the kickoff coverage to open up the sidelines,” Enoch said.
“The blocking was so good that even I could have run that one back,” head coach John Wristen quipped about Enoch’s return.
The Pack netted more kickoff return yards against Adams State (99) than in its previous two games combined. The unit is finally starting to fire on all cylinders, Enoch said.
“We had been slouching the previous two games (on special teams) and this week we practiced hard to make sure we were strong in that part of the game,” Enoch said.
Late in the third quarter, linebacker Damon Schiele (So., Aurora, Colo.) picked off Grizzlies’ quarterback Trevor Eggleston attempted screen pass
2010 SEASON-IN-REVIEW: GAME 3ADAMS STATE AT CSU-PUEBLOsatuRday, septembeR 11, 2010 • neta & eddie deRose thundeRbowl • pueblo, colo. • (6,068)
27
10
CSU-Pueblo kick returner Marquise Enoch gave the Pack the lift it needed with a kickoff return for a touchdown to open the second half and break a halftime tie Photo courtesy of the Pueblo Chieftain
adams state 3 0 0 7 – 10 csu-pueblo 0 3 21 3 – 27 scoRing summaRy:
1st quarter04:45 ASC David Van Voris 23 yd field goal Drive: 9 plays, 29 yards, TOP 3:30 ASC 3 - CSUP 0
2nd quarter 00:24 CSUP Kyle Major 27 yd field goal Drive: 10 plays, 25 yards, TOP 3:23 ASC 3 - CSUP 3
3rd quarter 14:46 CSUP Marquise Enoch 97 yd kickoff return (Kyle Major kick) Drive: N/A ASC 3 - CSUP 10 06:00 CSUP Damon Schiele 39 yd interception return (Kyle Major kick) Drive: N/A ASC 3 - CSUP 17 03:11 CSUP Jesse Lewis 18 yd run (Kyle Major kick) Drive: 3 plays, 25 yards, TOP 0:53 ASC 3 - CSUP 24
4th quarter 14:56 ASC Thomas Brown 4 yd pass from Trevor Eggleston (David Van Voris kick) Drive: 7 plays, 73 yards, TOP 3:07 ASC 10 - CSUP 24 05:51 CSUP Kyle Major 32 yd field goal Drive: 10 plays, 17 yards, TOP 4:00 ASC 10 - CSUP 27
team statistics: ASC CSUPFIRST DOWNS 16 16RUSHES-YARDS (NET) 24-60 44-164PASSING YDS (NET) 165 52Passes Att-Comp-Int 36-21-4 19-7-2TOTAL OFFENSE PLAYS-YARDS 60-225 63-216Fumble Returns-Yards 0-0 0-0Punt Returns-Yards 3-38 2-47Kickoff Returns-Yards 4-90 2-99Interception Returns-Yards 2-1 4-90Punts (Number-Avg) 5-24.2 5-42.2Fumbles-Lost 2-0 2-1Penalties-Yards 7-80 12-120Possession Time 28:08 31:52Third-Down Conversions 3 of 13 6 of 15Fourth-Down Conversions 1 of 1 1 of 1Red-Zone Scores-Chances 2-3 3-3Sacks By: Number-Yards 1-4 2-6
individual stats:RUSHING: Adams State-Terjean Saffold 14-37; Chris Jamison 3-10; Trevor Eggleston5-9; Thomas Brown 2-4. CSU-Pueblo-Jesse Lewis 15-70; Bernard Jackson 12-45;Jamaal Johnson 11-36; Giovanni Rider 1-7; Josh Salazar 1-6; Ross Dausin 4-0. PASSING: Adams State-Trevor Eggleston 21-36-4-165. CSU-Pueblo-Ross Dausin7-18-2-52; Jamaal Johnson 0-1-0-0. RECEIVING: Adams State-Delton Prescott 4-46; Shane McBurney 4-34; Trevor Zott4-31; Dustin Bolt 3-30; Terjean Saffold 2-8; Mohamad Hasoon 1-10; Thomas Brown1-4; JB Hall 1-2; Scott Kellogg 1-0. CSU-Pueblo-Josh Sandoval 3-2; Jesse Lewis2-29; Jared Sperber 1-12; Bernard Jackson 1-9. INTERCEPTIONS: Adams State-Bryant Williams 1-2; Rocco DeLorenzo 1-minus 1.CSU-Pueblo-Chris Brown 2-31; Damon Schiele 1-39; Grant Crunkleton 1-20. FUMBLES: Adams State-Terjean Saffold 1-0; Trevor Zott 1-0. CSU-Pueblo-MarquiseEnoch 1-0; Bernard Jackson 1-1.
and returned the interception 39 yards for a touchdown.Up 17-3, the Pack finally got their offense rolling when running back Jesse
Lewis (Jr., Loveland, Colo.) broke through on an 18-yard-run to extend the lead 24-3.
The ThunderWolves’ defense was relentless throughout the game, only giv-ing up a vanity fourth quarter touchdown after the final outcome was all but decided.
The cornerback pairing of Grant Crunkleton (Sr., Denver, Colo.) and Chris Brown (Sr., Aurora, Colo.) shined by intercepting the Grizzles three times inside the 10-yard-line on probable touchdown throws. Brown recorded two picks, each inside the five-yard line, and Crunkleton added a fourth quarter interception. All told, the duo had their hands in on six Grizzly passes, picking off three.
“On offense we have to manage the game, but tonight we just weren’t sharp, and the defense picked us up,” Wristen said.
The Pack added to their lead with a late fourth quarter field goal by kicker Kyle Major, to put them up for good 27-10.
This win marks the first time the ThunderWolves have started 3-0 since 1980, which is also the only time they have won an RMAC championship.
“It feels good to be 3-0 rather than 0-3,” Wristen said about the start of the season.
AFCA D-II Coaches’ Poll – 9/6/20101. Grand Valley St. (Mich.) (21) 1-0 641 2 2. Minnesota-Duluth (2) 1-0 616 33. North Alabama (3) 1-0 605 4 4. California (Pa.) 1-0 565 5 5. Abilene Christian (Texas) 1-0 551 6 6. Texas A&M-Kingsville 1-0 503 147. West Alabama 2-0 471 10 8. Northwest Missouri St. 0-1 419 19. West Texas A&M 0-1 356 8 10. Tuskegee (Ala.) 1-0 348 15 11. Hillsdale (Mich.) 1-0 342 16 12. Central Washington 1-1 337 1313. Midwestern St. (Texas) 1-0 312 1714. Missouri Western St. 1-0 294 19 15. Washburn (Kan.) 1-1 269 916. Saginaw Valley St. (Mich.) 0-1 232 11 17. North Carolina-Pembroke 1-0 219 23 18. Minnesota St.-Mankato 1-0 200 18 19. Winona St. (Minn.) 1-0 129 2420t. Carson-Newman (Tenn.) 1-1 119 20 20t. West Liberty (W.Va.) 0-1 119 722. Wayne St. (Neb.) 1-0 115 2523. Nebraska-Kearney 1-1 106 NR 24. Edinboro (Pa.) 1-0 84 NR 25. East Stroudsburg (Pa.) 1-0 81 NR
Dropped Out: Nebraska-Omaha (12), West Chester (Pa.) (21), Delta St. (Miss.) (22).
Others Receiving Votes: Valdosta St. (Ga.), 77; Nebraska-Omaha, 58; Bemidji St. (Minn.), 51; Central Missouri, 30; Au-gustana (S.D.), 24; West Chester (Pa.), 24; Delta St. (Miss.), 23; Ashland (Ohio), 22; Morehouse (Ga.), 18; Texas A&M-Commerce, 14; Colorado School of Mines, 11; Albany St. (Ga.), 10; Shepherd (W.Va.), 10; Tarleton St. (Texas), 10; Indiana (Pa.), 9; Tusculum (Tenn.), 6; Shaw (N.C.), 5; Wayne St. (Mich.), 5; C.W. Post (N.Y.), 4; Concord (W.Va.), 2; Colorado St.-Pueblo, 1; Ouachita Baptist (Ark.), 1; Pittsburg St. (Kan.), 1; St. Augustine’s (N.C.), 1.
52
thunderwolves post 35 unanswered points to rout skyhawks
duRango, colo. – Ask any football coach and he’ll tell you that big plays on defense can help define a game.
Near the close of the second half, that big play was turned in by true freshman defensive lineman, Beau Martin (Fr., Littleton, Colo.), who forced a fumble with less than three minutes remaining in the half, leading to a go-ahead score by the Pack, who carried a 21-14 lead into halftime and never looked back.
“I knew we had to be patient,” Pack head coach John Wristen said about the back-and-forth game in the first half. “Sooner or later, we were going to get some big plays and that’s what we got.”
After Martin’s big play, the rushing game caught fire, as did the defense’s ability to make even more noise.
On the ground, CSU-Pueblo logged a season-high 324 rushing yards, including 100-plus yard rushing days for both Jesse Lewis (Jr., Loveland, Colo.) and Jamaal Johnson (Jr., Fountain, Colo.), the first time this season that the Pack’s “thunder and lightning” combo each had 100-yard days in the same game. Each ran for two touchdown scores, as well.
Defensively, a pair of interception returns for touch-downs paved the way, the first coming from Jason Campbell (RSo., Kailua, Hawaii), who picked off a Tim Jenkins pass and promptly lateralled to Grant Crunkleton (Sr., Denver, Colo.), who rumbled 40
yards for his second defensive touchdown of the season.
Then with the game out of hand in the fourth quar-ter, reserve cornerback Mark Sterling (So., Colo-rado Springs, Colo.) turned a would-be cosmetic touchdown by Fort Lewis into a “pick six,” picking off a pass and returning it 97 yards for a score, the sec-ond longest interception return in school history (Keno Aleman recorded a 100-yard interception return, an NCAA record, in 1967).
All told, with the interception heroics, and a quality kickoff return game, CSU-Pueblo turned in 737 all-
2010 SEASON-IN-REVIEW: GAME 4CSU-PUEBLO AT FORT LEWISsatuRday, septembeR 25, 2010 • Ray dennison Field • duRango, colo. • (1,335)
14
49
CSU-Pueblo cornerback Mark Sterling (12) returned this interception 97 yards for a touchdown, the longest intercep-tion return for a touchdown since 1967 and the second of the game for the Pack. Photo by Bill Sabo, Pro Action Photos
csu-pueblo 7 14 14 14 – 49FoRt lewis 0 14 0 0 – 14scoRing summaRy:
1st quarter09:29 CSUP Jesse Lewis 3 yd run (Kyle Major kick) Drive: 12 plays, TOP 5:31 CSUP 7 - FLC 0
2nd quarter10:22 FLC Deric Davis 45 yd pass from Tim Jenkins (Rich Rodriguez kick) Drive: 6 plays, TOP 2:55 CSUP 7 - FLC 7 09:05 CSUP Jesse Lewis 4 yd run (Kyle Major kick) Drive: 3 plays, TOP 1:04 CSUP 14 - FLC 7 05:47 FLC Justin Johnson 41 yd pass from Tim Jenkins (Rich Rodriguez kick) Drive: 8 plays, TOP 3:13 CSUP 14 - FLC 14 00:52 CSUP Jamaal Johnson 3 yd run (Kyle Major kick) Drive: 5 plays, TOP 1:48 CSUP 21 - FLC 14
3rd quarter10:15 CSUP Ross Dausin 1 yd run (Kyle Major kick) Drive: 5 plays, TOP 2:25 CSUP 28 - FLC 14 05:25 CSUP Jamaal Johnson 41 yd run (Kyle Major kick) Drive: 5 plays, TOP 2:09 CSUP 35 - FLC 14
4th quarter14:44 CSUP Grant Crunkleton 40 yd interception return (Kyle Major kick) Drive: N/A CSUP 42 - FLC 14 02:36 CSUP Mark Sterling 97 yd interception return (Kyle Major kick) Drive: N/A CSUP 49 - FLC 14
team statistics: CSUP FLCFIRST DOWNS 18 20RUSHES-YARDS (NET) 34-324 28-89PASSING YDS (NET) 157 284Passes Att-Comp-Int 21-13-1 49-29-3TOTAL OFFENSE PLAYS-YARDS 55-481 77-373Fumble Returns-Yards 0-0 0-0Punt Returns-Yards 3-0 2-7Kickoff Returns-Yards 3-112 4-85Interception Returns-Yards 3-144 1-17Punts (Number-Avg) 3-50.0 6-45.2Fumbles-Lost 2-1 1-1Penalties-Yards 7-105 6-71Possession Time 24:57 35:03Third-Down Conversions 4 of 10 7 of 18Fourth-Down Conversions 0 of 0 0 of 0Red-Zone Scores-Chances 4-6 0-1Sacks By: Number-Yards 3-22 0-0
individual stats:RUSHING: CSU-Pueblo-Jesse Lewis 13-178; Jamaal Johnson 12-135; Giovanni Rider 2-7; Jona-than Gaye 2-7; Bernard Jackson 1-1; Ross Dausin 4-minus 4. Fort Lewis-Justin Peters 7-45; A.J. Miko 8-37; Sam Apraku 5-29; Blaise Cuban 1-2; Justin Johnson 1-1; Tim Jenkins 6-minus 25. PASSING: CSU-Pueblo-Ross Dausin 10-16-1-148; Sebastian Trujillo 2-4-0-6; Bernard Jackson 1-1-0-3. Fort Lewis-Tim Jenkins 29-49-3-284. RECEIVING: CSU-Pueblo-Da’Quan Cartwright 3-22; Roger Pfannenschmid 2-50; Derek Gainey 2-22; Bernard Jackson 2-22; Josh Sandoval 1-20; Koby Wittek 1-9; Jamaal Johnson 1-4; Josh Bredl 1-2; Jesse Lewis 0-6. Fort Lewis-Justin Johnson 7-102; Doyle Bode 4-21; Deric Davis 3-56; Justin Garman 3-27; Blaise Cuban 3-14; Zach Moisey 3-10; B. Schneider 2-16; Justin Peters 2-15; H. Scheider 1-12; Sam Apraku 1-11. INTERCEPTIONS: CSU-Pueblo-Mark Sterling 1-97; Chris Brown 1-5; Jason Campbell1-2; Grant Crunkleton 0-40. Fort Lewis-Phil Odell 1-17. FUMBLES: CSU-Pueblo-Ross Dausin 1-1; Marquise Enoch 1-0. Fort Lewis-Tim Jenkins 1-1.
purpose yards, a school record for a single game output. And defensively, the Pack employed the “bend but don’t break” approach, giving up nearly 400 total yards but allowing just 14 points, the fourth time in as many games that the Pack held its opponent to 14 points or less.
“Though our defense gave up a lot of yards, they only gave up those 14 points and it was a pretty good day for that unit,” Wristen said. “They seized the moment and played hard from the first snap to the last, and guys took turns making that big play.”
With the win, CSU-Pueblo continues its undefeated start, at 4-0 overall and 2-0 in RMAC play. The 4-0 start is its best since 1980 (when it won its only RMAC title) and its overall win streak of eight (dating back to last season) is the second-longest in school history.
But keeping these streaks alive will not be an easy task. The Pack returns home next week for “Homecoming” against a very daunting opponent, Chadron State, which the Pack beat last season in Chadron. It is a game that the Eagles have had circled on their calendar since last season.
AFCA D-II Coaches’ Poll – 9/20/20101. Grand Valley St. (Mich.) (19) 3-0 641 12. Minnesota-Duluth (4) 3-0 620 2 3. North Alabama (3) 3-0 604 3 4. California (Pa.) 3-0 558 4 5. Abilene Christian (Texas) 3-0 552 56. Texas A&M-Kingsville 3-0 519 67. Northwest Missouri St. 1-1 463 7 8. Missouri Western St. 3-0 441 11 9. West Texas A&M 2-1 428 910. Midwestern St. (Texas) 3-0 374 12 11. Minnesota St.-Mankato 3-0 359 16 12. Hillsdale (Mich.) 2-1 350 1313. Edinboro (Pa.) 3-0 280 22 14. Carson-Newman (Tenn.) 2-1 278 19 15. Tusculum (Tenn.) 4-0 219 24 16. Albany St. (Ga.) 3-0 203 NR 17. West Alabama 2-1 196 818. West Liberty (W.Va.) 1-1 193 2119. Nebraska-Kearney 2-1 168 23 20. Morehouse (Ga.) 4-0 123 NR 21. Central Missouri 3-1 116 NR 22. Central Washington 2-2 115 25 23. Delta St. (Miss.) 2-1 97 NR 24. Augustana (S.D.) 3-0 82 NR25. Tuskegee (Ala.) 2-1 72 10
Dropped Out: North Carolina-Pembroke (14), Washburn (Kan.) (15), Winona St. (Minn.) (17), Wayne St. (Neb.) (18), Valdosta St. (Ga.) (20).
Others Receiving Votes: Winston-Salem St. (N.C.), 54; North Carolina-Pembroke, 51; Washburn (Kan.), 51; Wayne St. (Neb.), 48; Winona St. (Minn.), 46; Shepherd (W.Va.), 41; Valdosta St. (Ga.), 28; Wingate (N.C.), 20; Bloomsburg (Pa.), 13; Colorado School of Mines, 13; Colorado St.-Pueblo, 11; Michigan Tech, 11; Arkansas-Monticello, 7; Indianapolis (Ind.), 2; St. Cloud State (Minn.), 2; Ouachita Baptist (Ark.), 1.
53
pack pulls out triple-overtime thriller over chadron.
pueblo, colo. – Kyle Major (Jr., Littleton, Colo.) doesn’t take react well to failure.
When the ThunderWolves’ junior placekicker went 0-for-3 last week in a 49-14 win over Fort Lewis, he knew he had to get better, because he never knew when his team would need him.
Saturday, the kicker was needed by his team, and he delivered.
After an epic goal line stop by the ThunderWolf de-fense, in which three consecutive Chadron State quar-terback sneak attempts were stuffed at the goal line, Major knew he’d have to deliver the kick that would lift his team to a win in an triple-overtime masterpiece of a game.
To close out the third overtime, Major nailed a 34-yarder, upholding the Pack’s valiant defensive stand and sending the ThunderWolves to a 33-30 nail-biter of a win over Chadron State.
The win lifts the ThunderWolves to an RMAC-best 5-0 and 3-0 in conference play.
“I stayed after practice all week long to practice some technique stuff to stay accurate, Major said of his four field goal day, in which he took over the Pack’s career lead in field goals and broke a school record for most three-pointers in a single game. “On that final kick, I knew it was going to go right down the middle.”
The kicker may be the hero on the stat sheet, but this win was signed, sealed and notarized by the Pack’s
defensive front. Facing a Chadron State 2nd-and-goal from the two,
CSU-Pueblo halted a quarterback sneak attempt by Jonn McLain at the 1-yard-line. Then facing 3rd-and-an-inch, the Pack front rejected McLain again, then held for a third time as the Eagles tried to go for it all on 4th-and-goal.
The biggest thing that stands out to me in the first half was when we held them to a field goal. We turned over the ball and they punched them in. We didn’t panic and stayed the course, kept it within 10, and from there we had a chance to keep it close.
“How about that stop?” CSU-Pueblo head coach John
2010 SEASON-IN-REVIEW: GAME 5CHADRON STATE AT CSU-PUEBLOsatuRday, octobeR 2, 2010 • neta & eddie deRose thundeRbowl • pueblo, colo. • (6,431)
33
30
Kyle Major (10) and Pack special teamers celebrate after the game-winning overtime field goal vs. Chadron State. Photo by Bill Sabo, Pro Action Photos
chadRon state 10 0 3 7 10 – 30csu-pueblo 0 3 7 10 13 – 33scoRing summaRy:
1st quarter09:04 CSC Michael Ziola 23 yd field goal Drive: 13 plays, 75 yards, TOP 5:56 CSC 3 - CSUP 0 06:24 CSC Jonn McLain 1 yd run (Michael Ziola kick) Drive: 3 plays, 3 yards, TOP 1:24 CSC 10 - CSUP 0
2nd quarter13:58 CSUP Kyle Major 36 yd field goal Drive: 9 plays, 47 yards, TOP 3:37 CSC 10 - CSUP 3
3rd quarter13:59 CSUP Jesse Lewis 3 yd run (Kyle Major kick) Drive: 3 plays, 24 yards, TOP 0:47 CSC 10 - CSUP 10 00:01 CSC Michael Ziola 23 yd field goal Drive: 12 plays, 60 yards, TOP 6:11 CSC 13 - CSUP 10
4th quarter08:11 CSUP Bernard Jackson 23 yd run (Kyle Major kick) Drive: 7 plays, 54 yards, TOP 3:01 CSC 13 - CSUP 17 06:06 CSC Jeremy Sondrup 11 yd pass from Jonn McLain (Michael Ziola kick) Drive: 5 plays, 64 yards, TOP 1:58 CSC 20 - CSUP 17 02:23 CSUP Kyle Major 39 yd field goal Drive: 10 plays, 39 yards, TOP 3:43 20 - 20
OVertIMe15:00 CSC Michael Ziola 24 yd field goal Drive: 6 plays, 18 yards, TOP 0:00 CSC 23 - CSUP 20 15:00 CSUP Kyle Major 32 yd field goal Drive: 5 plays, 11 yards, TOP 0:00 CSC 23 - CSUP 23 15:00 CSUP Koby Wittek 16 yd pass from Ross Dausin (Kyle Major kick) Drive: 2 plays, 25 yards, TOP 0:00 CSC 23 - CSUP 30
15:00 CSC Nathan Ross 10 yd pass from Jonn McLain (Michael Ziola kick) Drive: 6 plays, 25 yards, TOP 0:00 CSC 30 - CSUP 30 15:00 CSUP Kyle Major 34 yd field goal Drive: 4 plays, 8 yards, TOP 0:00 CSC 30 - CSUP 33
team statistics: CSC CSUPFIRST DOWNS 22 20RUSHES-YARDS (NET) 56-226 44-239PASSING YDS (NET) 179 91Passes Att-Comp-Int 27-16-2 25-11-0TOTAL OFFENSE PLAYS-YARDS 83-405 69-330Fumble Returns-Yards 0-0 0-0Punt Returns-Yards 1-19 3-51Kickoff Returns-Yards 3-73 4-101Interception Returns-Yards 0-0 2-20Punts (Number-Avg) 5-45.2 4-41.0Fumbles-Lost 2-0 1-1Penalties-Yards 6-44 6-51Possession Time 35:01 24:59Third-Down Conversions 10 of 20 3 of 14Fourth-Down Conversions 0 of 1 1 of 1Red-Zone Scores-Chances 6-7 5-6Sacks By: Number-Yards 4-30 2-10
individual stats:RUSHING: Chadron State-Dominic Morris 20-122; Glen Clinton 25-102; Jonn McLain 11-2. CSU-Pueblo-Jesse Lewis 18-119; Bernard Jackson 11-84; Jamaal Johnson 10-57; Brandon Kliesen 1-11; Ross Dausin 4-minus 32. PASSING: Chadron State-Jonn McLain 16-27-2-179. CSU-Pueblo-Ross Dausin 11-24-0-91; Bernard Jackson 0-1-0-0. RECEIVING: Chadron State-Jeremy Sondrup 4-49; Glen Clinton 4-25; Jeff Alcorn 3-45; Nathan Ross 2-20; Travis Reeves 1-21; Quinell Atkins 1-15; Brandon Gunter 1-4. CSU-Pueblo-Koby Wit-tek 3-27; Bernard Jackson 3-19; Jesse Lewis 2-15; Josh Sandoval 2-14; Derek Gainey 1-16. INTERCEPTIONS: Chadron State-None. CSU-Pueblo-Jon Bailey 1-17; Josh Costa 1-3. FUMBLES: Chadron State-Quinell Atkins 1-0; Jonn McLain 1-0. CSU-Pueblo-Ross Dausin 1-1.
Wristen beamed after the game. “Three downs within a yard and they didn’t get in. I credit those defensive linemen. It was an amazing effort by them.”
“[The defensive line] is tough,” freshman defensive end Beau Martin (Fr., Little-ton, Colo.) said. “Every day in practice, we bring it. Our coaches teach us to be phsyical, and that’s what you have to do going up against a tough offensive line like Chadron’s.”
The game-ending fireworks were the dessert for a game that seemed to be all Eagles from the beginning. Chadron State jumped out to a 10-0 lead by the end of the first quarter, using a field goal and a turnover inside the 10-yard-line to jump to the early advantage.
The Pack was able to put up one field goal, but Major missed his second attempt from 23 yards out, leaving the game in the Eagles’ hands, 10-3, at halftime.
The second half started off with a big Pack play, as Marquise Enoch (Sr., Den-ver, Colo.) returned the opening kickoff 57 yards to set up the tying score, a three-yard burst by Jesse Lewis (Jr., Loveland, Colo.) to knot the game at 10.
After that, it was a brawl, as each team traded scores. But a risky play helped put momentum in the Pack’s hands.
Down 20-17 with just five minutes remaining and a four-and-out situation staring the Pack down, the ThunderWolves opted for a fake punt, sending punter Brandon Kliesen (RFr., Pueblo, Colo.) on a sprint for the first-down marker, which eventually led to the game-tying boot by Major from 39 yards out with 2:23 remaining.
After trading field goals to open up the first overtime, CSU-Pueblo went ahead 30-23 on a pretty bootleg throw to Koby Wittek (Jr., Golden, Colo.), who had to fully extend to bring in the hopeful winning score. But a Chadron score tied the game at 30, setting up the defensive stand that won the game for the Pack.
AFCA D-II Coaches’ Poll – 9/27/20101. Grand Valley St. (Mich.) (21) 4-0 644 12. Minnesota-Duluth (2) 4-0 620 23. North Alabama (3) 4-0 604 34. California (Pa.) 4-0 556 4 5. Abilene Christian (Texas) 4-0 551 56. Texas A&M-Kingsville 4-0 520 67. Northwest Missouri St. 2-1 497 78. Missouri Western St. 4-0 445 89. West Texas A&M 3-1 431 9 10. Midwestern St. (Texas) 4-0 409 1011. Hillsdale (Mich.) 3-1 359 12 12. Edinboro (Pa.) 4-0 329 13 13. Tusculum (Tenn.) 4-0 324 15 14. Albany St. (Ga.) 4-0 301 16 15. West Alabama 3-1 260 17 16. Central Missouri 4-1 236 2117. Nebraska-Kearney 3-1 198 19 18. Morehouse (Ga.) 5-0 186 2019. Delta St. (Miss.) 3-1 165 2320. Augustana (S.D.) 4-0 134 24 21. Central Washington 3-2 111 22 22. Tuskegee (Ala.) 3-1 103 25 23. Winston-Salem St. (N.C.) 5-0 87 NR24. North Carolina-Pembroke 3-1 78 NR25. Minnesota St.-Mankato 3-1 75 11
Dropped Out: Carson-Newman (Tenn.) (14), West Liberty (W.Va.) (18).
Others Receiving Votes: Shepherd (W.Va.), 54; Valdosta St. (Ga.), 30; Bloomsburg (Pa.), 29; Wingate (N.C.), 29; Colorado St.-Pueblo, 17; Michigan Tech, 16; Colorado School of Mines, 15; West Virginia Wesleyan, 8; Winona St. (Minn.), 7; Wayne St. (Neb.), 5; St. Cloud State (Minn.), 4; Carson-Newman (Tenn.), 3; Concordia-St. Paul (Minn.), 3; Ouachita Baptist (Ark.), 3; Arkansas Tech, 2; Northern Michigan, 2.
54
offsides penalty, last-second touchdown lifts mines over pack
golden, colo. – In what was almost another grip-ping win for the ThunderWolves, a game-saving drive and well-timed offsides penalty on CSU-Pueblo in the closing seconds was enough to lift Colorado School of Mines over the Pack - and the lead in the Rocky Mountain Athletic Conference - as the ThunderWolves fell 19-16.
Facing a 4th-and-goal from the ThunderWolf eight-yard-line with 34 seconds remaining and a 16-12 lead, CSU-Pueblo seemingly stopped a desperation try for the end zone by the Orediggers. But an offsides pen-alty on the ThunderWolves delivered another chance for Mines, who made the most of of their reprieve, as quarterback Clay Garcia delivered his second touch-down of the day to Jerrod Doucet, leaving the Pack without much time to stage a last-ditch comeback.
It undid what would have been an amazing win for the Pack, who put up countless big plays, especially on the defense, in the seesaw affair.
In the first half, facing the highest-octane offense in the RMAC, CSU-Pueblo picked off two passes in the end zone and blocked a field goal attempt in the first half, balancing out Mines’ tenacious defense which held the Pack all afternoon, giving CSU-Pueblo a 3-0 halftime lead.
After Mines took a 6-3 lead on a goal-line touch-down dive in the third quarter, the Pack matched it, going for it on 4th-and-goal at the one-yard-line and
hitting paydirt, as quarterback Ross Dausin (So., San Antonio, Tex.) ran in a score on a quarterback keeper to take a 10-6 lead.
Mines then one-upped the ThunderWolves with a 41-yard pass from Garcia to Doucet with 5:55 remain-ing, giving the Orediggers a 12-10 lead.
But CSU-Pueblo, which had trouble moving the ball most of the afternoon, cruised on the ensuing drive, connecting on a touchdown toss from Dausin to Gold-en-native, Koby Wittek (Jr., Golden, Colo.) to deliver a 16-12 lead with 3:40 left.
But after Mines’ big plays on the ensuing drive which led to the eventual touchdown, CSU-Pueblo
2010 SEASON-IN-REVIEW: GAME 6#25 CSU-PUEBLO AT COLORADO SCHOOL OF MINESsatuRday, octobeR 9, 2010 • campbell Field • golden, colo. • (3,216)
19
16
CSU-Pueblo defensive end Grant Jansen (88) closes in on Mines quarterback Clay Garcia for one of the Thunder-Wolves’ three sacks on the afternoon. Photo by Bill Sabo, Pro Action Photos
csu-pueblo 3 0 0 13 – 16coloRado mines 0 0 6 13 – 19scoRing summaRy:
1st quarter09:10 CSUP Kyle Major 32 yd field goal Drive: 7 plays, 46 yards, TOP 3:07 CSUP 3 - CSM 0
3rd quarter05:12 CSM Blaine Sumner 3 yd run (Paul McVay kick blockd) Drive: 14 plays, 80 yards, TOP 6:21 CSUP 3 - CSM 6
4th quarter11:49 CSUP Ross Dausin 1 yd run (Kyle Major kick) Drive: 12 plays, 64 yards, TOP 6:00 CSUP 10 - CSM 6 05:55 CSM Jerrod Doucet 41 yd pass from Clay Garcia (Paul McVay kick failed) Drive: 2 plays, 66 yards, TOP 0:36 CSUP 10 - CSM 12 03:40 CSUP Koby Wittek 25 yd pass from Ross Dausin (Bernard Jackson pass failed) Drive: 5 plays, 62 yards, TOP 2:08 CSUP 16 - CSM 12 00:30 CSM Jerrod Doucet 4 yd pass from Clay Garcia (Paul McVay kick) Drive: 12 plays, 80 yards, TOP 3:10 CSUP 16 - CSM 19
team statistics: CSUP CSMFIRST DOWNS 11 28RUSHES-YARDS (NET) 31-127 24-145PASSING YDS (NET) 140 396Passes Att-Comp-Int 24-14-0 61-38-2TOTAL OFFENSE PLAYS-YARDS 55-267 85-541Fumble Returns-Yards 0-0 0-0Punt Returns-Yards 3-42 5-22Kickoff Returns-Yards 4-78 1-20Interception Returns-Yards 2-37 0-0Punts (Number-Avg) 8-46.5 3-41.3Fumbles-Lost 1-0 3-0Penalties-Yards 10-80 4-40Possession Time 27:35 32:25Third-Down Conversions 4 of 14 6 of 15Fourth-Down Conversions 1 of 1 2 of 5Red-Zone Scores-Chances 2-2 2-5Sacks By: Number-Yards 3-9 4-14
individual stats:RUSHING: CSU-Pueblo-Jesse Lewis 10-38; Ross Dausin 10-36; Jamaal Johnson 5-33;Bernard Jackson 6-20. Colorado Mines-Dan Palmer 16-108; Cody Renken 1-21; BlaineSumner 3-9; Clay Garcia 4-7. PASSING: CSU-Pueblo-Ross Dausin 14-24-0-140. Colorado Mines-Clay Garcia38-61-2-396. RECEIVING: CSU-Pueblo-Josh Sandoval 4-54; Koby Wittek 4-52; Jesse Lewis 3-9;Bernard Jackson 2-13; Derek Gainey 1-12. Colorado Mines-Jerrod Doucet 11-141;Cody Renken 10-93; Robbin Vinnola 9-110; Dan Palmer 5-20; Tom Kastens 2-27; SamFrazier 1-5. INTERCEPTIONS: CSU-Pueblo-Jon Bailey 1-26; Damon Schiele 1-11. ColoradoMines-None. FUMBLES: CSU-Pueblo-Marquise Enoch 1-0. Colorado Mines-Clay Garcia 1-0; DanPalmer 1-0; Cody Renken 1-0.
simply ran out of time.Not even the big leg of kicker Kyle Major (Jr., Littleton, Colo.) could save the
Pack, who tried booting a 64-yard field goal in the closing seconds on a drive that could have very easily turned into at least a tying score if the Pack had more than 30 seconds to work with.
The loss, while stinging, was put in perspective by Pack head coach, John Wristen.
“They made the big plays when they had to and took advantage of the opportuni-ties they had,” Wristen said. “I’m proud of our guys and the fight they put in, but we just couldn’t stop them when we needed to.”
With the loss, CSU-Pueblo effectively falls from first place in the RMAC to third place with a 5-1 record and 3-1 mark in conference play, behind both Mines and Nebraska-Kearney, which are both 5-1 and 4-0 in RMAC play after Saturday’s games. Kearney defeated Chadron State 35-28 Saturday.
AFCA D-II Coaches’ Poll – 10/4/20101. Grand Valley St. (Mich.) (21) 5-0 644 12. Minnesota-Duluth (2) 5-0 620 2 3. North Alabama (3) 5-0 604 34. California (Pa.) 5-0 563 4 5. Abilene Christian (Texas) 5-0 548 56. Northwest Missouri St. 3-1 524 77. West Texas A&M 4-1 487 98. Midwestern St. (Texas) 5-0 424 109. Hillsdale (Mich.) 4-1 420 1110. Texas A&M-Kingsville 4-1 376 611. Albany St. (Ga.) 5-0 365 14 12. Central Missouri 5-1 344 16 13. Delta St. (Miss.) 4-1 285 1914. Nebraska-Kearney 4-1 279 17 15. Augustana (S.D.) 5-0 268 20 16. Morehouse (Ga.) 5-0 247 18 17. Winston-Salem St. (N.C.) 6-0 211 23 18. Tuskegee (Ala.) 4-1 201 22 19. Missouri Western St. 4-1 200 8 20. North Carolina-Pembroke 4-1 151 24 21. Shepherd (W.Va.) 5-0 124 NR 22. Valdosta St. (Ga.) 4-1 104 NR 23. Tusculum (Tenn.) 4-1 91 13 24. Edinboro (Pa.) 4-1 77 12 25. Colorado St.-Pueblo 5-0 57 NR
Dropped Out: West Alabama (15), Central Washington (21), Minnesota St.-Mankato (25).
Others Receiving Votes: Bloomsburg (Pa.), 55; Michigan Tech, 45; Winona St. (Minn.), 30; West Alabama, 28; West Virginia Wes-leyan, 27; Colorado School of Mines, 16; Wayne St. (Neb.), 11; Mars Hill (N.C.), 7; Kutztown (Pa.), 6; St. Cloud State (Minn.), 3; Humboldt St. (Calif.), 2; Indiana (Pa.), 2; Ouachita Baptist (Ark.), 2; Henderson St. (Ark.), 1; St. Augustine’s (N.C.), 1.
55
late surge, porous pass defense turns close game into near-blowout.
pueblo, colo. – Timing is everything.
It’s a lesson the CSU-Pueblo football team learned harshly Saturday, watching two would-be touchdowns erased on account of untimely mistakes as 13th-ranked Nebraska-Kearney turned a neck-and-neck affair into a near blowout, claiming a 38-24 win.
The loss is the second straight for CSU-Pueblo (5-2, 3-2 RMAC) and suddenly puts the Pack in a long-shot position for an RMAC title.
CSU-Pueblo’s second half performance unraveled a strong first half in which the offense was clicking and the defense was making its trademark key stops in the red zone.
An opening drive into the Pack’s red zone by Ne-braska-Kearney was held up as the Lopers took a 3-0 opening lead, and stopped a would-be Loper score on a fake field goal attempt in the first half.
Offensively, the Pack took a 7-3 lead on a 71-yard rush by Jesse Lewis (Jr., Loveland, Colo.) in the first quarter, and took a lead in the third quarter when Ross Dausin (So., San Antonio, Tex.) placed a perfect
throw into the hands of Derek Gainey (Sr., Aurora, Colo.) as the ThunderWolves claimed a 14-10 advan-tage midway through the third quarter.
But just as it had the previous two times it faced Nebraska-Kearney since 2008, both Loper blowouts, defensive breakdowns and a trio of offensive mistakes by CSU-Pueblo broke the game wide open for the Lopers.
The first hurtful mistake came as Nebraska-Kearney was up 24-14 in the fourth quarter, and Dausin hit Jar-ed Sperber (Jr., Oakley, Kan.) for a would-be 36-yard
2010 SEASON-IN-REVIEW: GAME 7#13 NEBRASKA-KEARNEY AT CSU-PUEBLOsatuRday, octobeR 16, 2010 • neta & eddie deRose thundeRbowl • pueblo, colo. • (6,431)
24
38
Koby Wittek (80) and Josh Sandoval (11) celebrate after a touchdown during the loss to the Lopers. Photo by Bill Sabo, Pro Action Photos
nebRaska-keaRney 3 7 7 21 – 38csu-pueblo 7 0 7 10 – 24scoRing summaRy:
1st quarter13:11 UNK Michael Gruber 36 yd field goal Drive: 6 plays, 52 yards, TOP 1:43 UNK 3 - CSUP 0 02:35 CSUP Jesse Lewis 71 yd run (Kyle Major kick) Drive: 2 plays, 77 yards, TOP 0:41 UNK 3 - CSUP 7
2nd quarter04:52 UNK Brendan Liess 6 yd pass from Jake Spitzlberger (Michael Gruber kick) Drive: 10 plays, 75 yards, TOP 4:16 UNK 10 - CSUP 7
3rd quarter08:25 CSUP Derek Gainey 32 yd pass from Ross Dausin (Kyle Major kick) Drive: 6 plays, 56 yards, TOP 2:34 UNK 10 - CSUP 14 05:28 UNK Kyle Kaiser 29 yd pass from Jake Spitzlberger (Michael Gruber kick) Drive: 8 plays, 80 yards, TOP 2:57 UNK 17 - CSUP 14
4th quarter14:57 UNK Rustin Dring 1 yd run (Michael Gruber kick) Drive: 10 plays, 66 yards, TOP 3:12 UNK 24 - CSUP 14 11:40 CSUP Kyle Major 30 yd field goal Drive: 10 plays, 31 yards, TOP 3:08 UNK 24 - CSUP 17 10:17 UNK Kyle Kaiser 71 yd pass from Jake Spitzlberger (Michael Gruber kick) Drive: 3 plays, 77 yards, TOP 1:17 UNK 31 - CSUP 17 04:39 UNK Kyle Kaiser 73 yd pass from Jake Spitzlberger (Michael Gruber kick) Drive: 3 plays, 80 yards, TOP 1:41 UNK 38 - CSUP 17 03:44 CSUP Josh Sandoval 7 yd pass from Ross Dausin (Kyle Major kick) Drive: 5 plays, 45 yards, TOP 0:50 UNK 38 - CSUP 24
team statistics: UNK CSUPFIRST DOWNS 20 23RUSHES-YARDS (NET) 48-177 32-172PASSING YDS (NET) 410 251Passes Att-Comp-Int 32-22-0 44-26-0TOTAL OFFENSE PLAYS-YARDS 80-587 76-423Fumble Returns-Yards 0-0 0-0Punt Returns-Yards 2-7 3-19Kickoff Returns-Yards 3-59 6-167Interception Returns-Yards 0-0 0-0Punts (Number-Avg) 4-36.5 6-38.5Fumbles-Lost 1-1 1-1Penalties-Yards 8-69 8-65Possession Time 32:07 27:53Third-Down Conversions 11 of 18 5 of 15Fourth-Down Conversions 1 of 2 1 of 2Red-Zone Scores-Chances 3-5 2-4Sacks By: Number-Yards 3-22 4-16
individual stats:RUSHING: Nebraska-Kearney-Rustin Dring 25-133; Alex Hutchison 7-23; JakeSpitzlberger 14-23; Team 2-minus 2. CSU-Pueblo-Jesse Lewis 19-151; JamaalJohnson 7-22; Bernard Jackson 1-12; Ross Dausin 5-minus 13. PASSING: Nebraska-Kearney-Jake Spitzlberger 22-31-0-410; Kyle Kaiser 0-1-0-0.CSU-Pueblo-Ross Dausin 23-41-0-234; Sebastian Trujillo 3-3-0-17. RECEIVING: Nebraska-Kearney-Kyle Kaiser 10-282; Eli Hammond 4-38; Brendan Liess3-40; Matt Berry 1-16; Dane Rudeen 1-16; Brett Klein 1-14; Matt Turco 1-8;Rustin Dring 1-minus 4. CSU-Pueblo-Josh Sandoval 6-66; Bernard Jackson 4-8;Derek Gainey 3-48; Jared Sperber 3-33; Koby Wittek 3-22; Roger Pfannenschmid2-40; Justin McCash 2-19; Marquise Enoch 1-8; Jamaal Johnson 1-4; Jesse Lewis1-3. INTERCEPTIONS: Nebraska-Kearney-None. CSU-Pueblo-None.FUMBLES: Nebraska-Kearney-Dane Rudeen 1-1. CSU-Pueblo-Jamaal Johnson 1-1.
catch-and-run touchdown. But a holding penalty undid the score and CSU-Pueblo would only add a field goal on the drive.
Later, as CSU-Pueblo was trailing 31-17, Jamaal Johnson (Jr., Fountain, Colo.) was a running a would-be touchdown into the end zone when he fumbled at the goal line, shooting the ball out of the end zone and handing the ball the Lopers on a touchback.
In each case, Nebraska-Kearney all-conference receiver Kyle Kaiser made big plays on the offensive side of the ball that made the ThunderWolves pay. He was wide open repeatedly, catching three touchdown passes, including a pair of 70-plus yard touchdown receptions in the fourth quarter. He finished with 10 catches for 282 yards while the Lopers put up 587 yards of offense.
CSU-Pueblo will try to regroup from the loss with a road trip to Mesa State next Friday night before returning home for a Hall of Fame Game showdown with New Mexico Highlands on Oct. 30.
AFCA D-II Coaches’ Poll – 10/11/20101. Grand Valley St. (Mich.) (20) 6-0 643 12. Minnesota-Duluth (4) 6-0 622 2 3. North Alabama (2) 6-0 600 3 4. California (Pa.) 6-0 560 4 5. Abilene Christian (Texas) 6-0 551 5 6. Northwest Missouri St. 4-1 529 6 7. West Texas A&M 5-1 495 78. Hillsdale (Mich.) 5-1 454 99. Texas A&M-Kingsville 5-1 415 1010. Albany St. (Ga.) 6-0 391 11 11. Central Missouri 6-1 371 12 12. Delta St. (Miss.) 5-1 346 13 13. Nebraska-Kearney 5-1 300 1414. Augustana (S.D.) 6-0 299 15 15. Midwestern St. (Texas) 5-1 291 8 16. Tuskegee (Ala.) 5-1 247 1817. Missouri Western St. 5-1 237 1918. Shepherd (W.Va.) 6-0 225 21 19. Valdosta St. (Ga.) 4-1 203 2220. Bloomsburg (Pa.) 5-1 132 NR21. West Virginia Wesleyan 6-0 93 NR 22. Morehouse (Ga.) 5-1 75 16 23. Kutztown (Pa.) 6-0 67 NR 24. Colorado School of Mines 5-1 51 NR 25. Winston-Salem St. (N.C.) 6-1 48 17
Dropped Out: North Carolina-Pembroke (20), Tusculum (Tenn.) (23), Edinboro (Pa.) (24), Colorado St.-Pueblo (25).
Others Receiving Votes: St. Augustine’s (N.C.), 44; Wayne St. (Neb.), 35; St. Cloud State (Minn.), 27; West Alabama, 16; North Carolina-Pembroke, 14; Mars Hill (N.C.), 13; Humboldt St. (Calif.), 12; Colorado St.-Pueblo, 8; Slippery Rock (Pa.), 7; Wayne St. (Mich.), 6; Ferris St. (Mich.), 5; Central Washington, 4; Ouachita Baptist (Ark.), 4; Henderson St. (Ark.), 3; Tusculum (Tenn.), 3; Catawba (N.C.), 2; New Haven (Conn.), 1; Washburn (Kan.), 1.
56
Running game, defense re-emerges as thunderwolves improve to 6-2.
gRand junction, colo. – For the third straight season, wacky weather doomed a CSU-Pueblo/Mesa State gridiron matchup, as a rain storm kept the ball on the ground all night long, playing right into the Pack’s hands as CSU-Pueblo claimed a 26-14 win Saturday.
After a bitterly cold meeting in Grand Junction in 2008, and an even colder meeting in Pueblo in 2009 when a freakish ice storm hit the Neta and Eddie DeRose ThunderBowl, lightning delayed the start of Saturday’s game and a night-long rain storm decided its pace, allowing CSU-Pueblo and its potent rushing attack to consistently move the ball on the ground.
The ThunderWolves logged 193 yards on the ground, with Jesse Lewis (Jr., Loveland, Colo.) rush-ing for 119 yards and Jamaal Johnson (Jr., Fountain, Colo.) adding two touchdown runs, as the rushing at-tack logged 47 rushes on the night.
Defensively, CSU-Pueblo feasted on Mesa State after two consecutive weeks of facing spread offenses, allowing just 2.6 yards per rush to the Mavericks and never allowing a run of more than 10 yards on the night.
But the stars were certainly the Pack secondary,
which stepped up in a big way in the third quarter. Af-ter Mesa State ended the first half with a flurry, closing a 14-0 lead to a 14-14 tie at the break, CSU-Pueblo badly needed to regain momentum and the secondary delivered.
Just a minute into the half, cornerback Grant Crunk-leton (Sr., Denver, Colo.) converted his NCAA Divi-sion II-best third defensive touchdown of the season with a 40-yard interception return for a score, which put the Pack up 20-14 and put the Mavs in catch-up mode.
“We felt like the first ten minutes of the second half would be the most important in terms of taking back momentum,” Pack coach John Wristen said, “and that’s
2010 SEASON-IN-REVIEW: GAME 8CSU-PUEBLO AT MESA STATEsatuRday, octobeR 23, 2010 • stockeR stadium • gRand junction, colo. • (529)
14
26
CSU-Pueblo defenders Chris Brown (24) and Beldy Nseka (47) celebrate a big play toward the beginning of the ThunderWolves’ tilt with Mesa State. Photo by Bill Sabo, Pro Action Photos
csu-pueblo 7 7 6 6 – 26mesa state 0 14 0 0 – 14scoRing summaRy:
1st quarter03:47 CSUP Jamaal Johnson 2 yd run (Kyle Major kick)Drive: 11 plays, 85 yards, TOP 5:06 CSUP 7 - MSC 0
2nd quarter10:13 CSUP Jamaal Johnson 1 yd run (Kyle Major kick) Drive: 13 plays, 63 yards, TOP 6:17 CSUP 14 - MSC 003:02 MSC J. Hamm 1 yd run (C. Pavy kick)Drive: 13 plays, 61 yards, TOP: 7:02 CSUP 14 - MSC 700:30 MSC N. Neville 6 yd pass from Mi. Mankoff (C. Pavy kick)Drive: 5 plays, 41 yards, TOP: 1:50 CSUP 14 - MSC 14
3rd quarter13:23 CSUP Grant Crunkleton 40 yd interception return (Kyle Major kick failed) CSUP 20 - MSC 14
4th quarter14:13 CSUP Kyle Major 43 yd field goal, Drive: 4 plays, -2 yards, TOP 1:57 CSUP 23 - MSC 1404:06 CSUP Kyle Major 36 yd field goalDrive: 15 plays, 46 yards, TOP 7:25 CSUP 26 - MSC 14
team statistics: CSUP MSCFIRST DOWNS 19 11RUSHES-YARDS (NET) 47-193 28-74PASSING YDS (NET) 119 110Passes Att-Comp-Int 19-12-1 22-12-2TOTAL OFFENSE PLAYS-YARDS 66-312 50-184Fumble Returns-Yards 0-0 0-0Punt Returns-Yards 3-33 1-4Kickoff Returns-Yards 3-82 6-155Interception Returns-Yards 2-40 1-11Punts (Number-Avg) 2-49.5 4-45.2Fumbles-Lost 2-0 1-0Penalties-Yards 6-80 6-50Possession Time 31:56 28:04Third-Down Conversions 10 of 15 5 of 13Fourth-Down Conversions 1 of 1 0 of 0Red-Zone Scores-Chances 3-4 2-3Sacks By: Number-Yards 0-0 2-7
individual stats:RUSHING: CSU-Pueblo-Jesse Lewis 23-119; Jamaal Johnson 16-61; Ross Dausin 7-15;TEAM 1-minus 2. Mesa State-J. Hamm 25-71; Mi. Mankoff 3-3. PASSING: CSU-Pueblo-Ross Dausin 10-16-0-104; Sebastian Trujillo 2-3-1-15. MesaState-Mi. Mankoff 12-19-2-110; J. Haferman 0-3-0-0. RECEIVING: CSU-Pueblo-Josh Sandoval 4-45; Jared Sperber 3-34; Bernard Jackson2-25; Jamaal Johnson 2-9; Koby Wittek 1-6. Mesa State-T. Loomis 3-37; J. Hamm3-12; B. Blevins 2-18; R. Felberg 1-24; B. Belloni 1-7; K. Means 1-6; N. Neville1-6. INTERCEPTIONS: CSU-Pueblo-Grant Crunkleton 1-40; Chris Brown 1-0. Mesa State-S.Matheson 1-11. FUMBLES: CSU-Pueblo-Ross Dausin 1-0; Jesse Lewis 1-0. Mesa State-Mi. Mankoff1-0.
just what we did.”
A 43-yard field goal by Kyle Major (Jr., Littleton, Colo.) put the Pack up nine early in the first quarter, and really proved to be a clincher late in the game. Major later added another field goal, undoing a night that saw his streak of 36-straight extra points, dating back to last season, snapped on a rainy PAT try in the third quarter.
“I was proud of our special teams performance,” Wristen said, “and I think it really was the difference in the game.”
CSU-Pueblo will return home next week for its home finale against New Mexico Highlands, which is also the CSU-Pueblo Athletics Hall of Fame Game. The Pack will then close out its 2010 slate with road matches against Western State and West-ern New Mexico, and hopefully do enough to capture an NCAA Division II playoff berth in the process.
57
pack busts records, annihilate highlands.
pueblo, colo. – In the final home game of the sea-son Saturday, CSU-Pueblo teed off on New Mexico Highlands, setting school records for most points in a game and highest margin of victory in a 66-0 shutout of the Cowboys.
The ThunderWolves registered 499 yards of total offense to just 158 for the Cowboys, earning 23 first downs to just 8 by Highlands. The Pack rumbled for eight rushing touchdowns, a school record, as two backs, Jesse Lewis (Jr., Loveland, Colo.) and Ja-maal Johnson (Jr., Fountain, Colo.) each ran for 100 yards, with Lewis getting 141 and Johnson add-ing 102.
In a game that was out of hand just minutes into the second quarter, the highlight of the night was kicker Kyle Major (Jr., Littleton, Colo.), who was the benefi-ciary of the offensive outburst, scoring 12 points on the night, nine coming by way of extra points, also a school record, in overtaking former two-time All-American, Bill Gower, for most points scored in CSU-Pueblo history with 172. The timing of the record was fitting, as Gow-er was honored at the game after being inducted in the CSU-Pueblo Athletics Hall of Fame Friday night.
In what was also senior night for the Pack, seniors were given plenty of opportunities to produce. Fullback
Josh Salazar (Sr., Parker, Colo.) closed out his final home game of his career with a two-touchdown effort, and backup quarterback Sebastian Trujillo (Sr., Du-rango, Colo.) got the bulk of the work under center, going 6-for-9 for 107 yards and a touchdown. Another senior, kick and punt returner Marquise Enoch (Sr., Denver, Colo.) also logged 89 yards in combined punt and kick return yardage, nearly breaking two returns for scores.
The win broke the school record for scoring (57 points in a 57-27 win over Fort Lewis in 1965) as well as set a standard for highest margin of victory, which
2010 SEASON-IN-REVIEW: GAME 9NEW MEXICO HIGHLANDS AT CSU-PUEBLOsatuRday, octobeR 30, 2010 • neta & eddie deRose thundeRbowl • pueblo, colo. • (5,268)
66
0
Tailback Jesse Lewis (28) ran for 141 yards, leading a rush-ing attack that logged a school-record eight touchdowns. Photo by Bill Sabo, Pro Action Photos
new mexico highlands 0 0 0 0 – 0csu-pueblo 10 21 21 14 – 66scoRing summaRy:
1st quarter13:06 CSUP Kyle Major 42 yd field goal Drive: 4 plays, 5 yards, TOP 1:04 NMHU 0 - CSUP 3 08:22 CSUP Jesse Lewis 44 yd run (Kyle Major kick) Drive: 2 plays, 42 yards, TOP 0:49 NMHU 0 - CSUP 10
2nd quarter11:53 CSUP Josh Salazar 1 yd run (Kyle Major kick) Drive: 10 plays, 84 yards, TOP 3:48 NMHU 0 - CSUP 17 07:29 CSUP Jesse Lewis 7 yd run (Kyle Major kick) Drive: 2 plays, 12 yards, TOP 0:47 NMHU 0 - CSUP 24 00:28 CSUP Josh Sandoval 15 yd pass from Sebastian Trujillo (Kyle Major kick) Drive: 10 plays, 75 yards, TOP 4:13 NMHU 0 - CSUP 31
3rd quarter13:44 CSUP Jesse Lewis 25 yd run (Kyle Major kick) Drive: 3 plays, 56 yards, TOP 1:11 NMHU 0 - CSUP 38 09:57 CSUP Ross Dausin 5 yd run (Kyle Major kick) Drive: 3 plays, 53 yards, TOP 1:18 NMHU 0 - CSUP 45 04:44 CSUP Jamaal Johnson 9 yd run (Kyle Major kick) Drive: 5 plays, 38 yards, TOP 2:03 NMHU 0 - CSUP 52
4th quarter13:52 CSUP Josh Salazar 4 yd run (Kyle Major kick) Drive: 6 plays, 75 yards, TOP 1:55 NMHU 0 - CSUP 59 07:47 CSUP Dominique Harris 6 yd run (Kyle Major kick) Drive: 7 plays, 67 yards, TOP 3:21 NMHU 0 - CSUP 66
team statistics: NMHU CSUPFIRST DOWNS 8 23RUSHES-YARDS (NET) 42-100 42-331PASSING YDS (NET) 58 168Passes Att-Comp-Int 10-6-1 16-9-0TOTAL OFFENSE PLAYS-YARDS 52-158 58-499Fumble Returns-Yards 0-0 0-0Punt Returns-Yards 0-0 7-107Kickoff Returns-Yards 7-189 1-24Interception Returns-Yards 0-0 1-10Punts (Number-Avg) 8-36.2 1-44.0Fumbles-Lost 1-1 2-0Penalties-Yards 11-127 5-45Possession Time 36:12 23:48Third-Down Conversions 1 of 11 5 of 8Fourth-Down Conversions 1 of 2 0 of 1Red-Zone Scores-Chances 0-0 7-7Sacks By: Number-Yards 0-0 5-25
individual stats:RUSHING: New Mexico Highlands-Herman Young 19-64; James Finklea 6-31; MarcusWashington 1-8; Robbie Armijo 10-4; Jordan Mendoza 1-minus 2; Kevon Williams2-minus 2; TEAM 3-minus 3. CSU-Pueblo-Jesse Lewis 16-141; Jamaal Johnson 9-103;Dominique Harris 5-30; Ross Dausin 3-22; Justin McCash 1-20; Giovanni Rider2-14; Jonathan Gaye 3-6; Josh Salazar 2-5; Sebastian Trujillo 1-minus 10. PASSING: New Mexico Highlands-Robbie Armijo 3-7-1-18; Jordan Mendoza 2-2-0-18;Kenny Shanahan 1-1-0-22. CSU-Pueblo-Sebastian Trujillo 6-9-0-107; Ross Dausin3-7-0-61. RECEIVING: New Mexico Highlands-Marcus Washington 2-19; Kevon Williams 2-18;Brandon Torres 1-22; Tony Udley 1-minus 1. CSU-Pueblo-Bernard Jackson 4-107;Josh Sandoval 3-38; Koby Wittek 1-19; Da’Quan Cartwright 1-4. INTERCEPTIONS: New Mexico Highlands-None. CSU-Pueblo-Josh Costa 1-10. FUMBLES: New Mexico Highlands-Herman Young 1-1. CSU-Pueblo-Josh Sandoval 1-0;Sebastian Trujillo 1-0.
was set in a 50-0 win over Western New Mexico in 1982.
CSU-Pueblo, now 7-2, will be on the road for the remainder of the 2010 season, with road dates at Western State and Western New Mexico upcoming.
AFCA D-II Coaches’ Poll – 10/11/20101. Grand Valley St. (Mich.) (24) 8-0 648 12. Minnesota-Duluth (1) 8-0 623 23. Abilene Christian (Texas) (1) 8-0 575 44. Northwest Missouri St. 6-1 568 55. Texas A&M-Kingsville 7-1 519 76. Albany St. (Ga.) 8-0 518 87. Central Missouri 8-1 494 98. Augustana (S.D.) 8-0 456 119. Nebraska-Kearney 7-1 418 1210. Valdosta St. (Ga.) 6-1 402 1411. Shepherd (W.Va.) 8-0 377 1512. California (Pa.) 7-1 353 313. Bloomsburg (Pa.) 7-1 338 1614. West Texas A&M 6-2 312 1715. Kutztown (Pa.) 8-0 286 1816. Colorado School of Mines 7-1 218 2017. Hillsdale (Mich.) 6-2 202 618. Winston-Salem St. (N.C.) 8-1 195 2119. Delta St. (Miss.) 6-2 171 2220. St. Cloud State (Minn.) 7-1 161 2321. North Alabama 6-2 159 1022. Midwestern St. (Texas) 6-2 103 1323. St. Augustine’s (N.C.) 7-1 101 2424. Mercyhurst (Pa.) 6-2 44 NR25. Fort Valley St. (Ga.) 7-1 39 NR
Dropped Out: Morehouse (Ga.) (19), West Virginia Wesleyan (25).
Others Receiving Votes: Morehouse (Ga.), 37; West Alabama, 34; Wayne St. (Mich.), 32; New Haven (Conn.), 21; Ouachita Baptist (Ark.), 18; Central Washington, 10; Tuskegee (Ala.), 7; Wingate (N.C.), 3; Carson-Newman (Tenn.), 2; Colorado St.-Pueblo, 2; Washburn (Kan.), 2; Humboldt St. (Calif.), 1; Southwest Baptist (Mo.), 1.
58
offense, defense clicks in 37-3 win over western state
gunnison, colo. – CSU-Pueblo took care of busi-ness Saturday in a road showdown at Western State, playing stout on both sides of the ball as the Thunder-Wolves scored a 37-3 win over the Mountaineers.
The Pack’s key to success was its running game, which racked up 314 yards on the ground, 239 coming from Jesse Lewis (Jr., Loveland, Colo.), who used the gaudy rushing numbers to take over sole possession of first place in CSU-Pueblo history for most rushing yards in a season, now at 1,206 yards this year. He broke the mark set by two-time All-American and re-cent CSU-Pueblo Athletics Hall of Fame inductee, Bill Gower. Lewis also ran for a touchdown, equalling the single season rushing touchdown record of 11 set by Joe Pannunzio in 1980.
Defensively, CSU-Pueblo got a very strong game from its defensive front seven, equalling a season high with five sacks, 1-1/2 coming from RMAC Defensive Freshman of the Year candidate, Beau Martin (Fr., Littleton, Colo.). The defensive backfield was also strong, as cornerbacks Stephan Dickens (Fr., Aurora, Colo.) and Chris Brown (Sr., Aurora, Colo.) each had picks, helping to hold Western State to just 116 yards of passing and 247 yards of total offense.
“When you run the ball for 300 yards and get strong
play from your defense, you know you’re going to be pretty successful,” Pack coach John Wristen said. “It was nice to see our offense, and especially our run-ning game, execute well when they were throwing eight- and nine-man fronts at us.”
Overall, the 37-3 win was the ThunderWolves’ big-gest in terms of margin-of-victory over the Mountain-eers in school history, shattering the mark of 21 points in the school’s 1982 meeting. The back-and-forth series which has been all ThunderWolves since the school’s football program was re-started in 2008, now sits at nine wins apiece.
2010 SEASON-IN-REVIEW: GAME 10CSU-PUEBLO AT WESTERN STATEsatuRday, novembeR 6, 2010 • mountaineeR bowl • gunnison, colo. • (440)
3
37
CSU-Pueblo tailback Jesse Lewis (28) ran for 239 yards vs. Western State, becoming the leading single-season rusher in school history with 1,206 yards. His touchdown score in the game also gave him the school record for rushing TDs. Photo by Bill Sabo, Pro Action Photos
csu-pueblo 14 7 10 6 – 37westeRn state 0 3 0 0 – 3scoRing summaRy:
1st quarter10:25 CSUP Roger Pfannenschmid 26 yd pass from Ross Dausin (Kyle Major kick) Drive: 7 plays, 55 yards, TOP 3:47 CSUP 7 - WSC 0 05:27 CSUP Bernard Jackson 15 yd pass from Ross Dausin (Kyle Major kick) Drive: 6 plays, 71 yards, TOP 2:06 CSUP 14 - WSC 0
2nd quarter14:03 WSC Lloyd Tucker 35 yd field goal Drive: 8 plays, 28 yards, TOP 3:26 CSUP 14 - WSC 3 10:13 CSUP Jesse Lewis 70 yd run (Kyle Major kick) Drive: 1 play, 70 yards, TOP 0:11 CSUP 21 - WSC 3
3rd quarter07:33 CSUP Kyle Major 31 yd field goal Drive: 4 plays, -3 yards, TOP 1:48 CSUP 24 - WSC 3 01:56 CSUP Marquise Enoch 5 yd run (Kyle Major kick) Drive: 4 plays, 51 yards, TOP 1:29 CSUP 31 - WSC 3
4th quarter10:17 CSUP Jamaal Johnson 8 yd run (Ross Dausin pass failed) Drive: 6 plays, 84 yards, TOP 2:42 CSUP 37 - WSC 3 Drive: 5 plays, TOP 1:48 CSUP 21 - FLC 14
team statistics: CSUP WSCFIRST DOWNS 25 12RUSHES-YARDS (NET) 36-310 36-131PASSING YDS (NET) 146 116Passes Att-Comp-Int 25-15-1 24-11-2TOTAL OFFENSE PLAYS-YARDS 61-456 60-247Fumble Returns-Yards 0-0 0-0Punt Returns-Yards 4-14 1-1Kickoff Returns-Yards 1-17 3-79Interception Returns-Yards 2-49 1-9Punts (Number-Avg) 3-43.3 7-33.6Fumbles-Lost 0-0 0-0Penalties-Yards 6-35 6-55Possession Time 28:42 31:18Third-Down Conversions 3 of 9 4 of 15Fourth-Down Conversions 1 of 1 0 of 1Red-Zone Scores-Chances 4-5 1-1Sacks By: Number-Yards 5-30 1-7
individual stats:RUSHING: CSU-Pueblo-Jesse Lewis 18-239; Jamaal Johnson 11-55; Giovanni Rider3-12; Marquise Enoch 1-5; Chris Brown 1-2; Ross Dausin 2-minus 3. WesternState-G. Daniels 19-83; Bradey Gasaway 7-41; Dustin Driscoll 1-6; Tyler Booth9-1. PASSING: CSU-Pueblo-Ross Dausin 10-17-1-105; Sebastian Trujillo 5-7-0-41; JamaalJohnson 0-1-0-0. Western State-Tyler Booth 11-24-2-116. RECEIVING: CSU-Pueblo-Bernard Jackson 4-41; Koby Wittek 3-30; Jared Sperber2-18; Josh Bredl 2-17; Da’Quan Cartwright 2-8; Roger Pfannenschmid 1-26; AustenLott 1-6. Western State-L. Montoya 3-26; Bradey Gasaway 3-26; Dustin Driscoll2-47; T. Williamson 2-10; Lukas Adams 1-7. INTERCEPTIONS: CSU-Pueblo-Chris Brown 1-49; Stephan Dickens 1-0. WesternState-Seth Wilson 1-9. FUMBLES: CSU-Pueblo-None. Western State-None.
The win, combined with losses by three teams ranked ahead of the Thunder-Wolves in the Super Region Three rankings could greatly improve its chances to sneak into a playoff spot. RMAC-foe, Colorado Mines, lost Saturday, as did re-gional foes Winona State and the region’s top-ranked team, Augustana. Entering the week, Mines was ranked eighth and Winona was ninth. CSU-Pueblo entered the week unranked in the Super Region’s top ten, needing to get their way into the top six for a national playoff spot.
The Pack will get its final shot at postseason play next Saturday, when they close out its regular season in Silver City, N.M. against Western New Mexico.
AFCA D-II Coaches’ Poll – 11/1/20101. Minnesota-Duluth (24) 9-0 644 22. Abilene Christian (Texas) (2) 9-0 625 33. Northwest Missouri St. 7-1 596 44. Texas A&M-Kingsville 8-1 546 55. Albany St. (Ga.) 9-0 531 66. Central Missouri 9-1 511 77. Augustana (S.D.) 9-0 476 88. Grand Valley St. (Mich.) 8-1 469 19. Nebraska-Kearney 8-1 434 910. Valdosta St. (Ga.) 7-1 426 1011. Shepherd (W.Va.) 9-0 402 1112. California (Pa.) 8-1 354 1213. Bloomsburg (Pa.) 8-1 332 1314. West Texas A&M 7-2 314 1415. Kutztown (Pa.) 9-0 289 1516. Colorado School of Mines 8-1 262 1617. Hillsdale (Mich.) 7-2 227 1718. North Alabama 7-2 214 2119t. Midwestern St. (Texas) 7-2 160 2219t. St. Augustine’s (N.C.) 8-1 160 2321. Mercyhurst (Pa.) 7-2 114 2422. Fort Valley St. (Ga.) 8-1 103 2523. New Haven (Conn.) 8-1 45 NR24. Wayne St. (Mich.) 7-2 42 NR25. St. Cloud State (Minn.) 7-2 40 20
Dropped Out: Winston-Salem St. (N.C.) (18), Delta St. (Miss.) (19).
Others Receiving Votes: Morehouse (Ga.), 25; Michigan Tech, 21; Winston-Salem St. (N.C.), 19; Central Washington, 15; Tuskegee (Ala.), 10; Ashland (Ohio), 9; Colorado St.-Pueblo, 6; Carson-Newman (Tenn.), 5; Concord (W.Va.), 4; Delta St. (Miss.), 4; Humboldt St. (Calif.), 4; Shaw (N.C.), 4; Wingate (N.C.), 4; Washburn (Kan.), 3; Southwest Baptist (Mo.), 1.
59
thunderwolves equal win record in victory over western n.m.
silveR city, n.m. – CSU-Pueblo closed out its 2010 campaign with a powerful bang Saturday, run-ning roughshod over Western New Mexico, claim-ing a 45-17 victory over the Mustangs.
With the win, CSU-Pueblo ends its year with a 9-2 mark, equalling the all-time school record win mark set by the 1980 and 1982 teams (9-1 and 9-2, respectively).
The Pack cruised to the win by virtue of a strong start, opening up a 21-0 lead in the first quarter to put the game out of reach early, and the ability to force multiple turnovers.
CSU-Pueblo intercepted three passes, including two picks by Josh Costa (So., Nanakuli, Hawaii), one of which came in the end zone in the fourth quarter, as the ThunderWolves forced four turn-overs. The turnovers were enough to un-do the Mustangs’ spread offense, an offensive set that had given the Pack fits all season long, allowing CSU-Pueblo to employ its “bend but don’t break” defense, which gave up 448 yards of offense but just 17 points.
Offensively, the Pack was led by its offensive spark, tailback Jesse Lewis (Jr., Loveland, Colo.).
The Harlon Hill Award candiate for top Division II player strengthened his resume for the honor, running for 185 yards and equaling a career high with three rushing scores. His first score broke a CSU-Pueblo single season record for most rush-ing touchdowns in a single season. He finished 2010 with 14 rushing scores, which equalled a CSU-Pueblo single season record for most total touchdowns, owned by Herman Heard in 1982 and 1983. After reaching 1,391 rushing yards for the season Saturday, Lewis will likely finish in the top five nationally in rushing and be a strong candidate
2010 SEASON-IN-REVIEW: GAME 11CSU-PUEBLO AT WESTERN NEW MEXICOsatuRday, novembeR 13, 2010 • ben altamiRano stadium • silveR city, n.m. • (652)
17
45
Jamaal Johnson ran for one touchdown, one of four CSU-Pueblo rushing scores, in the Pack’s dismantling of Western New Mexico Photo by Bill Sabo, Pro Action Photos
csu-pueblo 21 3 7 14 – 45westeRn new mexico 0 14 0 3 – 17scoRing summaRy:
1st quarter12:16 CSUP Jesse Lewis 8 yd run (Kyle Major kick) Drive: 3 plays, 25 yards, TOP 1:02 CSUP 7 - WNMU 0 07:52 CSUP Roger Pfannenschmid 41 yd pass from Ross Dausin (Kyle Major kick) Drive: 8 plays, 76 yards, TOP 2:56 CSUP 14 - WNMU 0 01:34 CSUP Jamaal Johnson 5 yd run (Kyle Major kick) Drive: 11 plays, 71 yards, TOP 4:30 CSUP 21 - WNMU 0
2nd quarter11:22 WNMUFB C. Miranda 38 yd pass from C. Voller (K. Drawhorn kick) Drive: 2 plays, 51 yards, TOP 0:31 CSUP 21 - WNMU 7 09:56 CSUP Kyle Major 21 yd field goal Drive: 5 plays, 67 yards, TOP 1:19 CSUP 24 - WNMU 7 07:16 WNMUFB M. Sumpter 10 yd pass from K. Breaker (K. Drawhorn kick) Drive: 1 play, 10 yards, TOP 0:08 CSUP 24 - WNMU 14
3rd quarter06:50 CSUP Jesse Lewis 5 yd run (Kyle Major kick) Drive: 3 plays, 60 yards, TOP 1:15 CSUP 31 - WNMU 14
4th quarter14:10 WNMUFB K. Drawhorn 25 yd field goal Drive: 15 plays, 73 yards, TOP 7:40 CSUP 31 - WNMU 17 11:29 CSUP Bernard Jackson 48 yd pass from Ross Dausin (Kyle Major kick) Drive: 6 plays, 63 yards, TOP 2:32 CSUP 38 - WNMU 17 01:32 CSUP Jesse Lewis 33 yd run (Kyle Major kick) Drive: 3 plays, 51 yards, TOP 1:18 CSUP 45 - WNMU 17
team statistics: CSUP WNMUFIRST DOWNS 17 21RUSHES-YARDS (NET) 33-231 38-146PASSING YDS (NET) 239 302Passes Att-Comp-Int 26-16-0 35-19-3TOTAL OFFENSE PLAYS-YARDS 59-470 73-448Fumble Returns-Yards 0-0 0-0Punt Returns-Yards 3-1 3-10Kickoff Returns-Yards 4-102 5-118Interception Returns-Yards 3-24 0-0Punts (Number-Avg) 6-45.7 5-36.6Fumbles-Lost 1-1 1-1Penalties-Yards 5-41 4-20Possession Time 28:18 31:42Third-Down Conversions 5 of 12 2 of 14Fourth-Down Conversions 0 of 0 1 of 4Red-Zone Scores-Chances 4-4 2-5Sacks By: Number-Yards 3-12 0-0
individual stats:RUSHING: CSU-Pueblo-Jesse Lewis 20-185; Jamaal Johnson 10-38; Josh Salazar 1-5;Marquise Enoch 1-4; Bernard Jackson 1-minus 1. Western New Mexico-K. Breaker21-99; A. Young 12-53; D. Askew 2-minus 1; C. Voller 3-minus 5. PASSING: CSU-Pueblo-Ross Dausin 15-23-0-235; Sebastian Trujillo 1-2-0-4; JamaalJohnson 0-1-0-0. Western New Mexico-C. Voller 12-20-2-203; A. Young 6-14-1-89;K. Breaker 1-1-0-10. RECEIVING: CSU-Pueblo-Koby Wittek 5-82; Roger Pfannenschmid 2-57; BernardJackson 2-54; Josh Sandoval 2-16; Jared Sperber 2-13; Jamaal Johnson 2-10; JoshSalazar 1-7. Western New Mexico-C. Miranda 5-116; S. Garcia 4-87; M. Sumpter4-86; S. Kneisel 2-11; K. Breaker 2-minus 14; R. Pompey 1-9; S. Johnston 1-7. INTERCEPTIONS: CSU-Pueblo-Josh Costa 2-19; Chris Brown 1-5. Western NewMexico-None. FUMBLES: CSU-Pueblo-Marquise Enoch 1-1. Western New Mexico-S. Garcia 1-1.
for an All-American honor.
The ThunderWolves were able to eclipse a number of single season records in the game, setting team standards for total first downs (208), rushing touch-downs (31), pass completions (157), and least rushing touchdowns allowed (5). The 45-point output Saturday raised the Pack’s total points scored this season to 404, shattering the previous school record of 347, set by the 1982 team.
CSU-Pueblo finishes the 2010 campaign with their second-straight third-place finish in the Rocky Mountain Athletic Conference standings.
AFCA D-II Coaches’ Poll – 11/8/20101. Minnesota-Duluth (23) 10-0 645 12. Abilene Christian (Texas) (3) 10-0 626 23. Northwest Missouri St. 8-1 599 34. Texas A&M-Kingsville 9-1 555 45. Albany St. (Ga.) 10-0 543 56. Grand Valley St. (Mich.) 9-1 506 87. Valdosta St. (Ga.) 8-1 474 108. Nebraska-Kearney 9-1 472 99. Shepherd (W.Va.) 9-0 448 1110. California (Pa.) 9-1 412 1211. Bloomsburg (Pa.) 9-1 391 1312. Central Missouri 9-2 382 613. Hillsdale (Mich.) 8-2 316 1714. Augustana (S.D.) 9-1 298 715. North Alabama 8-2 281 1816. Mercyhurst (Pa.) 8-2 239 2117. Wayne St. (Mich.) 8-2 167 2418. St. Cloud State (Minn.) 8-2 156 2519. West Texas A&M 7-3 151 1420. Kutztown (Pa.) 9-1 147 1521. Colorado School of Mines 8-2 88 1622. Michigan Tech 7-2 81 NR23. Fort Valley St. (Ga.) 8-2 61 2224. Morehouse (Ga.) 8-2 53 NR25. Midwestern St. (Texas) 7-3 50 19t
Dropped Out: St. Augustine’s (N.C.) (19t), New Haven (Conn.) (23).
Others Receiving Votes: Shaw (N.C.), 48; St. Augustine’s (N.C.), 32; Wingate (N.C.), 27; Tuskegee (Ala.), 26; Central Washington, 25; Winston-Salem St. (N.C.), 25; Ashland (Ohio), 24; Concord (W.Va.), 17; Colorado St.-Pueblo, 14; New Haven (Conn.), 14; Delta St. (Miss.), 12; Washburn (Kan.), 11; West Alabama, 11; Wayne St. (Neb.), 9; West Virginia Wesleyan, 6; Missouri Western St., 4; Chadron St. (Neb.), 3; Virginia St., 1.
60
ROCKY MOUNTAIN ATHLETIC CONFERENCEAbout the RMACThe Rocky Mountain athletic Conference is
a premier nCaa Division II conference located in the states of Colorado, nebraska and new Mexico. The RMaC currently competes in 21 nCaa Division II sports and has earned more than 30 nCaa Division II national champion-ships and more than 20 national runner-ups since 1992. Founded in 1909, the RMaC is the fourth oldest conference in the United States.
Mission StatementThe Rocky Mountain athletic Conference
is a Presidents’ Conference, committed to the principles set forth in the nCaa Division II Philosophy Statement. our focus is on the overall educational experience of our student-athletes and the integration of the athletic programs into the total educational mission of our member schools. We seek to maintain institutional diversity and autonomy, and to promote individual diversity among the student-athletes and athletic staffs of our member institutions. We are committed to fostering the general welfare of our student-athletes and to developing their athletic skills and academic abilities. We provide leadership to develop and maintain a balance between competitive excellence and stability within our conference.
1909-1969The Colorado Faculty athletic Conference
was formed March 6, 1909 by the following four charter members: University of Colorado, Colorado a&M (now Colorado State Univer-sity), Colorado College and Colorado School of Mines. In 1910, the league changed its name to the Rocky Mountain Faculty athletic Confer-ence (RMFaC). The University of Denver and University of Utah joined the conference but Colorado College had a fallout with Colorado School of Mines and dropped from the confer-ence. In 1914, Colorado College rejoined and with the addition of Utah State University, the membership was at seven. Montana State University joined in 1917 and Brigham Young University joined in 1918 as the conference grew to nine members. Membership reached 12 when the University of Wyoming joined in 1921, and Western State College and the Uni-versity of northern Colorado joined in 1924.
a major defection occurred as seven schools dropped out of the RMFaC to form the Moun-tain States Conference (also known as the Skyline Conference). Leaving the RMFaC were Colorado, Colorado State, Brigham Young, Utah State, Wyoming and Denver. The RMFaC continued to operate under faculty adminis-tration with five schools - Colorado College, Colorado Mines, Montana State, northern Colorado and Western State.
Much athletic activity was curtailed during the World War II years, but in 1948 Idaho State University joined the league to bring the membership to six.
adams State College became the seventh member in 1956, but Idaho State left in 1958 and Montana State departed in 1959, reducing the membership back to five schools.
In 1967, the name changed to what it is cur-
rently known as, the Rocky Mountain athletic Conference (RMaC). In a meeting of the presi-dents of 15 schools, the presidents assumed control of the league from the faculty, changed the name and the RMaC underwent the most radical change in its 58-year history. Ten in-stitutions were added to the conference and two divisions were formed (Mountains and Plains). Joining the conference were emporia State, Fort Hays State University, Fort Lewis College, University of nebraska-omaha, Pitts-burg State, Kan., University of Southern Colo-rado, Southern Utah State, Regis University, Washburn, Kan., Western new Mexico and Westminster, Utah. Colorado College was not included in the new plan and new Mexico Highlands University joined in 1968 but left in 1969 due to financial aid restrictions of the RMaC.
1970-79The two divisions of the RMaC were split into
separate conferences for economic reasons in 1972. The Mountain Division kept the RMaC name, the Plains Division became known as the Great Plains athletic Conference. The two allied conferences worked under the name of the Mountain and Plains Intercollegiate ath-letic association (MPIaa). RMaC member-ship stood at eight with aSC, CSM, FLC, Regis, Southern Utah State, Western new Mexico, WSC and Westminster. new Mexico Highlands became the ninth member in 1974 and Mesa State College became the 10th in 1975. In 1976, the MPIaa was dissolved for economic reasons and the two conferences went their separate ways. In the shuffle, northern Colo-rado became independent and Southern Colo-rado transferred to the RMaC. Paul Brechler became the commissioner of the RMaC and was assisted by his wife Wanda. The 1978-79 season marked the first year in which the conference would sponsor women’s sports. In 1979, Westminster dropped its intercollegiate
athletic program, leaving the RMaC with 10 institutions.
1980-1989In 1983, Regis became an independent and
in 1985 Southern Colorado drops several sports, including football. In 1986, Southern Utah State departed the RMaC and member-ship dropped to eight. In 1988, new Mexico Highlands withdrew. The RMaC took another new look in 1989 when Chadron State Col-lege, Fort Hays State University, Kearney State (now the University of nebraska at Kearney and current member) and Wayne State an-nounced intentions to join. Southern Colorado and Western new Mexico stated they were leaving the RMaC in 1990.
1990-1993During the 1990 RMaC Spring Meetings,
Kearney State and Wayne State withdrew their membership. Southern Colorado and Western new Mexico left on July 1, 1990 and Fort Lew-is said it would leave in 1991. Brechler retired as RMaC commissioner and his wife, Wanda, was named commissioner for the 1990-91 RMaC year. During the 1990-91 season, Fort Lewis was retained as an associate member for the sports of football, wrestling and soft-ball while new Mexico Highlands rejoined the conference. In august 1991, Kurt Patberg was named the RMaC commissioner. During the 1992-93 season, all RMaC institutions gave a three-year commitment to the league and the league moved into the nCaa Division II ranks. anheuser-Busch, Rawlings and the Ramada Hotel-Denver West joined forces with the RMaC as corporate sponsors. a new logo was adopted and the RMaC Seal would be used for official league items only. The RMaC Week-In-Review television show on Prime Sports network (now Fox Sports Rocky Mountain) was developed, post season basketball tour-naments were held and conference baseball
61
ROCKY MOUNTAIN ATHLETIC CONFERENCEteams participated in the Mile High Intercol-legiate Baseball League. adams State won the RMaC’s initial two nCaa Division II titles with victories in men’s and women’s cross country in 1992 and 1993. Phillips 66 then became a major corporate sponsor.
1994-1999Conference growth continued in 1994 with
the addition of two new members and the hiring of a second full-time staff person. Fort Lewis resumed full membership and nebras-ka-Kearney was voted in as a member, both ef-fective in July. also in July, a full-time assistant to the Commissioner/Media Relations Direc-tor was hired.
In november 1995, adams State won its fourth straight national title in women’s cross country, while Western State won it first nCaa Division II national title in men’s cross country. The crowning moment for the confer-ence came in March of 1996, when Fort Hays State became only the third Division II team in the 40-year history of nCaa Division II men’s basketball to finish the season undefeated. The Tigers finished the year 34-0 en-route to FHSU’s first Division II national championship and the conference’s first national champion in men’s basketball.
Colorado Christian University, Metropolitan State College of Denver, Regis University and the University of Southern Colorado joined the league as full members on July 1, 1996. The University of Colorado at Colorado Springs joined as an associate member also on July 1, 1996. University of Denver was accepted as an affiliate member. The RMaC now consists of a two-division, 14 member conference for the sports of volleyball and men’s and women’s basketball. The league office also had a new look as the conference offices moved from Golden, Colo. to Colorado Springs, Colo.
also in 1996, the RMaC’s intern position of operations Coordinator was expanded to a full-time position and the assistant to the Commissioner/Media Relations Director position changed titles to assistant Commis-sioner/Media Relations Director.
The RMaC came under new direction in 1997 as Tom Wistrcill was named commis-sioner, replacing Kurt Patberg who resigned to pursue his doctorate degree. Wistrcill be-gan his appointment august 15, 1997 after serving a three-year term as Commissioner of the northern Sun Conference. The Univer-sity of Denver completed its one-year term as an outgoing affiliate member of the RMaC, and began competition as an nCaa Division I institution for the 1998-99 year. CU-Colo-rado Springs completed its first year as a full member of the RMaC after becoming the 14th such institution on July 1, 1997. San Francisco State competed as an associate member of the RMaC in the sport of wrestling for the first time in 1997-98. In 1998, the RMaC men’s and women’s post-season basketball tourna-ment became the first conference event to be broadcast on live television as Fox Sports Rocky Mountain carried the two champion-ship games to a regional cable television au-dience.
2000-2009In 2000, Metro State joined adams State
and Western State as national champions - with adams State claiming the women’s cross country title, Western State claiming the men’s cross country title and Metro State win-ning the men’s basketball championship. also, Fort Hays State advanced to the finals of the Division II Baseball World Series and the Mesa State softball team earned its first ever trip to the Softball World Series.
after a three year tenure with the RMaC, Tom Wistrcill stepped down as commissioner in november 2000.
The council of presidents selected Joel R. Smith as the new commissioner of the Rocky Mountain athletic Conference in February 2001.
Western State College earned nCaa national titles in men’s and women’s cross country in 2001 and 2002. Metro State posted their sec-ond nCaa men’s basketball national champi-onship team in three years (2002, 2000).
In July 2002, Smith implemented the Rocky Mountain athletic Conference Hall of Fame and the first induction class was Paul and Wanda Brechler. The Brechler’s were the first full-time Commissioner’s of the RMaC.
The following year in March 2003, the RMaC basketball tournament (RMaC Shootout) was moved to Colorado Springs for three years (2003-2005) at the World arena. In 2006, the tournament was moved to Pueblo, Colo. at the State Fair events Center and the tournament has been held there ever since.
The RMaC’s national dominance in cross country continued as adams State won six straight women’s titles between 2003-2008. The Grizzly men’s team took home the nation-al title in 2003 before Western State reclaimed the title in 2004 and 2005.
The conference’s monthly television show, The RMaC Showcase, debuted on altitude Sports & entertainment in September 2004.
For three straight years the RMaC won nCaa soccer championships. Metro State re-turned to the national spotlight, this time in women’s soccer. Head coach Danny Sanchez led the Roadrunners to the 2004 and 2006 nCaa championship titles. Coached by Jeremy Gunn, the Fort Lewis College men’s soccer team went 22-0-1 in 2005 to win their first ever national championship.
In the fall of 2006, Fort Hays State University left the RMaC to join the Mid-america Inter-collegiate athletics association (MIaa). Due to Fort Hays State’s departure, Western new Mexico University, located in Silver City, n.M., joined the RMaC.
adams State won three of the RMaC’s four national championships in 2008 as they swept the cross country titles and won the nCaa Women’s Indoor Track & Field championship in Mankato, Minn. nebraska-Kearney scored their first ever national championship in wrestling, winning the title by .5 points over Minnesota State, Mankato.
Since joining the nCaa, the Rocky Moun-tain athletic Conference is home to 40 nCaa national champions and more than 30 nCaa runners-up.
RMAC MEMBERSHIP: 1909 – PRESENTAdams State 1956-Present Brigham Young 1918-1937 Chadron State 1989- Present Colorado 1909-1937 Colorado Christian 1996- Present Colorado College 1909-1910, 1914-1967 Colorado Mines 1909-Present Colorado State 1909-1937 colorado State- Pueblo 1967-1972, 1976-1990, 1996- Present Denver University 1910-1937, 1996-1997 Emporia State 1967-1972 Fort Hays State 1967-1972, 1989-2006 Fort lewis 1967-90, 1994-Present Idaho State 1948-1958 Mesa State 1975- Present Metro State 1996- Present Montana State 1917-1959 New Mexico Highlands 1968-69, 1974-1988, 1990- Present Nebraska-Kearney 1989-90, 1994- Present Nebraska-Omaha 1967-1972 Northern Colorado 1924-1972 Pittsburg State 1967-1972 Regis 1967-1983, 1996-Present Southern Utah 1967-1986 UC-Colorado Springs 1997- Present Utah 1910-1937 Utah State 1914-1937 Washburn 1967-1972 Western New Mexico 1967-1990, 2006- Present Western State 1924-Present Wyoming 1921-1937
BOLD denotes current RMAC Member
RECENT RMAC FOOTBALL CHAMPS
championships by school (Current Members)
2010 Nebraska-Kearney/ Colorado Mines2009 Nebraska-Kearney2008 Chadron State2007 Chadron State2006 Chadron State2005 Nebraska-Kearney2004 Colorado Mines2003 Mesa State2002 Chadron State/ Nebraska-Kearney2001 Chadron State1999 Chadron State/ New Mexico Highlands1998 Chadron State/ Western State1997 Western State1996 Chadron State1995 Fort Hays State Western State
1994 Western State1993 Fort Hays State 1992 Western State1991 Western State 1990 Mesa State1989 Adams State1988 Mesa State 1987 Mesa State 1986 Mesa State1985 Mesa State1984 Fort Lewis1983 Mesa State1982 Mesa State1981 New Mexico Highlands1980 Adams State/ Southern Colorado1979 Western State1978 Western State1977 Western State1976 Western State
Western State 17Colorado Mines 16Mesa State 9Chadron State 8Adams State 8
Nebraska-Kearney 4New Mexico Highlands 2CSU-Pueblo 1Fort Lewis 1
62
RMAC SEASON IN REVIEWRMAC Football Final December 20, 2010ESPN Academic
All-America2010 RMAC FOOTBALL STANDINGS
RMAC OvIsu W-L P. F Opp W-L P. F Opp^*Colorado Mines 8-1 0.889 38.2 21.8 9-3 0.750 36.5 24.1 *Nebraska-Kearney 8-1 0.889 37.7 21.9 9-2 0.818 35.3 22.7Colorado St.-Pueblo 7-2 0.778 35.9 16.1 9-2 0.818 36.7 15.6Chadron State 7-2 0.778 32.3 18.9 8-3 0.727 29.9 17.2Adams State 4-5 0.444 22.1 19.6 5-6 0.455 21.2 22.2Western New Mexico 3-6 0.333 19.4 27.7 4-7 0.364 19.1 29.9Fort Lewis 3-6 0.333 20.9 30.9 3-7 0.300 19.8 33.7Mesa State 3-6 0.333 22.4 27.0 3-7 0.300 20.5 27.9New Mexico Highlands 1-8 0.111 13.0 43.8 1-10 0.091 11.7 41.8Western State 1-8 0.111 15.7 30.1 1-10 0.091 14.8 35.4
^ Quali ed for NCAA Tournament* RMAC Co-Champions
Rocky Mountain Athletic Conference1867 Austin Bluff s Parkway --- Suite 101 --- Colorado Springs, Colo. 80918
Contact: Sarah Meier (719) 471-4936 or [email protected]: Seth Pringle (719) 471-4936 or [email protected]
www.rmacsports.org
Fs TClay Garcia, Colorado MinesCory Beran, Chadron State
ESPN Academic All-Ditrict VII
Fs TClay Garcia, Colorado MinesJeff Alcorn, Chadron StateRustin Dring, Nebraska-KearneySean McGowan, Chadron StateSam Kuck, Nebraska-KearneyLee Meisner, CSU-PuebloCory Beran, Chadron StateNick Frizzell, Fort Lewis
S TJohn Ritz en, Chadron StateTim Hiett , Chadron StateTrent DeBraga, Mesa StateJed Herblan, Chadron StateGrant Jansen, CSU-PuebloFrank Atherton, Fort Lewis
Th TKevin Berg, Chadron StateJared Polster, Admas StateMatt hew Mankoff , Mesa StateRyan Walstrom, Western StateJ.T. Haddan, CSU-PuebloJeremia Van Valkenburg, Adams State
Daktronic Ser Region 3
Fs T - Off sMichael Ziola, Chadron StateClay Garcia, Colorado MinesRobbin Vinnola, Colorado MinesOrion Matt hies, Nebraska-Kearney
Fs T - DfsKevin Berg, Chadron StateMarc Schiechl, Colorado MinesGrant Crunkleton, Colorado St.-PuebloLee Meisner, Colorado St.-Pueblo
S T - Off sTim Hiett , Chadron StateJesse Lewis, Colorado St.-PuebloJustin Johnson, Fort Lewis
S T - DfsJames Ackel, Adams StateRocco DeLorenzo, Adams StateTaylor Accardi, Colorado MinesMason Brodine, Nebraska-KearneyArthur Hobbs Nebraska-KearneySam Kuck Nebraska-Kearney
AFCA All-America
Marc Schiechl, Colorado Mines
AP LittleAll-America
Fs T - DfsMarc Schiechl, Colorado Mines
Th T - Off sJesse Lewis, CSU-PuebloOrion Matt hies, Nebraska-Kearney
Daktronic All-America
Fs T - DfsMarc Schiechl, Colorado Mines
S T - Off sOrion Matt hies, Nebraska-Kearney
S T - DfsKevin Berg, Chadron State
Cact BowlSelection
Justin Johnson, Fort LewisTony Kelly, Mesa StateMarc Schiechl, Colorado MinesEvan Woody, Colorado Mines
ALL-RMAC TEAMSFIRST TEAM - OFFENSEPos. Name Yr./School/Hometown/High School/Previous SchoolQB Clay Garcia Jr./Colorado Mines/Alamosa, Colo./Alamosa HSRB Jesse Lewis Jr./CSU-Pueblo/Loveland, Colo./Loveland HSRB Rustin Dring Jr./Nebraska-Kearney/Kearney, Neb./Kearney HSWR *Kyle Kaiser Sr./Nebraska-Kearney/Broomfield, Colo./Broomfield HSWR Justin Johnson Sr./Fort Lewis/San Diego, Calif./Grossmont CollegeWR Cody Renken So./Colorado Mines/Smithson Valley, Texas/Smithson Valley HSTE Robbin Vinnola Sr./Colorado Mines/Arvada, Colo./Arvada West HSOL *Orion Matthies Sr./Nebraska-Kearney/Overton, Neb./Overton HSOL Tim Hiett Jr./Chadron State/Arvada, Colo./Arvada West HSOL Evan Woody Sr./Colorado Mines/Austin, Texas/McCallum HSOL Adam Drudik Sr./Nebraska-Kearney/Juanita, Neb./Fort Hays StateOL Garrett Gilkey So./Chadron State/Sandwich, Ill./Aurora Christian HS
FIRST TEAM - DEFENSEDE *Marc Schiechl Sr./Colorado Mines/Lakewood, Colo./Bear Creek HSDE Mason Brodine Sr./Nebraska-Kearney/Elm Creek, Neb./Elm Creek HSDT Josh Rohde Sr./Nebraska-Kearney/Eddyville, Neb./Sumner-Eddyville-Miller HSDT Blaine Sumner Sr./Colorado Mines/Conifer, Colo./Conifer HSILB Lee Meisner Jr./CSU-Pueblo/Sterling, Colo./Sterling HSILB Rocco DeLorenzo Jr./Adams State/Arvada, Colo./Arvada West HSOLB Kevin Lindholm So./Chadron State/Eads, Colo./Eads HSOLB James Ackel So./Adams State/Riverside, Calif./Arlington HSCB Bryant Williams Sr./Adams State/Mesa, Ariz./Truman StateCB Jed Herblan Sr./Chadron State/Arvada, Colo./Arvada West HSS Kevin Berg Sr./Chadron State/Longmont, Colo./Longmont HSS Sam Kuck So./Nebraska-Kearney/Central City, Neb./Central City HS
FIRST TEAM - SPECIAL TEAMSK Michael Ziola Fr./Chadron State/Columbus, Neb./Columbus HSP Kevin Berg Sr./Chadron State/Longmont, Colo./Longmont HSKR Kevon Williams So./New Mexico Highlands/Houston, Texas/Westbury HSPR Scott Kellogg So./Adams State/Littleton, Colo./Chatfield HS* - unanimous first team selection.
SECOND TEAM - OFFENSEQB Tim Jenkins So./Fort Lewis/Highlands Ranch, Colo./ThunderRidge HSRB Glen Clinton Fr./Chadron State/Cody, Wyo./Cody HSRB Terjean Saffold Jr./Adams State/Stockton, Calif./Laney JCWR Jerrod Doucet So./Colorado Mines/Baytown, Texas/Ross S. Sterling HSWR Kevon Williams So./New Mexico Highlands/Houston, Texas/Westbury HSWR Shaun Suttorp Sr./Western State/Aurora, Colo./Gateway HSTE Koby Wittek Jr./CSU-Pueblo/Golden, Colo./Golden HSOL Kevin Ashak So./Adams State/Mesa, Ariz./Desert Ridge HSOL Ryan Swope Sr./Mesa State/Castle Rock, Colo./Douglas County HSOL Sean McGowan Jr./Chadron State/Lakewood, Colo./Lakewood HSOL Ryan Jensen So./CSU-Pueblo/Fort Morgan, Colo./Fort Morgan HSOL Drew Swartz So./CSU-Pueblo/Gilbert, Ariz./Gilbert HS
SECOND TEAM - DEFENSEDE Cory Beran Sr./Chadron State/Sargent, Neb./Sargent HSDE Beau Martin Fr./CSU-Pueblo/Littleton, Colo./Mullen HSDT Kaleb Anderson Sr./Colorado Mines/Littleton, Colo./Bear Creek HSDT Tony Kelly Sr./Mesa State/Montrose, Colo./Montrose HSILB James Belville Jr./Chadron State/Valentine, Neb./Valentine HSILB Ethan Kuhlmann So./Nebraska-Kearney/Athol, Kan./Athol HSOLB Alex Vigil Jr./Colorado Mines/Arvada, Colo./Faith Christian HSOLB Jason Campbell So./CSU-Pueblo/Kailua, Hawaii/Kamehameha HSCB Arthur Hobbs Jr./Nebraska-Kearney/San Diego, Calif./Grossmont CollegeCB Grant Crunkleton Sr./CSU-Pueblo/Denver, Colo./Arizona State UniversityS Kyle Goracke Sr./Colorado Mines/Tecumseh, Neb./Tecumseh Public HSS Jon Bailey Jr./CSU-Pueblo/Fort Morgan, Colo./Fort Morgan HS
SECOND TEAM - SPECIAL TEAMSK Kyle Major Jr./CSU-Pueblo/Littleton, Colo./Heritage HSP Taylor Accardi So./Colorado Mines/Littleton, Colo./Dakota Ridge HSKR Cody Renken So./Colorado Mines/Smithson Valley, Texas/Smithson Valley HSPR Salvador Garcia Jr./Western New Mexico/Anthony, Texas/Anthony HS
THIRD TEAM - OFFENSEPos. Name Yr./School/Hometown/High School/Previous SchoolQB Jake Spitzlberger Jr./Nebraska-Kearney/Lakewood, Colo./Bear Creek HSRB Kevin Breaker Sr./Western New Mexico/Stockton, Calif./Delta CollegeRB Dan Palmer So./Colorado Mines/Greeley, Colo./University HSWR Delton Prescott Jr./Adams State/Phoenix, Ariz./Glendale CCWR Brendan Liess Sr./Nebraska-Kearney/McCook, Neb./McCook HSWR Bernard Jackson Sr./CSU-Pueblo/Corona, Calif./University of ColoradoTE Tom Kastens Jr./Colorado Mines/Golden, Colo./D’Evelyn HSOL Nate Behrends So./Colorado Mines/Parker, Colo./Ponderosa HSOL JT Haddan So./CSU-Pueblo/Craig, Colo./Moffat County HSOL Jeff Younker Sr./Adams State/Rosenberg, Texas/Blinn JCOL Luke Geller Sr./Fort Lewis/Simi Valley, Calif./Moorpark CollegeOL Trevor Stapp So./Mesa State/Chandler, Ariz./Corona Del Sol HS
THIRD TEAM - DEFENSEDE Cory Morten Jr./Nebraska-Kearney/Loomis, Neb./Loomis HSDE Alex Paicurich Jr./Nebraska-Kearney/Westminster, Colo./Standley Lake HSDT Keifer Burke So./Chadron State/Brady, Neb./University of NebraskaDT Justin Thiel So./Nebraska-Kearney/Hastings, Neb./Adams Central HSILB Josh Ruff Jr./Colorado Mines/Castle Rock, Colo./Douglas County HSILB Jake Cross Jr./Western New Mexico/Bakersfield, Calif./Bakersfield JCOLB Jay Kropp Sr./Nebraska-Kearney/Grand Island, Neb./Grand Island HSOLB Spencer McAdoo Sr./Mesa State/Broomfield, Colo./Legacy HSCB Chris Brown Sr./CSU-Pueblo/Aurora, Colo./Dodge City CCCB Kevin Gallas Sr./Colorado Mines/Gilbert, Ariz./Mesquite HSS Ryan Wood Fr./Colorado Mines/San Antonio, Texas/Smithson Valley HSS Josh Costa Jr./CSU-Pueblo/Nanakuli, Hawaii/Kamehameha-Kapalama HS
THIRD TEAM - SPECIAL TEAMSK Paul McVay Fr./Colorado Mines/College Station, Texas/A&M Consolidated HSP Vincente Gonzales Sr./N.M. Highlands/Santa Fe Springs, Calif./Santa Fe Spgs HSKR Trent deBraga So./Mesa State/Fallon, Nev./Churchill County HSPR Jed Herblan Sr./Chadron State/Arvada, Colo./Arvada West HS
2010 AFCA DIVISION II cOAcHES’ POll – FINAlRank School (1st votes)1. Minnesota-Duluth2. Delta St. (Miss.)3. Northwest Missouri St.4. Albany St. (Ga.)5. Central Missouri6. Augustana (S.D.)7. Shepherd (W.Va.)8. Abilene Christian (Texas)9. Texas A&M-Kingsville10. Grand Valley St. (Mich.)11. Mercyhurst (Pa.)12. St. Cloud State (Minn.)13. Kutz town (Pa.)14. California (Pa.)15. Bloomsburg (Pa.)16. Hillsdale (Mich.)17. Valdosta St. (Ga.)18. West Texas A&M19. Colorado School of Mines20. Wingate (N.C.)21. Wayne St. (Mich.)22. North Alabama23. Nebraska-Kearney24. Missouri Western St.25. Michigan Tech
Others Receiving Votes: Morehouse, 65; Shaw, 47; St. Augustine’s, 34; Washburn, 27; Tuskegee, 24; Colorado St.-Pueblo, 19; Fort Valley St., 16; Winston-Salem St., 10; West Virginia Wesleyan, 9; Ashland, 7; Central Washington, 6; Midwestern St., 6; Chadron St., 4; West Liberty, 2; Concord (W.Va.), 1.
RMAC SCHOOLS RANKED IN AFcA cOAcHES’ POllNovember 1519. Colorado Mines23. Nebraska-KearneyRV. CSU-PuebloRV. Chadron StateNovember 1516. Colorado Mines19. Nebraska-KearneyRV. CSU-PuebloRV. Chadron StateNovember 88. Nebraska-Kearney21. Colorado MinesRV. CSU-PuebloRV. Chadron StateNovember 19. Nebraska-Kearney16. Colorado MinesRV. CSU-PuebloOctober 259. Nebraska-Kearney16. Colorado MinesRV. CSU-PuebloOctober 1813. Nebraska-Kearney20. Colorado MinesOctober 1113. Nebraska-Kearney24. Colorado MinesRV. CSU-Pueblo
October 414. Nebraska-Kearney25. CSU-PuebloRV. Colorado MinesSeptember 2717. Nebraska-KearneyRV. CSU-PuebloRV. Colorado MinesSeptember 2019. Nebraska-KearneyRV. Colorado MinesRV. CSU-PuebloSeptember 1323. Nebraska-KearneyRV. Colorado MinesRV. CSU-PuebloSeptember 623. Nebraska-KearneyRV. Colorado MinesRV. CSU-PuebloAugust 30RV. Nebraska-KearneyRV. Chadron StateRV. Colorado MinesAugust 913. Nebraska-KearneyRV. Colorado MinesRV. Chadron State
ESPN ACADEMICALL-DISTRICT VIIFirst TeamClay Garcia, Colorado MinesJeff Alcorn, Chadron StateRustin Dring, Nebraska-KearneySean McGowan, Chadron StateSam Kuck, Nebraska-KearneyLee Meisner, CSU-PuebloCory Beran, Chadron StateNick Frizzell, Fort LewisSecond TeamJohn Ritzen, Chadron StateTim Hiett , Chadron StateTrent DeBraga, Mesa StateJed Herblan, Chadron StateGrant Jansen, CSU-PuebloFrank Atherton, Fort LewisThird TeamKevin Berg, Chadron StateJared Polster, Admas StateMatt hew Mankoff , Mesa StateRyan Walstrom, Western StateJ.T. Haddan, CSU-PuebloJeremia Van Valkenburg, Adams State
DAKTRONICSSUPER REGION 3First Team - OffenseMichael Ziola, Chadron StateClay Garcia, Colorado MinesRobbin Vinnola, Colorado MinesOrion Matt hies, Nebraska-KearneyFirst Team - DefenseKevin Berg, Chadron StateMarc Schiechl, Colorado MinesGrant Crunkleton, Colorado St.-PuebloLee Meisner, Colorado St.-PuebloSecond Team - Off enseTim Hiett , Chadron StateJesse Lewis, Colorado St.-PuebloJustin Johnson, Fort LewisSecond Team - DefenseJames Ackel, Adams StateRocco DeLorenzo, Adams StateTaylor Accardi, Colorado MinesMason Brodine, Nebraska-KearneyArthur Hobbs Nebraska-KearneySam Kuck Nebraska-Kearney
AFCA ALL-AMERICAMarc Schiechl, Colorado Mines
AP LITTLE ALL-AMERICAFirst Team - DefenseMarc Schiechl, Colorado MinesThird Team - Off enseJesse Lewis, CSU-PuebloOrion Matt hies, Nebraska-Kearney
DAKTRONICS ALL-AMERICAFirst Team - DefenseMarc Schiechl, Colorado MinesSecond Team - Off enseOrion Matt hies, Nebraska-KearneySecond Team - DefenseKevin Berg, Chadron State
CACTUS BOWL SELECTIONSJustin Johnson, Fort LewisTony Kelly, Mesa StateMarc Schiechl, Colorado MinesEvan Woody, Colorado Mines
63
RMAC FOOTBALL RECORDSTOTAL OFFENSE
PlaysGame: 116, Chadron State vs. Abilene Christian, 11/23/07Season: 910, Colorado Mines, 2010 897, Chadron State, 2008 893, Western State, 2005
Net YardsGame: 831, N.M. Highlands vs. Fort Lewis, ‘92Season: 5,856, Nebraska-Kearney, 2009 5,701, Chadron State, 2007
Average Per GamePlay: 11.0, Chadron State at Western State, 11/3Season: 552.1, Western State, ‘91
Most Yards Gained, Two TeamsGame: 1425, N.M. Highlands vs. Fort Lewis, ‘92
Punt Return Average16.7 Adams State, 1994 16.6 Adams State, 2006
Kickoff Returns Yards Per Return27.5 Adams State, 1993
Passing Offense Yards Per Game357.4 Western State, 1991
TEAM PASSING RECORDSAttemptsGame: 74, Fort Lewis vs. Neb.-Kearney, 10/12/01Season: 613, Colorado Mines, 2010 566, Fort Lewis, 2001
CompletionsGame: 45, Fort Lewis vs. Neb.-Kearney, 10/12/01
Season: 374, Colorado Mines, 2010 317, Fort Lewis, ‘02
Net YardsGame: 638, Fort Lewis vs. Western N.M., 11/2/02Season: 4220, Colorado Mines, 2010 4,109, Fort Lewis, ‘02
TouchdownsGame: 7, Fort Lewis vs. Mesa State, 11/16/02 7, Fort Lewis vs. Western N.M., 11/2/02 7, Colorado Mines vs. Fort Hays State 9/22/01 7, Fort Lewis vs. Western N.M. 10/20/01Season: 41, Colorado Mines, 2010 37, Neb.-Kearney, 2005 37, Fort Lewis, ‘02
InterceptionsGame: 7, Westminster vs. Western N.M., ‘72 7, Colorado Mines vs. Adams State, ‘80Season: 24, N.M. Highlands, 2010 24, N.M. Highlands, ‘83
TEAM RUSHING RECORDSAttemptsGame: 92, Southern Colorado vs. Fort Lewis 1978Season: 606, Mesa State ‘00
Net YardsGame: 578, N.M. Highlands vs. Fort Lewis, ‘92Season: 3,372, Chadron State, 2006Average: 320.2, Western State, 1978
TouchdownsGame: 9, Nebraska-Kearney vs. Mesa State, 11/8/08 9, Mesa State vs. Neb.-Kearney, 9/17/05Season: 42, Chadron State, 2007
TEAM SCORING RECORDSMost Points, Two TeamsGame: 149, Chadron State vs. Abilene Christian, 11/23/07
Most TouchdownsGame: 11, Chadron State vs. Abilene Christian, 11/23/07 11, Western State vs. Okla. Panhandle State 9/29/01 11, Fort Lewis vs. Western N.M. 10/20/01
Most Touchdowns, Two TeamsGame: 21, Chadron State vs. Abilene Christian,
11/23/07
ScoringGame: 83, Western State vs. OPSU 9/30/00Season: 488, Chadron State, 2007Average: 47.1, Western State, ‘92
Most Points Scored, Losing TeamGame: 55, Fort Lewis vs. Mesa State, 11/16/02 55, Fort Lewis vs. N.M. Highlands (70), ‘92
Most Yards Gained, Losing TeamGame: 749, Fort Lewis vs. Mesa State, 11/16/02
TEAM MISCELLANEOUS RECORDSOFFENSEPunt Return YardsGame: 199, Adams State vs. Mesa State, ‘75Season: 714, Chadron State, ‘99
Kickoff Return YardsGame: 271, Adams State at Chadron State, 11/10/07Season: 1469, Western New Mexico, 2009 1,371, Fort Lewis, ‘02
PenaltiesGame: 24, Fort Lewis vs. Adams State, ‘85Season: 124, N.M. Highlands, ‘99 Penalty YardsGame: 250, N.M. Highlands vs. Fort Lewis, 10/27/07Season: 1,179, N.M. Highlands, 2006
FumblesGame: 10, Western N.M. vs. Southern Colorado, ‘80Season: 41, Western State, ‘80
Fumbles LostGame: 9, Western N.M. vs. Southern Colorado, ‘80Season: 25, Western State, ‘76 & Western N.M., ‘80
Fewest FumblesSeason: 7, Neb.-Kearney, ‘02 7, Adams State, ‘02
DEFENSEFewest PlaysSeason: 398, Western State, ‘74
Fewest Yards AllowedGame: -3, Chadron State vs. Fort Lewis, ‘98Season: 1263, Adams State, ‘75
Fewest First Downs AllowedGame: 1, Held by numerous teamsSeason: 99, Adams State, ‘75 Fewest Rushes AllowedGame: 13, Colorado Mines vs. N.M. Highlands, 11/07/09 15, Chadron State vs. Western N.M., 10/11/08 15, Colorado Mines at Fort Lewis, 9/20/08 15, CSU-Pueblo at Fort Lewis, 9/13/2008 15, Chadron State vs. Colorado Mines, 9/28/02Season: 248, Western State, ‘74
Fewest Rushing Yards AllowedGame: -74, Colorado Mines at Okla. Panhandle State, 9/29/07Season: 488, Western State, ‘75
Fewest Pass Attempts AllowedGame: 0, Held by numerous teamsSeason: 151, Western N.M., ‘80
Fewest Pass Completions AllowedGame: 0, Held by numerous teamsSeason: 49, SUSC, ‘74
Fewest Passing Yards AllowedGame: -11, Western State vs. Mesa State, ‘76Season: 609, Adams State, ‘80
Most InterceptionsGame: 7, Adams State vs. Colorado Mines, ‘80Season: 26, Mesa State, ‘89
Fewest Points AllowedSeason: 70, Adams State, ‘75
Fewest Average Points AllowedSeason: 8.4, Adams State, ‘80
Most Points AllowedGame: 90, N.M. Highlands vs. West Texas A&M, 2005Season: 566, Fort Lewis, ‘02
Punting AverageGame: *57.5, Colorado Mines vs. Fort Lewis, 10/21/89 (8-460)Season: 42.9, Colorado Mines, 1994Season: *48.0, Adams State, 1966 (36-1728) 45.4, Colorado Mines, 2010
INDIVIDUAL TOTAL OFFENSEPlaysGame: 85, Jermaine Whitaker, N.M. Highlands vs. Adams State, ‘94Season: 660, Chad Friehauf, Colorado Mines, 2004 639, Andrew Webb, Fort Lewis ‘01
Net YardsGame: 660, Andrew Webb, Fort Lewis vs. Mesa State, ‘02Season: *5363, Chad Friehauf, Colorado Mines, 2004 4245, Andrew Webb, Fort Lewis, ‘02Per Game: 559, Chad Friehauf, Colorado Mines vs. Midwestern State, 2004 385.9, Andrew Webb, Fort Lewis, 2002 340.0, Jayson Merrill, Western State, 1991
Average Per GameSeason: 385.9, Andrew Webb, Fort Lewis, ‘02 Touchdowns Responsible ForGame: 8, Jake Spitzlberger, Neb.-Kearney vs. Western N.M., 10/17/09 8, Joe McLain, Chadron State vs. Abilene Christian, 11/23/07 7, Andrew Webb, Fort Lewis vs. Mesa State, 11/16/02 7, Andrew Webb, Fort Lewis vs. Western N.M., 11/2/02 7, Nate Jackson, Colorado Mines vs. Fort Hays State 9/22/01 Season: 54, Chad Friehauf (39 pass, 15 rush), Colorado Mines, 2004 39, Clay Garcia (39 pass, 0 rush), Colorado Mines, 2010 39, Nate Jackson (9 rush, 30 pass), Colorado Mines, 2001
Points Responsible ForGame: 48, Jake Spitzlberger, Neb.-Kearney vs. Western N.M., 10/17/09 48, Joe McLain, Chadron State vs. Abilene Christian, 11/23/07 48, Andrew Webb, Fort Lewis vs. Western N.M., ‘02Season: 326, Chad Friehauf, Colorado Mines, 2004 (234 pass, 90 rush, 2 XP) 258, Andrew Webb, Fort Lewis, ‘02 (222 pass, 30 rush, 6 XP)
INDIVIDUAL PASSING RECORDSAttemptsGame: 74, Andrew Webb, Fort Lewis vs. Neb.- Kearney 10/12/01Per Game: *50.8, Andrew Webb, Fort Lewis, 2001 (559 in 11 games)Season: 567, Clay Garcia, Colorado Mines, 2010 559, Andrew Webb, Fort Lewis ‘01
CompletionsGame: 45, Chad Friehauf, Colorado Mines vs. PittsburghState,2004 43, Andrew Webb, Fort Lewis vs. Neb.- Kearney 10/12/01Season: 384, Chad Friehauf, Colorado Mines, 2004
Net YardsGame: 638, Andrew Webb, Fort Lewis vs. Mesa State, ‘02Season: 4,646, Chad Friehauf, Colorado Mines, 2004Per Game: 2010, Clay Garcia, Colorado Mines (338.8) 1999, Justin Coleman, Neb.-Kearney (338.6)
64
Passing EfficiencySeason: 188.1, Jayson Merrill, Western State, 1991Season: 183.5, Steve Smith, Western State, 1992
TouchdownsGame: 7, Andrew Webb, Fort Lewis vs. Mesa State, 11/16/02 7, Andrew Webb, Fort Lewis vs. Western N.M., 11/2/02 7, Nate Jackson, Colorado Mines vs. Fort Hays State 9/22/01Season: 39, Clay Garcia, Colorado Mines, 2010 39, Chad Friehauf, Colorado Mines, 2004 37, Andrew Webb, Fort Lewis, ‘02
Interceptions ThrownGame: 5, manySeason: 22, Kurt Van Hael, Fort Lewis, 1970
Completion PercentageSeason: *74.4, Chad Friehauf, Colorado Mines, (384-516) 66.4% (180 of 271), Steve Smith, Western State, 1992
Yards Per GameSeason: 379.7, Brian Ainsworth, N.M. Highlands, 1987Longest PassGame: *99 yards, Jake Spitzlberger to Kyle Kaiser, Neb.-Kearney vs. Western N.M., 9/12/09 99 yards, Nate Jackson, Colorado Mines vs. S.D. Tech, 9/7/02 99 yards, Nick Pannunzio to Herman Heard, Southern Colo. vs. Adams State, ‘82 99 yards, Justin Coleman to Mike Smith, Neb.-Kearney vs. Wayne State, 10/25/97 99yards,MattStrandtoRianWeber,Chadron St.vs.UW-RiverFalls9/2/00
INDIVIDUAL RUSHING RECORDSAttemptsGame: 47, C. Bouknight, Western State vs. Chadron State, ‘03Season: 344, Danny Woodhead, Chadron State, 2006
Net YardsGame: 378, Jason Broom, Fort Hays State vs. Okla. Pan. State 10/6/01Season: *2,756, Danny Woodhead, Chadron State, 2006
Average Per GameSeason: 212.0, Danny Woodhead, Chadron State, 2006
TouchdownsGame: 6,RayOverstreet,AdamsStatevs.Mesa State, ‘75 6, Thelbert Withers, N.M. Highlands vs. Fort Lewis, ‘92Season: 34, Danny Woodhead, Chadron State, 2006
Longest RunGame: 99 yards, Thelbert Withers, N.M. Highlands, ‘92
Yards Rushing, 2 Players, Same TeamGame: 514,ThelbertWithers(333)&DerrickRay (181), N.M. Highlands vs. Fort Lewis, ‘92
INDIVIDUAL RECEIVING RECORDSReceptionsGame: 20, Keylie Martin, N.M. Highlands vs. Western State, ‘94Season: 124, Justin Johnson, Fort Lewis, 2009 106, Jamal Allen, Fort Lewis 2001
Net YardsGame: 317,RichieRoss,Neb.-Kearneyvs.FHSU, ‘03Season: 1719, Chris Perry, Adams State, ‘95Per Game: 171.9, Chris Perry, Adams State, 1995
TouchdownsGame: 5, Chris Perry, Adams State vs. Mesa State, ‘95 5, Dayven Johnston, Colorado Mines vs. Fort Hays State 9/22/01Season: 21, Chris Perry, Adams State, ‘95
Highest Gain Per ReceptionSeason: *32.5 yds, Tyrone Johnson, Western State,‘91
INDIVIDUAL ALL-PURPOSE RECORDSYards GainedGame: 390, Johnny Cox, Fort Lewis vs. N.M. Highlands, ‘93Season: *3,159, Danny Woodhead, Chadron State, 2006Per Game: 243.0, Danny Woodhead, Chadron State, 2006
INDIVIDUAL SCORING RECORDSTouchdownsGame: 6, Jason Davis, Western State vs. Westmont, ‘93 6,RayOverstreet,AdamsStatevs.Mesa State, ‘75 6, Thelbert Withers, N.M. Highlands vs. Fort Lewis, ‘92Season: 38, Danny Woodhead, Chadron State, 2006
PointsGame: 44, Thelbert Withers, N.M. Highlands vs. Fort Lewis, ‘92 Season: 228, Danny Woodhead, Chadron State, 2006Per Game: 17.5, Danny Woodhead, Chadron State, 2006 15.4, David McCartney, Chadron State, 1992
INDIVIDUAL INTERCEPTIONSNumberGame: 4, Four Players tiedSeason: 11,ScottWiedemann,AdamsState,‘88
YardsGame: 136, Marvin Jackson, Chadron State vs. Neb.-Kearney 10/4/01Season: 267,MickeyReeves,N.M.Highlands,‘93
Longest ReturnGame: 100, held by numerous players
TouchdownsGame: 2, Jake Mandelko, Nebraska-Kearney, 11/8/08 2, Mike Neal, Neb.-Kearney at Western N.M., 11/10/07 2, Travis Pride, Fort Lewis vs. Colorado Mines, ‘86 2,RyanTurman,ChadronStatevs. Colorado Mines, ‘98 2, Marvin Jackson, Chadron State vs. Neb.-Kearney 10/4/01
Passes Defended Per GameSeason: 2.3, James Bracey, Mesa State, 2000
INDIVIDUAL PUNTING RECORDSTotal PuntsGame: 13, Daniel Glynn, FHSU vs. Chadron State, ‘03 13,AdamRodriquez,N.M.Highlandsv. Mesa State, 2002Season: 84, Jody Cook, Fort Lewis, ‘81
YardsGame: 519 (11), Dee Tennison, Fort Lewis vs. Western State ‘73Season: 3344 (84), Jody Cook, Fort Lewis, ‘81
AverageGame: 63.0,JeffWilliams,AdamsStatevs.Fort Lewis, 2005 (2-126) 61.5,JeffWilliams,AdamsStatevs.Okla. Panhandle, 2005 (4-246)Season: 48.0,JeffWilliams,AdamsState,2004 (71-3405) 46.2, Jason Van Dyke, Adams State, ‘98
Longest PuntGame: 89, Dave Humann, Adams State, ‘87 88,RyanHedberg,AdamsState,‘08
INDIVIDUAL PUNT RETURN RECORDS
NumberGame: 9, Austin Forster, Chadron State vs. Mesa State, 9/30/00
9, Mitch Barry, Chadron State vs. Fort Hays State 11/10/01Season: 45, Austin Forster, Chadron State, ‘99
YardsGame: 161, Brandon Sicilia, Western State v. Fort Lewis, ‘98Season: 562, Tony Donald, Western State ‘01
TouchdownsGame: 1, Held by numerous playersSeason: 2, Jeremy Craighea, Western State, ‘02 2, Tony Donald, Western State ‘01 2, Lance Vogely, Fort Lewis, ‘97 2, Bob Boudoin, Mesa State, ‘89 2, Jay Ogle, Western N.M., ‘83
Longest ReturnGame: 98, C. Alvarado, N.M. Highlands vs. Paul Quinn, Oct. 14, 2006
INDIVIDUAL KICKING RECORDSFG AttemptsGame: 7, Held by numerous playersSeason: 33, Jared Keating, Mesa State, 2007
FG MadeGame: 6,RockyPaulson,AdamsStatevs. Western State, ‘80 Season: 22, Jared Keating, Mesa State, 2007Per Game: 1.89, David Van Voris, Adams State, 2009 1.83, Jared Keating, Mesa State, 2007
Longest Field GoalGame: 62, Mike Flatler, Colorado Mines, ‘73 vs. Western StatePAT AttemptsGame: 11,RichieHahn,MesaStatevs.Fort Lewis, ‘90Season: 63,TravisAtter,ChadronState,2007 62,TravisAtter,ChadronState,2006
PAT’s MadeGame: 11,RichieHahn,MesaStatevs.Fort Lewis, ‘90Season: 60,TracyBennett,MesaState,‘88
INDIVIDUAL KICKOFF RETURN RECORDSNumberGame: 12, Johnny Cox, Fort Lewis vs. Mesa State, ‘90Season: 43, Frank Whalen, Fort Lewis, ‘88
YardsGame: 234, Johnny Cox, Fort Lewis vs. Mesa State, ‘90Season: 1,234, Justin Gallas, Colorado Mines, 2005Average: 39.4,LaVonReis,WesternState,1993
TouchdownsGame: 1, Held by numerous playersSeason: 4, Brian Sump, Colorado Mines, ‘01
Longest ReturnGame: 100, Held by numerous players
* NCAA Division II Record
RMAC FOOTBALL RECORDS
65
RMAc ANNUAl lEADERS (SINcE ‘72)Year Receiving Leader Avg.2010 Justin Johnson, Fort Lewis 124.22009 Adam Saur, Colorado Mines 110.82008 John Means, Western N.M. 99.62007 Rod Windsor, Western N.M. 111.92006 Eddie Abreu, N.M. Highlands 68.62005 Richie Ross, Neb.-Kearney 113.32004 Jonny Chan, Colorado Mines 105.82003 Richie Ross, Neb.-Kearney 148.22002 Chris Brewer, Fort Lewis 115.82001 Brian Sump, Colorado Mines 106.82000 Trevor Weston, Neb.-Kearney 113.61999 Trevor Weston, Neb.-Kearney 94.11998 John South, Adams State 127.91997 Jamar Nailor, N.M. Highlands 114.91996 Xavier Brown, Fort Hays State 126.91995 Chris Perry, Adams State 171.91994 Keylie Martin, N.M. Highlands 91.11993 Rus Bailey, N.M. Highlands 119.21992 Johnny Cox, Fort Lewis 133.11991 Tyrone Johnson, Western State 103.91990 Dale Kopec, Fort Lewis 60.21989 Robert Woodruff, Western State 70.61988 Alfonso Garcia, Fort Lewis 91.11987 Anthony Edwards, N.M. Highlands 114.51986 Mike Williams, N.M. Highlands 96.61985 Anthony Edwards, N.M. Highlands 117.51984 Donnie Holmes, Mesa State 79.51983 Steve Haase, Western State 84.21982 John Trahan, Southern Colorado 91.71981 John Wright, Fort Lewis 62.21980 Mark Holland, SUSC 961979 Corey Tolle, Southern Colorado 91.21978 Lamont Winston, West. 98.91977 Rex Macey, West. 119.21976 Mike Silva, West. 73.61975 Craig Caldwell, West. 99.81974 Craig Caldwell, West. 112.21973 Rex Macey, West. 761972 Bill Cappela, Adams State 63.2 Year Scoring Leader Points2010 Kyle Major, CSU-Pueblo 962009 Jordan Alegria, Nebraska-Kearney 1042008 Travis Atter, Chadron State 1002007 Danny Woodhead, Chadron State 1382006 Danny Woodhead, Chadron State 2282005 Danny Woodhead, Chadron State 1262004 Danny Woodhead, Chadron State 1622003 Jessup Pfeifer, Neb.-Kearney 852002 Chris Brewer, Fort Lewis 1182001 Brian Sump, Colorado Mines 1042000 Austin Forster, Chadron State 981999 Volker Olbrich, Neb.-Kearney 841998 Thad Variance, N.M. Highlands 1281997 Conan Smith, N.M. Highlands 1101996 Jamar Nailor, N.M. Highlands 1101995 Chris Perry, Adams State 1301994 Tim Thenell, Western State 891993 Rus Bailey, N.M. Highlands 741992 David McCartney, Chadron State 1541991 Reggie Alexander, Western State 901990 Brian Barton, Mesa State 901989 Wes Polk, Adams State 1211988 Michael Vaughn, Mesa State 1261987 Anthony Edwards, N.M. Highlands 741986 Tracy Bennett, Mesa State 931985 Ronell Brown, N.M. Highlands 961984 Howard Roberts, Mesa State 721983 Herman Heard, Southern Colorado 861982 Russ Hodgson, Mesa State 801981 Dino Jones, N.M. Highlands 661980 Ron Linsacum, Western State 841979 Chuck Van Allen, Colorado Mines 801978 Charlie Thompson, Western State 841977 Rex Macey, West. 801976 Mike Makings, Western State 961975 Ray Overstreet, Adams State 1021974 Wolfgang Taylor, Western State 411973 Wolfgang Taylor, Western State 511972 Jim Arcieri, Western State 84
Year Rushing Leader Avg.2010 Jesse Lewis, CSU-Pueblo 139.12009 Rustin Dring, Nebraska-Kearney 137.32008 Bobby Coy, Mesa State 145.52007 Danny Woodhead, Chadron State 145.22006 Danny Woodhead, Chadron State 2282005 Danny Woodhead, Chadron State 1262004 Danny Woodhead, Chadron State 1842003 C. Bouknight, Western State 154.32002 Mike Miller, Neb.-Kearney 145.52001 Mike Miller, Neb.-Kearney 110.12000 Austin Forster, Chadron State 101.21999 Zach Mader, Neb.-Kearney 84.11998 Thad Variance, N.M. Highlands 128.41997 Conan Smith, N.M. Highlands 145.41996 Emmett Pride, Fort Hays State 121.51995 Murray Dillon, Western State 129.11994 Corey Campbell, Chadron State 131.21993 Thelbert Withers, N.M. Highlands 148.61992 Thelbert Withers, N.M. Highlands 147.41991 Brian Barton, Mesa State 124.41990 Marlo Johnson, Mesa State 127.91989 Michael Vaughn, Mesa State 138.41988 Michael Vaughn, Mesa State 135.81987 Michael Vaughn, Mesa State 164.41986 Lonnie Williams, Mesa State 1471985 Bob Dyer, Southern Utah 112.91984 Bill Stone, Adams State 128.61983 Russ Hodgson, Mesa State 110.61982 Scott Stamper, Fort Lewis 120.81981 Dino Jones, N.M. Highlands 111.21980 Wayne McGinn, Adams State 100.11979 Charlie Thompson, Western State 114.11978 Winfred Anderson, Southern Utah St. 104.41977 Wayne McGinn, Adams State 89.51976 Phil Wicks, Western State 107.61975 Ray Overstreet, Adams State 110.51974 Jim Arcieri, Western State 101.11973 Charles Coleman, Western N.M. 1141972 Steve Clodfelter, Southern Utah State 107.7 Year Passing Leader Avg.2010 Clay Garcia, Colorado Mines 338.82009 David Pesek, Colorado Mines 321.02008 Joe McLain, Chadron State 226.32007 David Pesek, Colorado Mines 243.92006 Alex Aispuro, N.M. Highlands 1912005 M. Goldenstein, Neb.-Kearney 281.82004 Chad Friehauf, Colorado Mines 357.42003 Pat Korth, Neb.-Kearney 324.52002 Andrew Webb, Fort Lewis 373.52001 Nate Jackson, Colorado Mines 307.32000 Justin Coleman, Neb.-Kearney 264.51999 Justin Coleman, Neb.-Kearney 316.71998 Brad Norris, Adams State 291.31997 Justin Coleman, Neb.-Kearney 254.91996 Jamie Sander, N.M. Highlands 288.51995 Shawn Behr, Fort Hays State 287.11994 Jermaine Whitaker, N.M. Highlands 297.81993 Jermaine Whitaker, N.M. Highlands 273.51992 Thad Trujillo, Fort Lewis 298.31991 Jayson Merrill, Western State 348.41990 Bobby Saiz, Adams State 257.31989 Bobby Saiz, Adams State 2501988 Bobby Saiz, Adams State 294.11987 Brian Ainsworth, N.M. Highlands 379.71986 Brian Ainsworth, N.M. Highlands 303.81985 Brian Ainsworth, N.M. Highlands 310.51984 Kevin Sherman, Fort Lewis 171.81983 Andy Lowry, Western State 2011982 John Wristen, Southern Colorado 169.81981 Kevin Stephens, Western N.M. 169.61980 Dave Mollica, SUSC 1801979 Chuck Van Allen, Colorado Mines 154.91978 Walt Sturkey, WC 198.61977 Walt Sturkey, WC 229.41976 Ron Trujillo, Fort Lewis 221.51975 John Chisholm, Fort Lewis 196.41974 Jerry Dyer, SUSC 219.51973 Randy Beckstead, WC 148.31972 Mike Busby, Western State 133.1
66
All-Time RMAC Champions (1909-Present)2010 Colorado Mines & Nebraska-Kearney2009 Nebraska-Kearney2008 Chadron State2007 Chadron State2006 Chadron State2005 Nebraska-Kearney2004 Colorado Mines2003 Mesa State2002 Chadron State & Nebraska-Kearney2001 Chadron State2000 Mesa State1999 Chadron State & N.M. Highlands1998 Chadron State & Western State1997 Western State1996 Chadron State1995 Fort Hays State & Western State1994 Western State1993 Fort Hays State1992 Western State1991 Western State1990 Mesa State1989 Adams State1988 Mesa State1987 Mesa State1986 Mesa State1985 Mesa State1984 Fort Lewis1983 Mesa State1982 Mesa State1981 N.M. Highlands1980 Adams State & Southern Colorado1979 Western State1978 Western State1977 Western State1976 Western State1975 Western State1974 Western State1973 Western State1972 Adams State1971 Northern Colorado1970 Pittsburg State1969 Northern Colorado1968 Adams State1967 Adams State1966 Western State1965 Western State1964 Western State1963 Western State1962 Adams State1961 Adams State1960 Adams State1959 Idaho State1958 Colorado College & Colorado Mines1957 Idaho State1956 Montana State1955 Idaho State1954 Montana State1953 Idaho State1952 Idaho State1951 Colorado Mines1950 Colorado College1949 Colorado College1948 Northern Colorado1947 Montana State1946 Montana State1945 Colorado College1943 No League1942 Colorado Mines1941 Colorado College1940 Colorado College1939 Colorado Mines1938 Montana State1937 Colorado1936 Utah State1935 Colorado1934 Colorado1933 Utah1932 Utah1931 Utah1930 Utah1929 Utah1928 Utah1927 Colorado State1926 Utah1925 Colorado State1924 Colorado1923 Colorado1922 Utah1921 Colorado1920 Colorado State1919 Colorado College1918 Colorado Mines1917 Denver1916 Colorado State1915 Colorado State1914 Colorado Mines1913 Colorado1912 Colorado Mines1911 Colorado1910 Colorado College & Colorado1909 Colorado & Denver
RMAC TEAMS IN THE POSTSEASONYear Winning Team Score Losing Team Score Round Site2010 Grand Valley State 35 Colorado Mines 13 First Round Allendale, Mich.2009 Minnesota-Duluth 42 Nebraska-Kearney 7 Second Round Duluth, Minn. Nebraska-Kearney 35 Saginaw Valley (Mich.) 20 First Round Kearney, Neb.2008 Western Washington 25 Colorado Mines 10 Dixie Rotary Bowl St. George, Utah Minnesota-Duluth 20 Chadron State 10 Second Round Duluth, Minn. Chadron State 23 Wayne State (Neb.) 17 First Round Chadron, Neb.2007 Western Oregon 26 Colorado Mines 12 Dixie Rotary Bowl St. George, Utah NorthwestMo.State 26 ChadronState 13 Quarterfinals Chadron,Neb. Chadron State 76 Abilene Christian 73 (3OT) Second Round Chadron, Neb. Abilene Christian 56 Mesa State 12 First Round Abilene, Texas2006 NorthwestMo.State 28 ChadronState 21 Quarterfinals Maryville,Mo. Chadron State 43 West Texas A&M 17 Second Round Chadron, Neb. Fort Lewis 24 Dixie State 14 Dixie Rotary Bowl St. George, Utah2004 Pittsburg State 70 Colorado Mines 35 Second Round Pittsburg, Kan. Colorado Mines 52 Midwestern State 33 First Round Golden, Colo.2003 Central Oklahoma 20 Mesa State 15 First Round Grand Junction, Colo.2002 Texas A&M-Kingsville 58 Nebraska-Kearney 40 First Round Kearney, Neb.2001 Tarleton State 28 Chadron State 24 First Round Chadron, Neb.2000 Mesa State 40 Northeastern Okla. 21 First Round Tahlequah, Okla. UC-Davis 62 MesaState 18 Quarterfinals Davis,Calif. UC-Davis 48 Chadron 10 First Round Davis, Calif.1998 Central Oklahoma 21 Chadron State 19 First Round Edmond, Okla.1997 Angelo State 46 Western State 12 First Round San Angelo, Texas1996 Central Oklahoma 23 Chadron State 21 First Round Edmond, OK1995 Texas A&M-Kingsville 59 Fort Hays State 28 First Round Kingsville, Texas1994 Texas A&M-Kingsville 43 Western State 7 First Round Kingsville, Texas1993 Cal-Davis 37 FortHaysState 34 Quarterfinals Davis,Calif.1992 TexasA&I 22 WesternState 13 Quarterfinals Kingsville,Texas1991 WesternState 38 Carson-Newman,TN 21 Quarterfinals Gunnison,Colo. CentralState,OH 20 WesternState 13 Semifinals Wilbuforce,Ohio1990 MesaState 37 W.NewMexico 30(OT) Quarterfinals GrandJunction,Colo. CentralState,OH 48 FortHaysState 10 Quarterfinals Hays,Kan. Dickinson State, ND 28 Chadron State 3 First Round Dickinson, N.D. MesaState 10 CentralArkansas 7 Semifinals Conway,Ark. Central State, OH 38 Mesa State 16 Championship Grand Junc., Colo.1989 AdamsState 30 NorthwesternOkla. 22 Quarterfinals Alamosa,Colo. EmporiaState,KS 51 AdamsState 44 Semifinals Alamosa,Colo.1988 Moorhead State, MN 26 Mesa State 16 First Round Moorhead, Minn. Adams State 14 Emporia State, KS 10 First Round Emporia, Kan. AdamsState 38 SoutheasternOkla. 7 Quarterfinals Durant,Okla. AdamsState 13 PittsburgState,KS 10 Semifinals Alamosa,Colo. Carson-Newman, TN 56 Adams State 21 Championship Jefferson Cy, Tenn.1987 Mesa State 49 Southwest State, MN 7 First Round Marshall, Minn. MesaState 38 SouthernOregon 7 Quarterfinals GrandJunc.,Colo. Carson-Newman,TN 21 MesaState 7 Semifinals JeffersonCy,Tenn.1986 Hillsdale,MI 27 MesaState 17 Quarterfinals GrandJunction,Colo.1985 MesaState 39 WesternOregon 32 Quarterfinals GrandJunction,Colo. Hillsdale,MI 24 MesaState 21(OT) Semifinals GrandJunction,Colo.1983 MesaState 35 EasternNewMexico 9 Quarterfinals GrandJunction,Colo. MesaState 34 CentralArkansas 17 Semifinals GrandJunction,Colo. Carson-Newman, TN 36 Mesa State 28 Championship Grand Junction, Colo.1982 MesaState 43 MoorheadState 20 Quarterfinals GrandJunction,Colo. CentralState,OK 61 SouthernColorado20 Quarterfinals Pueblo,Colo. MesaState 18 Hillsdale,MI 9 Semfinals GrandJunction,Colo. Central State, OK 14 Mesa State 11 Championship Edmund, Okla.1979 TexasA&I 38 WesternState 14 Quarterfinals Kingsville,Texas1978 WesternState 21 CentralArkansas 17 Quarterfinals Conway,Ark. AngeloState 35 WesternState 3 Semimfinals Angelo,Texas1976 TexasA&I 56 WesternState 14 Semifinals Kingsville,Texas1969 TexasA&I 28 N.M.Highlands 23 Semifinals Kingsville,Texas1967 EasternWashington 28 N.M.Highlands 14 Semifinals LasVegas,N.M.1966 Waynesburg,PA 30 N.M.Highlands 27 Semifinals Albuquerque,N.M.
67
RECORD BOOK CSUP SEASON OPENERS
HOMECOMING GAMES ALL-TIME SERIES RESULTS
PAGE 68All-TIME SERIES VS. OPPONENTS
PAGE 69YEAR-BY-YEAR RESULTS
PAGE 70ALL-TIME LETTERMAN LIST
PAGE 74RECORD BOOK
PAGE 77THUNDERWOLVES IN THE PROS
PAGE 84
68
ALL-TIME RECORDSSEASON OPENERSYear Score/Opponent CSUP Record1938 CSUP 0, Colorado Mines JV 0 (0-0-1)1939 Colorado JV 26, CSUP 7 (0-1-1)1940 CSUP 19, Colorado College JV 6 (1-1-1)1941 Colorado Mines JV 27, CSUP 0 (1-2-1)1942 Trinidad State (Colo.) 31, CSUP 0 (1-3-1)1943-45 No Team1946 New Mexico Highlands 6, CSUP 0 (1-4-1)1947 New Mexico Military Inst. 26, CSUP 6 (1-5-1)1948 CSUP 14, New Mexico Military Inst. 12 (2-5-1)1949 CSUP 20, Garden City (Kan.) 0 (3-5-1)1950 Garden City (Kan.) 25, CSUP 0 (3-6-1)1951 Garden City (Kan.) 33, CSUP 20 (3-7-1)1952 CSUP 32, Trinidad State (Colo.) 0 (4-7-1)1953 CSUP 19, Colorado College JV 6 (5-7-1)1954 CSUP 31, Otero (Colo.) 7 (6-7-1)1955 CSUP 20, Otero (Colo.) 0 (7-7-1)
1956 CSUP 33, McCook (Neb.) 12 (8-7-1)1957 CSUP 12, Western Nebraska 0 (9-7-1)1958 CSUP 26, Western Nebraska 7 (10-7-1)1959 CSUP 27, Western Nebraska 25 (11-7-1)1960 CSUP 34, Western Nebraska 0 (12-7-1)1961 CSUP 24, Western Nebraska 6 (13-7-1)1962 CSUP 21, Northwest (Wyo.) 7 (14-7-1)1963 Emporia State (Kan.) 21,@CSUP 20 (14-8-1)1964 @CSUP 34, Western New Mexico 7 (15-8-1)1965 CSUP 20, @Western New Mexico 13 (16-8-1)1966 @CSUP 15, Okla Panhandle St 9 (17-8-1)1967 @Okla Panhandle St 21, CSUP 13 (17-9-1)1968 @CSUP 10, Pittsburg State (Kan.) 7 (18-9-1)1969 @Pittsburg State (Kan.) 21, CSUP 17 (18-10-1)1970 CSUP 21, @Fort Lewis 7 (19-10-1)1971 CSUP 38, @Fort Lewis 0 (20-10-1)1972 Western State 35, @CSUP 13 (20-11-1)
1973 CSUP 30, @Fort Lewis 17 (21-11-1)1974 @CSUP 24, Western State 7 (22-11-1)1975 @Western State 17, CSUP 6 (22-12-1)1976 Western State 17, @CSUP6 (22-13-1)1977 @CSUP 42, Fort Hays St (Kan.) 14 (23-13-1)1978 CSUP 29, @Fort Hays St (Kan.) 6 (24-13-1)1979 @CSUP 41, Mexico Ministry of Ed. 7 (25-13-1)1980 CSUP 33, @Mexico Ministry of Ed. 0 (26-13-1)1981 @CSUP 36, East Central (Okla.) 14 (27-13-1)1982 @CSUP 24, Carroll (Mont.) 21 (28-13-1) 1983 Central Missouri 34, @CSUP 9 (28-14-1)1984 Central Oklahoma 48, @CSUP 7 (28-15-1)1985-2007 No Team2008 @CSUP 24, Okla Panhandle St 13 (29-15-1)2009 @CSUP 28, Eastern New Mexico 23 (30-15-1)2010 CSUP 26, Okla Panhandle St. 14 (31-15-1)
HOMECOMING (HOMEcOMING REcORDS ONlY ExIST SINcE 1963)Year Score/Opponent CSUP Record1963 Washburn (Kan.) 7, CSUP 0 (0-1)1964 CSUP 39, Fort Lewis 6 (1-1)1965 CSUP 26, Emporia State (Kan.) 13 (2-1)1966 CSUP 25, Fort Lewis 7 (3-1)1967 Adams State 17, CSUP 13 (3-2)1968 CSUP 20, Fort Hays State (Kan.) 14 (4-2)1969 CSUP 10, Emporia State (Kan.) 9 (5-2)1970 Pittsburg State (Kan.) 34, CSUP 9 (5-3)
1971 Nebraska-Omaha 19, CSUP 6 (5-4)1972 CSUP 25, Pittsburg State (Kan.) 3 (6-4)1973 CSUP 32, Nebraska-Omaha 28 (7-4)1974 CSUP 50, Emporia State (Kan.) 13 (8-4)1975 CSUP 20, Washburn (Kan.) 6 (9-4)1976 CSUP 16, Adams State 10 (10-4)1977 CSUP 44, New Mexico Highlands 6 (11-4)1978 CSUP 16, Adams State 13 (12-4)1979 CSUP 47, New Mexico Highlands 18 (13-4)
1980 CSUP 20, Adams State 18 (14-4)1981 Western State 21, CSUP 7 (14-5)1982 CSUP 36, Southern Utah 22 (15-5)1983 CSUP 44, Western State 27 (16-5)1984 Southern Utah 17, CSUP 13 (16-6)1985-2007 No Team2008 CSUP 21, New Mexico Highlands 14 (17-6)2009 CSUP 38, Western State 27 (18-6)2010 CSUP 33, Chadron State 30 (3OT) (19-6)
All-TIME REcORD VS. OPPONENTSTeam W L TAdams State 15 10 2Adams State (JV) 2 1 0Air Force Prep 1 0 0Cameron (Okla.) 0 2 0Carroll (Mont.) 1 0 0Central Missouri 0 1 0Chadron State 2 1 0Coffeyville Community College (Kan.) 0 2 0Colorado (JV) 0 2 0Colorado College (JV) 2 3 0Colorado School of Mines 12 8 0Colorado School of Mines (JV) 1 1 1Colorado State (JV) 0 1 0Dodge City Community College (Kan.) 2 4 0Eastern Arizona Junior College 1 1 0East Central (Okla.) 1 0 0Eastern New Mexico 3 6 1
Emporia State (Kan.) 9 4 0Fort Hays State (Kan.) 9 6 0Fort Lewis 31 15 0Garden City Community College (Kan.) 4 3 0Idaho 0 1 0Lamar Community College (Kan.) 6 2 0McCook Community College (Neb.) 2 7 2Mesa State 11 17 5Mexico Ministry of Education 2 0 0New Mexico Military Institute 1 3 0Northeastern Junior College (Colo.) 9 4 1Northwest College (Wyo.) 2 0 0Northwestern Oklahoma State 1 3 0Nebraska-Kearney 0 3 0Nebraska-Omaha 1 3 0New Mexico (JV) 0 2 0New Mexico Highlands 11 5 0Northern Colorado 0 11 2
Northern Colorado (JV) 3 2 0Oklahoma Panhandle State 6 2 0Otero Junior College (Colo.) 10 8 0Pittsburg State (Kan.) 2 7 0South Dakota-Springfield 1 0 0Southern Utah 3 6 0St. Mary’s of the Plains (Kan.) 2 0 0Trinidad State Junior College (Colo.) 4 17 1UNLV 0 1 0Washburn (Kan.) 7 4 0Weber State (Utah) 0 2 0Western Nebraska Community College 12 1 0Western New Mexico 12 6 0Western State 9 9 0Westminster (Utah) 1 1 0Wyoming (Freshmen) 0 1 0
ROCKY MOUNTAIN ATHLETIC CONFERENCE OPENERS*Year Score/Opponent CSUP Record1969 @Pittsburg State (Kan.) 21, CSUP 17 (0-1)1970 @CSUP 20, Emporia State (Kan.) 14 (1-1)1971 CSUP 30, @Emporia State (Kan.) 9 (2-1)1972-75 in Great Plains Athletic Conference1976 Western State 17, @CSUP 6 (2-2)
1977 @Colorado Mines 13, CSUP 10 (2-3)1978 @CSUP 24, Colorado Mines 14 (3-3)1979 CSUP 48, @Mesa State 10 (4-3)1980 @CSUP 27, Mesa State 7 (5-3)1981 Mesa State 20, @CSUP 14 (5-4)1982 @Mesa State 14, CSUP 13 (5-5)
1983 CSUP 21, @New Mexico Highlands 14 (6-5)1984 @CSUP 27, New Mexico Highlands 13 (7-5)1985-2007 No team2008 CSUP 37, @Fort Lewis 7 (8-5)2009 @CSUP 38, Fort Lewis 0 (9-5)2010 CSUP 27, Adams State 10 (10-5)
* CSU-Pueblo played football in the Rocky Mountain Athletic Conference during the following years: 1969-71; 1976-84; and 2008-Present
HOME OPENERS (SINcE 1963)Year Score/Opponent CSUP Record1963 Emporia State (Kan.) 21,CSUP 20 (0-1)1964 CSUP 34, Western New Mexico 7 (1-1)1965 CSUP 0, Northern Colorado 0 (1-1-1)1966 CSUP 15, Okla Panhandle St 9 (2-1-1)1967 CSUP 7, Northern Colorado 0 (2-1-2)1968 CSUP 10, Pittsburg State (Kan.) 7 (3-1-2)1969 CSUP 21, Washburn (Kan.) 20 (4-1-2)1970 CSUP 24, Western State 12 (5-1-2)
1971 CSUP 34, Adams State 27 (6-1-2)1972 Western State 35, CSUP 13 (6-2-2)1973 Adams State 8, CSUP 7 (6-3-2)1974 CSUP 24, Western State 7 (7-3-2)1975 CSUP 17, Adams State 8 (8-3-2)1976 Western State 17, CSUP 6 (8-4-2)1977 CSUP 42, Fort Hays St (Kan.) 14 (9-4-2)1978 CSUP 24, Colorado Mines 14 (10-4-2)1979 CSUP 41, Mexico Ministry of Ed. 7 (11-4-2)
1980 CSUP 27, Mesa State 7 (12-4-2)1981 CSUP 36, East Central (Okla.) 14 (13-4-2)1982 CSUP 24, Carroll (Mont.) 21 (14-4-2) 1983 Central Missouri 34, CSUP 9 (14-5-2)1984 Central Oklahoma 48, CSUP 7 (14-6-2)1985-2007 No Team2008 CSUP 24, Okla Panhandle St 13 (15-6-2)2009 CSUP 28, Eastern New Mexico 23 (16-6-2)2010 CSUP 55, Northwestern Okla. St. 13 (17-6-2)
69
Adams State (15-10-2)1938 N T 7-7 1939 N L 12-26 11/02/1940 N W 20-6 10/11/1941 A T 0-0 11/13/1965 H L 16-22 11/12/1966 A L 0-16 11/11/1967 H L 13-27 11/16/1968 A L 0-31 11/15/1969 H W 12-10 09/26/1970 A W 20-17 09/25/1971 H W 34-27 09/23/1972 A W 37-28 09/22/1973 H L 7-8 09/21/1974 A L 7-27 09/20/1975 H W 17-8 10/16/1976 A W 16-10 10/22/1977 A W 34-7 10/21/1978 H W 16-13 10/27/1979 A W 20-18 10/25/1980 H W 20-18 11/07/1981 H L 10-19 11/06/1982 A W 33-24 11/12/1983 H W 51-28 11/10/1984 A L 25-51 11/8/2008 H L 8-16 11/7/2009 A W 41-7 9/18/2010 H W 27-10 Cameron (OK) (0-2)11/01/1975 H L 7-35 11/20/1976 A L 7-31 Carroll (MT) (1-0)9/04/1982 H W 24-21 Central Missouri (0-1)09/03/1983 H L 9-34 Central Oklahoma (0-2)12/04/1982 H L 20-61 09/08/1984 H L 7-48 Chadron State (NE) (2-1)9/20/2008 H L 0-32 9/19/2009 A W 28-17 10/2/2010 H W 33-30 OTColorado Mesa (11-17-5)1939 N L 7-24 11/16/1940 N T 14-14 10/17/1941 A L 0-52 11/07/1942 H L 6-25 1946 N L 6-7 1947 N T 0-0 1948 N T 0-0 1949 N W 33-7 11/11/1950 A W 18-13 1951 N L 13-47 1952 N L 6-40 1953 N L 7-28 1954 N L 0-22 1955 N W 33-14 1956 N L 12-20 1957 H T 7-7 1958 N L 6-19 1959 N L 13-21 1960 N W 21-14 1961 N W 21-0 1962 N L 0-14 11/13/1976 H W 20-6 11/19/1977 A L 7-16 11/18/1978 H W 49-19 09/22/1979 A W 48-10 09/20/1980 H W 27-7 09/19/1981 H L 14-20 09/18/1982 H L 13-14 09/24/1983 H T 14-14 09/22/1984 A W 6-38 10/11/2008 A L 3-26 10/10/2009 H L 13-21 10/23/2010 A W 26-14Colorado School of Mines (12-8)11/21/1964 A W 28-9 11/20/1965 H W 24-12 11/19/1966 A L 20-21 11/18/1967 H W 46-33 11/23/1968 A L 21-45 11/22/1969 H W 14-6 11/21/1970 H W 21-12 11/20/1971 A W 30-18
09/18/1976 A W 21-18 09/24/1977 A L 10-13 09/23/1978 H W 24-14 09/29/1979 A L 14-15 09/27/1980 H W 27-19 10/24/1981 H W 28-27 10/23/1982 A W 16-10 10/29/1983 H W 14-9 10/27/1984 A L 9-42 9/27/2008 A L 14-21 OT 9/26/2009 H L 7-31 10/9/2010 A L 16-19East Central (OK) (1-0)09/12/1981 H W 36-14 Eastern New Mexico (3-6-1)1938 N. L 12-20 1939 N. L 0-33 09/30/1972 H W 35-7 09/29/1973 A. L 15-43 09/28/1974 H L 21-29 09/27/1975 A. L 16-28 11/06/1976 H T 17-17 10/03/1981 H W 20-17 10/06/1984 A. L 13-70 8/29/2009 H W 28-23 Emporia State (9-4)1963 H L 20-21 10/17/1964 A W 27-7 10/16/1965 H W 26-13 10/15/1966 A W 22-0 10/14/1967 H W 34-6 10/12/1968 A L 17-20 10/11/1969 H W 10-9 10/10/1970 H W 20-14 10/09/1971 A W 30-9 10/14/1972 H L 10-24 10/13/1973 A L 12-45 10/26/1974 H W 50-13 10/25/1975 A W 34-20 Fort Hays State (KS) (9-6)1963 A L 14-18 10/31/1964 H W 34-19 10/30/1965 A W 24-14 10/28/1967 A L 0-14 10/26/1968 H W 20-14 10/25/1969 A W 43-8 10/31/1970 H L 21-42 10/30/1971 A L 7-10 11/04/1972 H W 34-9 11/03/1973 A L 7-42 11/16/1974 H L 13-28 11/15/1975 H W 31-27 10/02/1976 H W 31-21 09/17/1977 H W 42-14 09/16/1978 A W 29-6 Fort Lewis (CO) (31-15)1938 N W 19-6 1939 N W 20-6 10/26/1940 N L 7-21 11/20/1941 A L 0-32 10/24/1942 A W 13-0 1946 N W 12-6 1947 N W 13-6 1948 H L 0-7 1949 N L 13-20 11/04/1950 A L 6-13 1951 N L 6-13 1952 N L 19-39 1953 N W 14-6 1954 N W 31-26 1955 N L 20-26 1956 N W 19-9 1957 N L 6-19 1958 N L 6-25 1959 N W 60-0 1960 N W 25-6 1961 N W 53-14 1962 N W 14-0 1963 H W 28-6 1963 A W 7-0 10/24/1964 H W 39-6 10/23/1965 A W 57-27 10/22/1966 H W 25-7 10/21/1967 A L 6-22 11/08/1969 H W 31-0 09/12/1970 A W 21-7
09/11/1971 N W 38-0 11/19/1972 H W 39-26 09/08/1973 A W 30-17 11/23/1974 H W 13-12 09/25/1976 A L 9-17 10/01/1977 H L 27-34 09/30/1978 A W 20-17 10/06/1979 H W 26-22 10/04/1980 A W 45-14 09/26/1981 A L 0-3 09/25/1982 H W 49-30 10/01/1983 A W 10-6 09/29/1984 H L 10-38 9/13/2008 A W 37-7 9/12/2009 H W 38-0 9/25/2010 A W 49-14 Idaho (0-1)09/10/1983 A L 28-43 Northwestern Oklahoma State (1-3)10/03/1970 A L 21-27 10/02/1971 H L 7-50 9/5/2009 A L 28-34 9/4/2010 H W 55-13 Nebraska-Kearney (0-3)10/4/2008 H L 10-4110/3/2009 A L 12-4410/16/2010 H L 24-38 Nebraska-Omaha (1-3)10/17/1970 A L 15-44 10/16/1971 H L 9-16 10/21/1972 A L 3-14 10/20/1973 H W 32-28New Mexico Highlands (11-5)1946 N L 0-6 11/06/1965 A W 10-7 11/05/1966 H L 13-47 11/04/1967 H L 6-70 11/09/1968 H L 10-48 10/15/1977 H W 42-6 10/14/1978 A W 29-22 10/20/1979 H W 47-18 10/18/1980 A W 24-21 11/14/1981 A L 13-33 11/13/1982 H W 33-13 09/17/1983 A W 21-14 09/15/1984 H W 27-13 10/18/2008 H W 21-14 10/17/2009 A W 35-7 10/30/2010 H W 66-0Northern Colorado (0-11-2)11/07/1964 A L 8-21 09/25/1965 H T 0-0 09/24/1966 A L 13-29 09/24/1967 H T 7-7 11/02/1968 A L 8-52 11/01/1969 H L 20-41 11/07/1970 A L 10-27 11/07/1971 H L 14-17 11/11/1972 A L 0-3 11/10/1973 H L 7-24 10/05/1974 A L 14-48 10/04/1975 H L 21-24 10/09/1976 A L 7-38 Oklahoma Panhandle State (6-2)09/19/1964 H L 7-19 09/18/1965 A W 10-0 09/17/1966 H W 15-9 09/16/1967 A L 13-21 11/17/1979 A W 24-9 11/15/1980 H W 45-25 9/6/2008 H W 24-13 8/28/2010 a W 26-14 Pittsburg State (KS) (2-7)1963 A L 0-46 09/21/1968 H W 10-7 09/20/1969 A L 17-21 10/24/1970 H L 9-34 10/23/1971 A L 24-26 10/28/1972 H W 25-3 10/27/1973 A L 17-20 11/09/1974 H L 20-31 11/08/1975 A L 7-26
South Dakota-Springfield (1-0)09/11/1982 H W 45-3Southern Utah (3-6)10/23/1976 A W 32-9 11/05/1977 H L* 24-0 11/04/1978 A L 21-22 11/10/1979 H W 30-13 11/08/1980 A L 15-49 10/10/1981 A L 12-27 10/09/1982 H W 36-22 10/15/1983 A L 21-32 10/13/1984 H L 13-17 * Forfeited due to ineligible players St. Mary’s of the Plains (KS) (2-0)1963 A W 28-709/26/1964 H W 41-0 Nevada-Las Vegas (0-1)10/19/1968 A L 21-25 Washburn (KS) (7-4)1963 H L 0-7 10/10/1964 A L 7-12 10/09/1965 H W 45-14 10/08/1966 A L 13-21 10/07/1967 H W 20-0 09/28/1968 A W 10-7 09/27/1969 H W 21-20 10/07/1972 A W 13-0 10/06/1973 H W 28-7 10/19/1974 A L 14-19 10/18/1975 H W 20-8 Weber State (UT) (0-2)1963 H L 14-28 10/03/1964 A L 14-19 Western New Mexico (12-6)09/12/1964 H W 34-7 09/11/1965 A W 20-13 10/01/1966 H L 0-24 09/30/1967 A L 3-21 10/05/1968 H W 21-7 10/04/1969 A W 23-6 10/30/1976 H W 33-27 10/08/1977 A L 10-17 10/07/1978 H W 36-10 10/13/1979 A L 14-17 10/11/1980 H W 39-7 10/31/1981 A W 24-0 10/30/1982 H W 50-0 11/05/1983 A W 24-14 11/03/1984 H L 7-34 11/1/2008 A L 14-24 10/31/2009 H W 48-3 11/13/2010 A W 45-17 Western State (CO) (9-9)09/17/1970 H W 24-12 09/18/1971 A L 7-10 09/14/1972 H L 13-35 09/15/1973 A L 21-41 09/12/1974 H W 24-7 09/13/1975 A L 6-17 09/11/1976 H L 6-17 10/29/1977 H L* 14-10 10/28/1978 A L 43-51 11/03/1979 H W 34-28 11/01/1980 A W 27-10 10/17/1981 H L 7-21 10/16/1982 A W 28-7 10/22/1983 H W 44-27 10/20/1984 A L 10-46 10/25/2008 A W 20-17 10/24/2009 H W 38-27 11/6/2010 A W 37-3*Forfeited due to ineligible players Westminster (UT) (1-1)11/12/1977 A L* 34-22 11/11/1978 H W 38-27 * Forfeited due to ineligible players
All-TIME SERIES VS. OPPONENTS
70
YEAR-BY-YEAR RESULTSCOACH DR. DALE REA
1938-40The first coach in CSUP history, he started the athletic program at then-Pueblo Junior College, coaching the football and basketball
teams. He went on to become the president of Fort Lewis College and was an inaugural inductee to the CSU-Pueblo Athletics Hall of
Fame in 1938.1938
(1-3-2 overall; 1-2 conf.) Coach: Dr. Dale Rea 1938 vs Colorado Mines JV T 0-0 1938 vs Colorado College JV L 0-15 1938 vs Adams State T 7-7* 1938 vs Eastern New Mexico L 12-20* 1938 vs Fort Lewis W 19-6* 1938 vs Trinidad State (Colo.) L 7-12
1939(2-4 overall; 2-1 conf.) Coach: Dr. Dale Rea
1939 vs Colorado JV L 7-26 1939 vs Adams State L 12-26 1939 vs Mesa State L 7-24* 1939 vs Eastern New Mexico L 0-33* 1939 vs Trinidad State JC W 20-6* 1939 vs Fort Lewis W 20-6
1940(3-2-1 overall; 0-2 conf.) Coach: Dr. Dale Rea
10/05/1940 vs Colorado College JV W 19-6 10/18/1940 vs Colorado Mines JV W 20-19* 10/26/1940 vs Fort Lewis L 7-21 11/02/1940 vs Adams State W 20-6* 11/11/1940 vs Trinidad State (Colo.) L 6-39 11/16/1940 vs Mesa State T 14-14
COACH JACK JOHNSON1941
Coach Johnson helmed the PJC team for one year upon the departure of Coach Rea, who left to fight in World War II. Johnson is the only
CSU-Pueblo football coach to not earn a single win.
1941(0-6-1 overall; 0-2 conf.) Coach: Jack Johnson
10/04/1941 COLORADO MINES JV L 0-27 10/11/1941 at Adams State T 0-0 10/17/1941 at Mesa State L 0-52 10/25/1941 at Colorado College JV L 6-19 11/01/1941 NORTHERN COLO JV L 0-26* 11/15/1941 TRINIDAD ST (COLO.) L 0-18 * 11/20/1941 at Fort Lewis L 0-32
COACH DAN LAWRENCE1942
Like his predecessor, Lawrence also helmed the PJC team for just one year. Lawrence mustered one win in the first season to take place during World War II. The program would go on haitus for the duration
of the war after 1942
1942(1-4 overall; 1-2 conf.) Coach: Dan Lawrence
* 10/10/1942 at Trinidad State (Colo.) L 0-31* 10/17/1942 OTERO (COLO.) L 0-13* 10/24/1942 at Fort Lewis W 13-0 11/07/1942 MESA STATE L 6-25 11/14/1942 at Otero (Colo.) L 6-40
MAURICE “RED” ELDER1946-51
A former All-American at Kansas State University who was actually drafted by the Washington Redskins in 1937, “Red” Elder led the
football team to its best seasons. Today, he still has the third-highest winning percentage in school history. Like trivia? Elder’s grandson is
NFL quarterback, Jeff Garcia.
1946(5-4 overall; 2-2 conf.) Coach: Maurice “Red” Elder
1946 vs N.M. Highlands L 0-6 1946 vs Garden City (Kan.) W 24-0* 1946 vs Mesa State L 6-7 1946 vs Colorado State JV L 6-25* 1946 vs Trinidad State (Colo.) L 13-32* 1946 vs Fort Lewis W 12-6* 1946 vs Otero (Colo.) W 27-0 1946 vs Northeastern (Colo.) W 19-0 1946 vs Dodge City (Kan.) W 54-6
1947(3-3-1 overall; 3-1-1 conf.) Coach: Maurice “Red” Elder
1947 at NM Military Institute L 6-26* 1947 vs Lamar (Colo.) W 39-0* 1947 TRINIDAD ST (COLO.) L 6-18* 1947 vs Fort Lewis W 13-6* 1947 vs Mesa State T 0-0* 1947 OTERO (COLO.) W 46-21 1947 at Dodge City (Kan.) L 0-12
1948(7-1-1 overall; 4-1-1 conf.) Coach: Maurice “Red” Elder
1948 vs NM Military Institute W 14-12 1948 at Garden City (Kan.) W 7-6* 1948 vs Mesa State T 0-0* 1948 at Lamar (Colo.) W 19-7 1948 DODGE CITY (KAN.) W 13-0* 1948 vs Otero (Colo.) W 32-0* 1948 vs Northeastern (Colo.) W 46-0* 1948 FORT LEWIS L 0-7* 1948 vs Trinidad State (Colo.) W 23-13
1949(5-3-1 overall; 2-2-1 conf.) Coach: Maurice “Red” Elder
1949 GARDEN CITY (KAN.) W 20-0 1949 at Northeastern (Colo.) W 22-12* 1949 LAMAR (COLO.) L 7-21 1949 at Dodge City (Kan.) L 7-13 1949 vs Western Nebraska W 41-17* 1949 vs Otero (Colo.) W 41-0* 1949 vs Mesa State W 33-7* 1949 vs Fort Lewis L 13-20* 1949 vs Trinidad State (Colo.) T 6-6
1950(4-6 overall; 3-2 conf.) Coach: Maurice “Red” Elder
09/22/1950 at Garden City (Kan.) L 0-25 09/30/1950 COFFEYVILLE (KAN.) L 6-48* 10/07/1950 at Lamar (Colo.) W 32-7 10/13/1950 DODGE CITY (KAN.) L 6-13 10/21/1950 at Western Nebraska W 18-12* 10/27/1950 OTERO (COLO.) W 21-19* 11/04/1950 at Fort Lewis L 6-13* 11/11/1950 at Mesa State W 18-13 11/18/1950 COLORADO JV L 7-43* 11/23/1950 at Trinidad State (Colo.) L 13-26
1951(1-8 overall; 1-5 conf.) Coach: Maurice “Red” Elder
1951 vs Garden City (Kan.) L 20-33 1951 vs Coffeyville (Kan.) L 7-42* 1951 vs Lamar (Colo.) W 30-20* 1951 vs Northeastern (Colo.) L 6-13* 1951 vs Otero (Colo.) L 19-26* 1951 vs Fort Lewis L 6-13* 1951 vs Mesa State L 13-47 1951 vs Dodge City (Kan.) L 25-54* 1951 vs Trinidad State (Colo.) L 25-34
HARRY SIMMONS1952-55
Known as “The Chief”, Simmons is immortalized as the longtime CSU-Pueblo basketball coach. But he helmed the football program for four
years, as well, winning games at about a 50 percent clip.
1952(2-6-1 overall; 2-4 conf.) Coach: Harry Simmons
* 1952 vs Trinidad State (Colo.) W 32-0* 1952 vs Fort Lewis L 19-39* 1952 vs Northeastern (Colo.) L 12-21* 1952 vs Mesa State L 6-40* 1952 vs Otero (Colo.) W 14-7 1952 vs Dodge City (Kan.) L 0-42* 1952 vs Lamar (Colo.) L 6-14 1952 vs Western Nebraska L 13-29 1952 vs McCook (Neb.) T 6-6
1953(6-3 overall; 5-3 conf.) Coach: Harry Simmons
1953 vs Colorado College JV W 19-6 * 1953 vs Mesa State L 7-28 * 1953 vs McCook (Neb.) L 6-34* 1953 vs Otero (Colo.) W 50-14* 1953 vs Fort Lewis W 14-6* 1953 vs Lamar (Colo.) W 48-6* 1953 vs Northeastern (Colo.) W 7-0* 1953 vs Western Nebraska W 25-7* 1953 vs Trinidad State (Colo.) L 6-40
1954(5-4 overall; 5-3 conf.) Coach: Harry Simmons
* 1954 vs Otero (Colo.) W 31-7* 1954 vs Mesa State L 0-22* 1954 vs Fort Lewis W 31-26* 1954 vs McCook (Neb.) L 6-31* 1954 vs Northeastern (Colo.) W 34-13* 1954 vs Western Nebraska W 31-14 1954 vs New Mexico JV L 12-19* 1954 vs Lamar (Colo.) W 32-19* 1954 vs Trinidad State (Colo.) L 0-64
SEL ELIZONDOTwo-time all-conference selection, 1950-51
71
1955(3-4-1 overall; 3-3-1 conf.) Coach: Harry Simmons
* 1955 vs Otero (Colo.) W 20-0* 1955 vs Mesa State W 33-14 1955 vs New Mexico JV L 14-32* 1955 vs Fort Lewis L 20-26* 1955 vs Northeastern (Colo.) T 6-6* 1955 vs Western Nebraska W 27-13* 1955 vs McCook (Neb.) L 21-46* 1955 vs Trinidad State (Colo.) L 6-59
JOE PRATER1956-73
One of the longest-tenured coaches of any sport in CSU-Pueblo his-tory, Prater led CSU-Pueblo for 17 years, leading the football program
during the school’s transition to a four-year college in 1963. His 85 career wins are the most of any coach in school history.
1956(4-6 overall; 3-2 conf.) Coach: Joe Prater
* 1956 vs McCook (Neb.) W 33-12* 1956 vs Mesa State L 12-20 1956 vs NM Military Institute L 7-33* 1956 vs Western Nebraska W 26-0* 1956 vs Otero (Colo.) W 18-13* 1956 vs Northeastern (Colo.) W 14-0* 1956 vs Fort Lewis W 19-9* 1956 vs Trinidad State (Colo.) L 7-19
1957(4-5-1 overall; 3-3-1 conf.) Coach: Joe Prater
* 1957 vs Western Nebraska W 12-0* 1957 vs McCook (Neb.) L 13-27* 1957 MESA STATE T 7-7 1957 vs NM Military Institute L 0-9 1957 vs Eastern Arizona W 21-7* 1957 vs Fort Lewis L 6-19* 1957 at Otero (Colo.) L 0-9* 1957 vs Northeastern (Colo.) W 14-6* 1957 vs Trinidad State (Colo.) W 26-6 1957 vs Colorado College JV L 6-21
1958(3-6 overall; 2-5 conf.) Coach: Joe Prater
* 1958 vs Western Nebraska W 26-7* 1958 vs McCook (Neb.) L 0-7* 1958 vs Mesa State L 6-19 1958 GARDEN CITY (KAN.) W 38-13 1958 vs Eastern Arizona L 20-27* 1958 vs Fort Lewis L 6-25* 1958 vs Otero (Colo.) L 6-13* 1958 vs Northeastern (Colo.) W 31-0* 1958 vs Trinidad State (Colo.) L 6-15
1959(4-4-1 overall; 2-3-1 conf.) Coach: Joe Prater
* 1959 vs Western Nebraska W 27-25* 1959 vs McCook (Neb.) T 6-6* 1959 vs Mesa State L 13-21 1959 vs Garden City (Kan.) L 14-19 1959 vs Northern Colorado JV W 27-13* 1959 vs Fort Lewis W 60-0 1959 vs Northwest (Wyo.) W 14-6* 1959 vs Otero (Colo.) L 7-14* 1959 vs Trinidad State (Colo.) L 7-32
1960(6-4 overall; 4-3 conf.) Coach: Joe Prater
* 1960 vs Western Nebraska W 34-0* 1960 vs McCook (Neb.) W 19-12 1960 vs Northwest (Wyo.) W 39-0* 1960 vs Fort Lewis W 25-6* 1960 vs Mesa State W 21-14* 1960 vs Otero (Colo.) L 3-9* 1960 vs Northeastern (Colo.) L 14-27 1960 vs Adams State JV W 40-7 1960 vs Northern Colorado JV L 7-14* 1960 vs Trinidad State (Colo.) L 0-19
1961(4-6 overall; 3-4 conf.) Coach: Joe Prater
* 1961 vs Western Nebraska W 24-6 * 1961 vs McCook (Neb.) L 12-13 * 1961 vs Fort Lewis W 53-14 * 1961 vs Trinidad State (Colo.) L 0-49 * 1961 vs Mesa State W 21-0 * 1961 vs Otero (Colo.) L 13-20 * 1961 vs Northeastern (Colo.) L 0-46 1961 vs Adams State JV L 20-21 1961 vs Northern Colorado JV W 34-6 1961 vs Wyoming Freshmen L 6-34
1962(7-3 overall; 3-3 conf.) Coach: Joe Prater
1962 vs Northwest (Wyo.) W 21-7 1962 vs Air Force Prep W 14-13 * 1962 vs McCook (Neb.) L 0-13 * 1962 vs Fort Lewis W 14-0 * 1962 vs Trinidad State (Colo.) L 6-26 * 1962 vs Western Nebraska W 7-0 * 1962 vs Mesa State L 0-14 * 1962 vs Northeastern (Colo.) W 27-20 1962 vs Adams State JV W 27-0 1962 vs Northern Colorado JV W 30-6
FOUR-YEAR ERA
In 1963, Pueblo Junior College became Southern Colorado State College, and its athletic programs began competing against other four-year schools for the first time. Though the football program’s success as a junior college was admittedly mediocre, the program would be far more successful as a four-year program.
1963(3-5 overall; No conf. affiliation) Coach: Joe Prater
1963 EMPORIA STATE L 20-21 1963 at St. Mary’s of the Plains W 28-7 1963 WEBER STATE L 14-28 1963 at Pittsburg State L 0-46 1963 WASHBURN L 0-7 1963 FORT LEWIS W 28-6 1963 at Fort Hays State L 14-18 1963 at Fort Lewis W 7-0 Home: 1-3 Away: 2-2
1964(6-4 overall; No conf. affiliation) Coach: Joe Prater
09/12/1964 WESTERN NM W 34-7 09/19/1964 OKLA PANHANDLE ST L 7-19 09/26/1964 ST. MARY’S (Kan.) W 41-0 10/03/1964 at Weber State L 14-19 10/10/1964 at Washburn L 7-12 10/17/1964 at Emporia State W 27-7 10/24/1964 FORT LEWIS W 39-6 10/31/1964 FORT HAYS STATE W 34-19 11/07/1964 at Northern Colorado L 8-21 11/21/1964 at Colorado School of Mines W 28-9 Home: 4-1 Away: 2-3
1965(8-1-1 overall; No conf. affiliation) Coach: Joe Prater
09/11/1965 at Western New Mexico W 20-13 09/18/1965 at Okla. Panhandle W 10-0 09/25/1965 NORTHERN COLO. T 0-0 10/09/1965 WASHBURN W 45-14 10/16/1965 EMPORIA STATE W 26-13 10/23/1965 at Fort Lewis W 57-27 10/30/1965 at Fort Hays State W 24-14 11/06/1965 at N.M. Highlands W 10-7 11/13/1965 ADAMS STATE L 16-2 11/20/1965 COLORADO MINES W 24-12 Home: 3-1-1 Away: 5-0
YEAR-BY-YEAR RESULTS
FRANK HESTERAll-time single game rushing yardage leader (304 yards vs. Emporia State, 1965)
72
1966(3-6 overall; No conf. affiliation) Coach: Joe Prater
09/17/1966 OKLA. PANHANDLE W 15-9 09/24/1966 at Northern Colo. L 13-29 10/01/1966 WESTERN N.M. L 0-24 10/08/1966 at Washburn L 13-21 10/15/1966 at Emporia State W 22-0 10/22/1966 FORT LEWIS W 25-7 11/05/1966 N.M. HIGHLANDS L 13-47 11/12/1966 at Adams State L 0-16 11/19/1966 at Colorado Mines L 20-21 Home: 2-2 Away: 1-4
1967(3-6-1 overall; No conf. affiliation) Coach: Joe Prater
09/16/1967 at Okla. Panhandle L 13-21 09/24/1967 NORTHERN COLO. T 7-7 09/30/1967 at Western N.M. L 3-21 10/07/1967 WASHBURN W 20-0 10/14/1967 EMPORIA STATE W 34-6 10/21/1967 at Fort Lewis L 6-22 10/28/1967 at Fort Hays State L 0-14 11/04/1967 N.M. HIGHLANDS L 6-70 11/11/1967 ADAMS STATE L 13-27 11/18/1967 COLORADO MINES W 46-33 Home: 3-2-1 Away: 0-4
1968(4-6 overall; No conf. affiliation) Coach: Joe Prater
09/21/1968 PITTSBURG STATE W 10-7 09/28/1968 at Washburn W 10-7 10/05/1968 WESTERN N.M. W 21-7 10/12/1968 at Emporia State L 17-20 10/19/1968 at UNLV L 21-25 10/26/1968 FORT HAYS STATE W 20-14 11/02/1968 at Northern Colo. L 8-52 11/09/1968 N.M. HIGHLANDS L 10-48 11/16/1968 at Adams State L 0-31 11/23/1968 at Colorado Mines L 21-45 Home: 3-1 Away: 1-5
1969(7-2 overall; 3-2 RMAC) Coach: Joe Prater
* 09/20/1969 at Pittsburg State L 17-21 * 09/27/1969 WASHBURN W 21-20 10/04/1969 at Western N.M. W 23-6* 10/11/1969 EMPORIA STATE W 10-9* 10/25/1969 at Fort Hays State W 43-8* 11/01/1969 NORTHERN COLO. L 20-41 11/08/1969 FORT LEWIS W 31-0 11/15/1969 ADAMS STATE W 12-10 11/22/1969 COLORADO MINES W 14-6* Rocky Mountain Athletic Conference game Home: 5-1 Away: 2-1
1970(5-5 overall; 1-4 RMAC) Coach: Joe Prater
09/12/1970 at Fort Lewis W 21-7 09/17/1970 WESTERN STATE W 24-12 09/26/1970 at Adams State W 20-17 10/03/1970 at Northwestern Okla. L 21-27* 10/10/1970 EMPORIA STATE W 20-14* 10/17/1970 at Nebraska-Omaha L 15-44* 10/24/1970 PITTSBURG STATE L 9-34* 10/31/1970 FORT HAYS STATE L 21-42* 11/07/1970 at Northern Colo. L 10-27 11/21/1970 COLORADO MINES W 21-12* Rocky Mountain Athletic Conference game Home: 3-2 Away: 2-3
1971(4-6 overall; 1-4 RMAC) Coach: Joe Prater
09/11/1971 vs Fort Lewis W 38-0 3000 09/18/1971 at Western State L 7-10 1500 09/25/1971 ADAMS STATE W 34-27 5500 10/02/1971 NORTHWESTERN OKLA. L 7-50 2000* 10/09/1971 at Emporia State W 30-9 5500* 10/16/1971 NEBRASKA-OMAHA L 9-16 3200* 10/23/1971 at Pittsburg State L 24-26 10000* 10/30/1971 at Fort Hays State L 7-10 2000* 11/07/1971 NORTHERN COLO. L 14-17 2000 11/20/1971 at Colorado Mines W 30-18 860* Rocky Mountain Athletic Conference game Home: 1-3 Away: 2-3
1972(6-4 overall; 3-3 GPAC) Coach: Joe Prater
09/14/1972 WESTERN STATE L 13-35 3100 09/23/1972 at Adams State W 37-28 2600 09/30/1972 EASTERN NEW MEXICO W 35-7 600* 10/07/1972 at Washburn W 13-0 5000* 10/14/1972 EMPORIA STATE L 10-24 4200* 10/21/1972 at Nebraska-Omaha L 3-14 2600* 10/28/1972 PITTSBURG STATE W 25-3 700* 11/04/1972 FORT HAYS STATE W 34-9 300* 11/11/1972 at Northern Colo. L 0-3 6352 11/19/1972 FORT LEWIS W 39-26 650* Great Plains Athletic Conference game Home: 4-2 Away: 2-2
1973(3-7 overall; 1-4 GPAC) Coach: Joe Prater
09/08/1973 at Fort Lewis W 30-17 3000 09/15/1973 at Western State L 21-41 2500 09/22/1973 ADAMS STATE L 7-8 3500 09/29/1973 at Eastern New Mexico L 15-43 3000* 10/06/1973 WASHBURN W 28-7 1500* 10/13/1973 at Emporia State L 12-45 8000 10/20/1973 NEBRASKA-OMAHA W 32-28 3500* 10/27/1973 at Pittsburg State L 17-20 2000* 11/03/1973 at Fort Hays State L 7-42 3000* 11/10/1973 NORTHERN COLO. L 7-24 1500* Great Plains Athletic Conference game Home: 2-2 Away: 1-5
MIKE FRIEDMAN1974-83
The most successful coach in CSU-Pueblo history, Friedman’s squads became the first to garner national rankings and a national playoff
berth (in 1982). Friedman’s legacy as a great coach was tarnished, however, by his ability to follow the rules, as evidenced by his use of an ineligible player in 1977 and the reason behind his dismissal in 1983 –
doctoring game tape that was sent to an opponent.
1974(3-6 overall; 1-4 GPAC) Coach: Mike Friedman
09/12/1974 WESTERN STATE W 24-7 09/21/1974 at Adams State L 7-27 09/28/1974 EASTERN NEW MEXICO L 21-29* 10/05/1974 at Northern Colo. L 14-48* 10/19/1974 at Washburn L 14-19* 10/26/1974 EMPORIA STATE W 50-13* 11/09/1974 PITTSBURG STATE L 20-31* 11/16/1974 FORT HAYS STATE L 13-28 11/23/1974 FORT LEWIS W 13-12* Great Plains Athletic Conference game Home: 3-3 Away: 0-3
1975(4-5 overall; 3-2 GPAC) Coach: Mike Friedman
09/13/1975 at Western State L 6-17 09/20/1975 ADAMS STATE W 17-8 09/27/1975 at Eastern New Mexico L 16-28* 10/04/1975 NORTHERN COLO. L 21-24* 10/18/1975 WASHBURN W 20-8* 10/25/1975 at Emporia State W 34-20 11/01/1975 CAMERON L 7-35* 11/08/1975 at Pittsburg State L 7-26* 11/15/1975 FORT HAYS STATE W 31-27* Great Plains Athletic Conference game Home: 3-2 Away: 1-3
1976(6-4-1 overall; 3-2 RMAC) Coach: Mike Friedman
* 09/11/1976 WESTERN STATE L 6-17 3900* 09/18/1976 at Colorado Mines W 21-18 2372* 09/25/1976 at Fort Lewis L 9-17 1500 10/02/1976 FORT HAYS STATE W 31-21 3054 10/09/1976 at Northern Colo. L 7-38 6200* 10/16/1976 at Adams State W 16-10 3200* 10/23/1976 at Southern Utah W 32-9 563* 10/30/1976 WESTERN N.M. W 33-27 950 11/06/1976 EASTERN NEW MEXICO T 17-17 2500* 11/13/1976 MESA STATE W 20-6 750 11/20/1976 at Cameron L 7-31 1000* Rocky Mountain Athletic Conference game Home: 3-1-1 Away: 3-3
YEAR-BY-YEAR RESULTS
NORM FLEISCHAUERAll-time single-season tackles leader
FRANK GRANT1972 All-American, former receiver with
Washington Redskins.
73
YEAR-BY-YEAR RESULTS
1977(3-7 overall; 2-7 RMAC) Coach: Mike Friedman
09/17/1977 FORT HAYS STATE W 42-14 2832* 09/24/1977 at Colorado Mines L 10-13 2000* 10/01/1977 FORT LEWIS L 27-34 5800* 10/08/1977 at Western N.M. L 10-17 1800* 10/15/1977 N.M. HIGHLANDS W 42-6 2000* 10/22/1977 at Adams State W 34-7 6586* 10/29/1977 WESTERN STATE L^ 14-10 4000* 11/05/1977 SOUTHERN UTAH L^ 24-0 1100* 11/12/1977 at Westminster L^ 34-22 1000 * 11/19/1977 at Mesa State L 7-16 3000* Rocky Mountain Athletic Conference game^ Game forfeited due to use of ineligible player Home: 2-3 Away: 1-4
1978(8-2 overall; 0-0 RMAC^) Coach: Mike Friedman
09/16/1978 at Fort Hays State W 29-6 5363 09/23/1978 COLORADO MINES W 24-14 2048 09/30/1978 at Fort Lewis W 20-17 3000 10/07/1978 WESTERN N.M. W 36-10 5368 10/14/1978 at N.M. Highlands W 29-22 1500 10/21/1978 ADAMS STATE W 16-13 2162 10/28/1978 at Western State L 43-51 3846 11/04/1978 at Southern Utah L 21-22 2016 11/11/1978 WESTMINSTER W 38-27 1015 11/18/1978 MESA STATE W 49-19 1222* Rocky Mountain Athletic Conference game^ Not eligible for RMAC Championship due to violations Home: 5-0 Away: 3-2
1979(8-2 overall; 6-2 RMAC) Coach: Mike Friedman
09/15/1979 MEXICO MINISTRY OF ED W 41-7 3432* 09/22/1979 at Mesa State W 48-10 3000* 09/29/1979 at Colorado Mines L 14-15 1321* 10/06/1979 FORT LEWIS W 26-22 2556* 10/13/1979 at Western N.M. L 14-17 948* 10/20/1979 N.M. HIGHLANDS W 47-18 2073* 10/27/1979 at Adams State W 20-18 3607* 11/03/1979 WESTERN STATE W 34-28 5775* 11/10/1979 SOUTHERN UTAH W 30-13 2020 11/17/1979 at Okla. Panhandle W 24-9 1290* Rocky Mountain Athletic Conference game Home: 5-0 Away: 3-2
1980(9-1 overall; 7-1 RMAC) Coach: Mike Friedman
09/13/1980 at Mexico Ministry of Ed. W 33-0 1750* 09/20/1980 MESA STATE W 27-7 6201* 09/27/1980 COLORADO MINES W 27-19 5982* 10/04/1980 at Fort Lewis W 45-14 2247* 10/11/1980 WESTERN N.M. W 39-7 4664* 10/18/1980 at N.M. Highlands W 24-21 2174* 10/25/1980 ADAMS STATE W 20-18 9147* 11/01/1980 at Western State W 27-10 4100* 11/08/1980 at Southern Utah L 15-49 2448 11/15/1980 OKLA. PANHANDLE W 45-25 1536* Rocky Mountain Athletic Conference game Home: 5-0 Away: 4-1
1981(4-6 overall; 2-6 RMAC) Coach: Mike Friedman
09/12/1981 EAST CENTRAL W 36-14* 09/19/1981 MESA STATE L 14-20* 09/26/1981 at Fort Lewis L 0-3 10/03/1981 EASTERN NEW MEXICO W 20-17* 10/10/1981 at Southern Utah L 12-27* 10/17/1981 WESTERN STATE L 7-21* 10/24/1981 COLORADO MINES W 28-27* 10/31/1981 at Western N.M. W 24-0* 11/07/1981 ADAMS STATE L 10-19* 11/14/1981 at N.M. Highlands L 13-33* Rocky Mountain Athletic Conference game Home: 3-3 Away: 1-3
1982(9-2 overall; 6-2 RMAC) Coach: Mike Friedman
09/04/1982 CARROLL (MONT.) W 24-21 2614 09/11/1982 S.D.-SPRINGFIELD W 45-3 3866* 09/18/1982 MESA STATE L 13-14 3500* 09/25/1982 FORT LEWIS W 49-30 5917* 10/09/1982 SOUTHERN UTAH W 36-22 3717* 10/16/1982 at Western State W 28-7 1867* 10/23/1982 at Colorado Mines W 16-10 3546* 10/30/1982 WESTERN N.M. W 50-0 4084* 11/06/1982 at Adams State W 33-24 4200* 11/13/1982 N.M. HIGHLANDS W 33-13 4169^ 12/04/1982 CENTRAL OKLAHOMA L 20-61 7442 ^ NAIA Quarterfinals, Pueblo, Colo. * Rocky Mountain Athletic Conference game Home: 6-2 Away: 3-0
1983(6-3-1 overall; 6-1-1 RMAC) Coach: Mike Friedman
09/03/1983 CENTRAL MISSOURI L 9-34 5679 09/10/1983 at Idaho L 28-43 12500* 09/17/1983 at N.M. Highlands W 21-14 1004* 09/24/1983 MESA STATE T 14-14 7224* 10/01/1983 at Fort Lewis W 10-6 1201* 10/15/1983 at Southern Utah L 21-32 1681* 10/22/1983 WESTERN STATE W 44-27 4822* 10/29/1983 COLORADO MINES W 14-9 3152* 11/05/1983 at Western N.M. W 24-14 654* 11/12/1983 ADAMS STATE W 51-28 4123* Rocky Mountain Athletic Conference game Home: 3-1-1 Away: 3-2
GARY RICHARDSON1984
Richardson was dealt the harshest hand of any coach in CSU-Pueblo history – having to direct a lame duck program. The one-time CSU-
Pueblo assistant coach inherited a depleted team and a program due to be on the chopping block for a campus-wide cost-cutting initiative that
claimed football, baseball, and gymnastics programs.
1984(2-8 overall; 2-6 RMAC) Coach: Gary Richardson
09/08/1984 CENTRAL OKLAHOMA L 7-48* 09/15/1984 N.M. HIGHLANDS W 27-13* 09/22/1984 at Mesa State W^ 6-38 * 09/29/1984 FORT LEWIS L 10-38 10/06/1984 at Eastern N.M. L 13-70* 10/13/1984 SOUTHERN UTAH L 13-17* 10/20/1984 at Western State L 10-46* 10/27/1984 at Colorado Mines L 9-42* 11/03/1984 WESTERN N.M. L 7-34
* 11/10/1984 at Adams State L 25-51 ^ Game forfeited to USC by Mesa State* Rocky Mountain Athletic Conference game Home: 1-4 Away: 1-4
JOHN WRISTEN2007-PRESENT
John Wristen, a former all-conference quarterback at CSU-Pueblo from 1980-83, was hired as CSU-Pueblo’s head football coach in July 2007. He was tasked with building a team from the ground up in just
365 days, with the first game taking place in September 2008. Working out of an office located in the attic of the CSU-Pueblo Library while the Neta and Eddie DeRose ThunderBowl, the former assistant at
Northwestern, UCLA and Colorado hired a world-class coaching staff and recruiting players that began paying immediate dividends.
2008(4-6 overall; 3-6 RMAC) Coach: John Wristen
9/6/2008 OKLA. PANHANDLE ST. W 24-13 9897* 9/13/2008 at Fort Lewis College W 37-7 789* 9/20/2008 CHADRON STATE L 0-32 7722* 9/27/2008 at Colorado Mines L (OT) 14-21 1246* 10/4/2008 NEBRASKA-KEARNEY L 10-41 6920* 10/11/2008 at Mesa State College L 3-26 1412* 10/18/2008 N.M. HIGHLANDS W 21-14 7383* 10/25/2008 at Western State W 20-17 895* 11/1/2008 at Western N.M. L 14-24 476* 11/8/2008 ADAMS STATE L 8-16 7341* Rocky Mountain Athletic Conference game Home: 2-3 Away: 2-3
2009(7-4 overall; 6-3 RMAC) Coach: John Wristen
8/29/2009 EASTERN NEW MEXICO W 28-23 8112 9/5/2009 at NW Oklahoma St. L 28-34 3721* 9/12/2009 FORT LEWIS W 38-0 6280* 9/19/2009 at Chadron State W 28-17 1100* 9/26/2009 COLORADO MINES L 7-31 6010* 10/3/2009 at Nebraska-Kearney L 12-44 2434* 10/10/2009 MESA STATE L 13-21 4998* 10/17/2009 at New Mexico Highlands W 35-7 1200* 10/24/2009 WESTERN STATE W 38-27 6741* 10/31/2009 WESTERN NEW MEXICO W 48-3 5010* 11/7/2009 at Adams State W 41-7 2085* Rocky Mountain Athletic Conference game Home: 4-2 Away: 3-2
2010(9-2 overall; 7-2 RMAC) Coach: John Wristen
8/28/2010 at Oklahoma Panhandle State W 26-14 2500 9/4/2010 NORTHWESTERN OKLA. ST. W 55-10 6723* 9/18/2010 at ADAMS STATE W 27-10 6068* 9/25/2010 at Fort Lewis W 49-14 1335* 10/2/2010 CHADRON STATE W (OT) 33-30 6431* 10/9/2010 at Colorado Mines L 16-19 3216* 10/16/2010 NEBRASKA-KEARNEY L 24-38 5905* 10/23/2010 at Mesa State W 26-14 529* 10/30/2010 NEW MEXICO HIGHLANDS W 66-0 5268* 11/6/2010 at Western State W 37-3 440* 11/13/2010 at Western New Mexico W 45-17 652* Rocky Mountain Athletic Conference game Home: 4-1 Away: 5-1
ALL-TIME RECORD214-203-15 (.513)
ALL-TIME RECORD (4-YEAR ERA)133-111-4 (.545)
NATIONAL PLAYOFF RECORD0-1 (.000) (*NAIA Playoffs in 1982)
CONFERENCE CHAMPIONSHIPS1980 – Rocky Mountain Athletic Conference
BILL GOWERAll-time rushing leader, All-American
74
ALL-TIME LETTERWINNERSAAbeyta, Timothy 1978-Abrams, Mike 1968-Ackinsanya, Daveon 2008-09-10Adams, Michael 1981Agnetta, Jim 1967Agyei, Augustine 2009Akins, James 1976-78-79-80Alberton, Bill 1942Albo, Ron 1982Aleman, Keno 1968Allen, Dale 1955Allen, Frederick 1978Allen, Jeff 1979Allesandro, Martin 1949Allison, Dave 1981Allison, Jack 1948Alvarado, Jose 1948Alvarado, Louie 1954Amberg, Jack 1981-82Anastos, Mike 1981Anderson, Don 1956Anderson, Paul 1983Anderson, R. 1953-54Anderson, Sheldon 1979-80-81-83Andrews, Robert 1948-49Andrus, Lynn 1952Apodaca, Del 1956Apodoca, Mike 1955Aquino, Jon 1971Aquino, Jon 1971Arburn, Don 1948Archibeque, Andre 1975-76-77-78Ardavin, Gonzalo 1983Ardrey, Ted 1981Aring, Kevin 1983Aring, Kris 1981-82-83Armijo, Sam 1978Arnold, Mike 1963Ash, Jack 1938Ashby, Rick 1971-72-73Atkins, James 1978-79-80Atkinson, Gary 1976Axe, Glenn 1958
BBacho, Joe 1973-74Bahi, Steve 1981Bailey, Bob 1972Bailey, Brad 1981-82Bailey, Darryl 1982Bailey, Harold 1962Bailey, Herb 1939Bailey, Jon 2008-09-10Baker, Billy 1977-78-79-80Baker, Don 1948Baker, James 1952-53Baker, Terry 1983-84Baldwin, J 1940-41Ballas, Jim 1963Banks, Clyde 1980Banks, Mike 1976Banks, Milt 1961-62-63-64Banning, Barry 1983-84Barajas, Vincent 1981Barber, Bill 1964Barck, Chris 1973Barnes, Dan 1972-73Barnes, Isaac 1966-67Barnes, Steve 1978Barney, Craig 1977-78-79-80Barron, Milton 1974Barry, Mike 1957Bates, Jerry 1962Bauer, Hank 1957-58Bauer, Ken 1961Bauer, Rusty 1977Bauer, Terry 1976Baylor, John 1982Beachum, Larry 1974Beaman 1947Beamon, Bill 1968Beauprez, Ken 1959Beauvais, Jack 1954-55Beauvais, Mix 1954Beeler, Jack 1967Bell, Gordon 1957-58Bell, Jeff 1981-82-83Bell, Vince 1974-75Beller, Larry 1969-70Benassi, Greg 1971Bennet, Meredith 1979Bennett, Brian 1983
Bennett, Dennis 1963Bergamo, Frank 1979Bergeron, Mark 1963-64Bernitt, Tim 1980Berry 1947Berry, Bob 1961-62-63-64Berumen, F. 1953Bidwell, Gary 1981Biggins, Marty 1976Bisetti, Ed 1961-62-63Bishop, Del 1971-72-73Biskup, Brad 1982Blajeski, David 1976Blanc, Jim 1953-54Blanke, Scott 1981Blaser, Bob 1974-75Blazina, Milt 1958Bludworth 1947Bobley, Russel 1978Boccaccio, Jeff 1983Boggs, Bill 1963Bohlen, Greg 1980-81Bollacker, Dave 1970Bonner, Woodie 1982Booth, Alvin 1974Borema, Kim 1981Bortz, Norman 1981Bosse, Greg 1981Boudreau, Ron 1961Bowen, Jeff 1981Bowman, Mark 1978Boyce, Bob 1966Boysen, Greg 1975-76Bradford, Jack 1955-56Bradley, Bill 1967Bradley, Bob 1960Bradley, Pat 1966Braly, Mark 1959Branson, John 1968-69Brasselero, Russ 1955Bravdica, Steve 1957Braziel, Newton 1970-71-72Brazil, Bob 1956-57Bredl, Josh 2010Bridges, Richard 1984Broadhead, Bob 1942Brobst, Dick 1966-67Brookfield, Bill 1955Brooks, Al 1967-68-69Brown, B. 1953Brown, Chris 2008-09-10Brown, Darren 2008Brown, Perry 1978Brown, Ray 1974-75-76Brown, Tom 1952Browning, Mark 1979Brozovich, Mark 1981Bryan, Don 1949Bryant, Bobby 1975-76-78Bryant, Paul 197Bryant, Steve 1981Brynjulson, Kirk 1972-73-74-75Bubnich, Bob 1961Buck, Gordon 1955Buderus, Mike 1973
Bueltell, Derek 1981Buff, Haskell 1983Buku, Mike 1939-40-41Burgess, Kevin 1982Burick, Bob 1956Burke, Pat 1979Burtenshaw, Art 1975-76Burtis, Wally 1955Burton, Wendell 1976-77-78-79Busch, Robert 1958-59Busia, Bob 1961-63-64Butkovich, Nick 1949Butler 1947Butler, John 1966
CCain, Jim 1962-63-64-65Califano, John 1949-50-51Call, Mitch 1976Campbell, Jason 2009-10Campbell, John 1975Campbell, Todd 1981Campton, Joe 2008-09-10Cannon, Mark 1980-81-82Cantrell, G 1940-41Capana, Ralph 1954-55Cara, Gene 1950-51Carara, Richard 1957Carara, Warren 1955Caravajal, Steve 1978Cardinal, Bob 1957Carey, Cal 1981Carlson, Carl 1954Carlson, Jim 1938Carlson, Rod 1977-78-79-80Carpenter, Ken 1980Carter, Bill 1959-60Carter, Bob 1965Carter, Bruce 1983-84Carter, Dan 1982Carter, Mark 1978Carter, Mark 1978Cartwright, Da’Quan 2008-09-10Cartwright, John 2008Casack, Larry 1950-51Case, Bob 1973Casen, John 1949Casey, Phillip 1950-51Caslavka, Lee 1975Cassidy, Paul 1970-71-72-73Cassidy, Paul 1970-71-72-73Castro, Steve 1984Caughran, Dan1979-80Cavey, Cal 1982-83Cavey, Todd 1983Cebulski, B 1940-41Centa, J 1940-41Cephers, Dale 1978-79-80-81Cerjanic, Earl 1939-40-41Cervi, Jim 1980Chamberlain, John 1949Chamberlain, Leroy 1982Chamberlain, Rich 1980-81-82Chambers, Bill 1950-51Chambers, L 1940-41
Chantala, Troy 1979Chapman, Randy 1980Chase, Robert 1966Chavez, Bob 1952Chavez, Nathan 1976Chavez, Peter 1979Chavez, Steve 1966-67Cheeks, Calvin 1980Chesire, Pat 1979Childress, Frank 1958Cholas, Dan 1964-65Chorak, Mike 1958-59Christensen, Grey 1960-61Christy, Chris 1979Ciavonne, Mike 1939Clady, Chris 2009Clancy, Colin 2009Clay, Sam 1962-63-64-65Clementi, Mark 1976Clute, Brian 1983Clute, Ed 1957Cobloga, Ben 1938Cohen, Morrie 1957-58Colbert, John 1982Colby, Larry 1961Cole, Matt 2008-09Coleman, Don 1949Colgan, Jim 1980Colglazier, Sid 1958Collins, Al 1959-60Collins, Marty 1960-61-64-65Collins, Orris 1954Collins, Sam 2010Colnar, Jeff 1978Conner, Larry 1975-76Connors, Dan 1970-71-72-73Conrad, Bill1976Cook, Greg 1967Cooper, Doyle 1967-68-69Cooper, Reggie 1982-83Copeland, Lorenzo 1978Coppersmith, Scott 1980-81Cordova, Joe 1958-59Cordova, Ken 1980-81Corsentino, Jerry 1980Costa, Josh 2009-10Courtney, Howard 1938Cowan, Paul 1966-67Cowan, Robin 1973Cozzolino, Brent 1984Craddock, Jack 1949-50-51Craighead, Joe 1939Crall, Bernard 1978Crank, Gerald 1942Cresswell, Dale 1981-82-83-84Crews, Micah 2008-09Cronin, Mike 1969Crowell, Bill 1963Crowleu, Phil 1981Crowley, Dave 1975-76Crunkleton, Grant 2009-10Crusick, Nick 1949-50-51Cruz, Felix 1957Cruz, Robert 1982Cuellar, Nelson 1981Cullen, Jack 1961-62-63Cure, Ed 1969-70Currier, P. 1953Curry, Ed 1959Curtis, Dale 1980
DD’Errico, Len 1964Dail, Lee 1942Daldegan, Mark 1982-83Daniels, Elimu 1979Datz, Jack 1954-55Dausin, Ross 2010David, King 1956David, Richard 1960Davidson, Harlan 1962Davis, Jim 1947-48Davis, John 1983Davis, Maynard 1975Davis, Richard 1982Davis, Scott 1983Davoli, Phil 1967-68-69Dawidczik, Greg 1972Day, Lloyd 1982Day,Bob 1952Dazzio, Sam 1956-57DeAndrea, James 1979DeBay, Randy 1979Deheart, Mal 1947-48
Del Pizzo, Allan 1973DeLeon, Doroteo 1948DeLeon, S. 1953-54DeLuca, Charles 1952Denardo, John 1947-48Deneice 1947Denny, Steve 1973DeRose, Dan 1981-82-83DeRose, Eddie 1953DeRose, Mark 1981-82Deverich, Mike 1950-51Dewhurst, Mark 1979DeWitt, Bill 1952DeYong, Donnie 1981Diaz, Spike 1958-59Dickens, Stephan 2010Dickerson, Bill 1965Dickerson, Larry 1957-58Dickerson, Layton 2008Diephenbrock, Rick 1967DiGiallonardo, Yom 1981DiPalma, F 1940-41DiRubio, Dick 1958-59Dixon, Gene 1971Doll, Bill 1982Donachie, Dave 1958Donaldson, Ray 1962Donlay, Jerry 1972Dorenkamp, Andrew 1979Dorenkamp, Phillip 1976Dorrance, Mike 1979Dorsey, Bob 1942Douglas, Terry 1975Dowd, Tom 1979-80Doyle, E.J. 1964-65-66Dreitz, Randy 1981-82-83-84Drell, Dave 1958Dreutzer, Keith 1957Drummond, Dale 1947Ducic, John 1973-74Ducy, Kevin 1978Dudley, Virgil 1942Dudrick, Dick 1954Dulin, Tony 1983Dumas, Rick 1975-76-77Dunaway, Dan 1972Duncan, Casey 1982Dunlap, J. 1940-41-42Dupuch, George 1978Dutkovich, Vic 1960-61Dwidczik, Greg 1973
EEaker, Gary 1971-72Eason, Ron 1959-60Easton, Kevin 1975Easton, Michael 1981Eddy, Randy 1962-63-64-65Eder, Lonnie 1979Eklund, Matt 1975-76-77-78Eldridge, Clarence 1938Elich, Voyd 1938Elizondo, Scott 1980-81-82-83Elizondo, Selestino 1952-53Elliott, Dick 1962
Ellis, Daniel 1978Elm, Mike 1974-75-76-77Emory, John 1963England, Jeff 1981-82-83-84Englehardt, Warren 1962Enoch, Marquise 2009-10Enzminger, Kurt 1969-70-71Erchul, Scott 1980Erickson, Hans 1952Erickson, Ken 1979-80Esinhart, Les 1964Eskew, Terry 1976Esquillin, David 1980Evans, Dave 1976-77-78Evans, Scott 1981Evans, Tom 1979Even, Anthony 1984Everett, Jim 1960Ezyk, Steve 1973-74
FFalk, Rod 1975-76-77-78Fasula, Charles 1955Faust, Ed 1983Feely, Bill 1975-76-77Ferguson, Joe 1939Fern, Mark 1981Ferrara, Tony 1976Fields, Marcus 1980Fillmon, Rick 1981Finley, Steve 1970-71Firth, Dave 1938Fisher, Joe 1982Fitzgerald, Bill 1966-67Fitzsimmons, Craig 1979-80Fix, Kelly 1980Flanigann, J 1940-42Fleischauer, Norm 1974-75Flenoy, Anthony 1976-77-78Flood, Frank 1948Flood, Jim 1955Flores, Louis 1979-80-82Flower, Steve 1978Foleu, Jeff 1983Foster, Chet 1962-63-64-65Fraize, Jerry 1976Franek, Ken 1982Franier, Mike 1982Fraser, John 1956Frasier, Cliff 1969-70Frazier R. 1952Frazier, Jim 1951Frazier, Tim 1950Freeman, Ray 1983Freeman, Ron 1966-67-68-69Fritschen, Tom 1983Frohlick, Bob 1958-59Fuhs, Vic 1974-75-76Fuller, Bob 1948Fuller, George 1982Fuller, Jim 1961-62Fuller, Ken 1980Fulmer, Jeff 1981Funderburk, Steve 1975Funk, Roger 1976
RAY BROWN1974-76
KIRK BRYNJULSON1972-75
75
ALL-TIME LETTERWINNERSGGaines, Ken 1981Gainey, Derek 2010Gaisson, Tom 1966Gaiter, Vince 1981Gallas, Scott 1977-78-79-80Gallegos, Frank 1967Gallegos, Tom 1981Garbaz, Joe 1973Garcia, Sam 1980Gard, Steve 1975Garner, Greg 1983-84Garner, Keith 1976Garner, Keith 1982Gavin, Sean 2008Gaye, Jonathan 2010Gebhart, Rich 1975Geiser, Jim 1957Genova 1947Gentry, Lany 1973Gerbaz, Greg 1980-81-82Gerken, E 1940-41Germany, Norwood 1975Gettler, Mack 1957Giarratano, Dick 1958-59Giasson, Tim 1964-66Giasson, Tom 1963-64Gieck, Sam 1967Gillogy, Ray 1952Gilmore, Demetrius 2008-09Giovacchini, Mel 1959-60Girouard, Bob 1967-68-69Gladden, Roland 1962Glanigan, J. 1941Gloyd, Randy 1973Gobin, Brian 1980Godinez, Dan 1964-65-66-67Goering, Jerry 1957Golden, Pete 1957-58Golletti, Victor 1952Gomez, George 1961Gomez, Ray 1965-66-67-68Gonzales, Fred 1968-69Gonzales, Kasey 2008Gonzales, Mike 1981Goodhue, Bob 1970Gorham, Darrell 1980Gorham, John 1981Goronto, Gary 1978Gottbehuet, Mark 1973Gottula, Ernie 1939Gowell, L. 1952Gower, Bill 1977-78-79-80Goyer, Joe 2008Grabowski, Ron 1976Gradishar, Mark 1980-81Gradishar, Tony 1981-82-83-84Graham, Bill 1960Graham, Troy 2009-10Grant, Bob 1952Grant, Frank 1968-69-70-71Grant, Larry 1949Grant, T. 1953-54Grantham, Dick 1955Gray, Bill 1959-60Gray, Brandon 2008Greco, Art 1961Greco, J. 1953Green, Bud 1948-49Green, David 1983Green, Richard, 1961Green, Troy 1956Greene, Dennis 1971Greenwood, Rich 1967-68-69Grenfell, Matt 1972-73-74-75Griebel, Mike 1978Griffin, Dan 1963Griffin, Lance 1981-82Griffin, William 1982Griffith, A. 1953Grigg 1947Grimes, Jim 1981-82Grove, Carl 1948-49Groves, Greg 1975Guardamondo, Charles 1959Gucciione, Pete 1979Guilder, Dick 1959-60Guillen, H. 1953Guinane, Tom 1974-75-76Gulley, Jeff 1979Gurovich, George 1948Guthrie, Darrell 1956Gutierrez, Caesar 1959-60
HHaddan, J.T. 2009-10Haliburton, Ron 1962-63-64-65Hall, Clem 1981-82Hall, Garles 1975Hall, J. Newell 1938-39Hallcy, Dyrell 2010Hamlin, Dennis 1979Hamlin, Tyler 2009-10Hammons, Rich 1975Hampton, Lonnie 1982-83Hanenberg, Peter 1981Hanley, Tom 1962Hardcastle, Larry 1960Hareze, Bill 1938Harkness, Henry 1976Harmon, Ray 1976Harr 1947Harris, Dominique 2009-10Harris, Wayne 1971-72-73-74Harrison, Drayton 1980Hartshorn, Pat 1979Harvey, Fred 1982Harvey, Wayne 1979Hastings, Henry 1963Hatch, Bob 1959Hatler, Brian 1984Hayes, Gregory 1978Hayes, Ted 1978Hayner, Ron 1975Haynie, Tom 1984Headley, Ray 1968-69-70Headricks, Calvin 1963Heard, Herman 1982-83Heath 1947Heath, Dick 1956Hebiesen, Lee 1976-77Hedrick, Calvin 1963Heister, Ken 1980Heitman, Scott 1980-81-82-83Helein, Al 1962-64-65-66Hellard, John 1961-62Helsop, John 1980Henderson, Nick 2010Henderson, William 1978Hendricks, Calvin 1979-80Hendron, Rich 1960Henley, Ed 1949Henry, David 1976-77Henry, William 1978Herberger, Bob 1978Herberger, Robert 1978Hernandez, Aaron 2008-09-10Herold, Frank 1952Herrera, Justin 2009-10Herrin, Ed 1957Herzberger, J. 1953Heslop, John 1979Hess 1947Hesser, Jim 1982-83Hester, Frank 1964-65-66-67Hiatt, Hal 1982Hickman, Tom 1960-Hicks, Ben 2010Hicks, Sean 1979-Hildenbrand, Chuck 1983Hill, Gary 1975Hill, George 1958Hill, Mark 1973-74-75-76Hill, Steve 1981-82 Hiner, Russ 1975Hitchcock, Jack 1957Hodge, Blanch 1975Hoffman, Dick 1942Hogg, Dale 1960-6Holden, Jim 1975Holland, Pat 1976-77-78Hollingsworth, Allen 1984Hollins, Jervoise 2010Holmes, Jay 1981Holtor, Mark 1979Hoppmann, Ron 1956-57Hornbaker, Ron 1976Horner, Bill 1942Hoskins, Sam 1962Hottman, Bill 1959-60Housh, Mike 1974-75-76-77Houston, Woody 1960-61Hoy, Bill 1949Hren, Mike 1979Hren, Steve 1982Huber, Henry 1971-72Huff, Dick 1970-71-72Hughes, Lowell 1938
Hughes, Rich 1957Hummitzsch, Jerry 1959Hunholtz, Milton 1983Hunter, Craig 1978-79-80-81Hurst, Royal 1974-75Hutcherson, Charles 1948
IIsenhart, Les 1958-59
JJacketta, Ed 1962Jackson, Ben 2010Jackson, Bernard 2010Jackson, Eric 1984Jackson, Gordon 1982Jackson, Tony 1984James, Carl 1963James, Tahir 2010Jansen, Grant 2008-09-10Jarvis, Bob 1957Jay, Gary 1982Jefferson, Mike 1969-70Jefferson, Myron 1984Jehorek, Ed 1978Jenkins, Dennis 1960Jenks, Chris 1984Jensen, Ryan 2009-10Jochem, Greg 1978Johannes, Steve 1978-79Johnson, Bill 1966-67Johnson, Calvin 1976Johnson, Cletis 1979Johnson, Dickie 1975-76-77-78Johnson, Gary 1967Johnson, Gary 1980Johnson, Greg 1974Johnson, Jamaal 2008-09-10Johnson, Mitch 1974-75-76-77Johnson, Sid 1942Johnston, Bill 1956-58Jones, Curt 1978-79Jones, Dick 1951Jones, Dick 1961Jones, Jack 1949-50Jones, Jonathan 2009-10Jones, Kurt 1980-81Jones, Tim 1972-73Jordan, D. 1953-54Jordan, Steve 2008Jorgenson, Mark 1980-81Jorgesen, DeLynn 1955Jorse, Bobby 1981Jost, Jack 1958Justin, Ayrius 2008-09
KKallinger, John 1965-66Kane, Terry 1947-48Kasel, Richard 1949Kashinskie, Tony 1975Kasimatis, John 1948-49Kaufman, Tom 1960Keating, Bob 1949Keator, L 1940-41Keck, Ron 1981Keefe, Michael 1981-82Keeler, Jack 1954Keiley, Randy 1974-75Keisling, Mark 1969-70Kelley, Richard 1975Kelly, Ivan 1950-51Kelly, Jim 1976Kelly, Lee 1980-81-82-83Kelly, Taylor 2010Kelson, Jerry 1956-57Kemp, John 1981Kemp, Vic 1960-61Kenebrew, Clyde 1973-74-75-76Kennedy, Collon 1970-71-72Kennedy, Jim 1960Kereford, Owen 1982Kerrigan, Tim 1982-83-84Kimble, Kenneth 1978King, Tony 1980-81Kirchenschlager, Roger 1979Kirgan, Jim 1967Kjeldguard, Ty 197-Klein, Doug 1976Klein, Jack 1957-58Kliesen, Brandon 2010Kliesen, Wade 1982Klikus, J.J. 1967-68-69-70
Knight, Dan 1976Knox, Wayne 1980-81Kochevar, Bernie 1949Kochevar, M 1940-41Koenig, Mark 1978Koester, Dean 1974-75-76-77Konstanzer, Paul 1975Korber, John 1947-48Kozacek, Gary 1980Kratovl, Steven 1981Kravig, Harold 1942Krofchik, Paul 1962Kryzanowski, Ken 1982
LLadd, Marion 1947-48Lallis, Everett 1966-67Lamar, Kyle 2008Lamberth, Lon 1979Lane, B 1940-41LaPorte, Joe 1959Large, Jim 1956-57-58Larson, Joe 1963Lavoie, Larry 1958Lawson, Phil 1965Lee, Monte 1974-75Lee, Ricky 1982Leffett, Billy 1979Leib, Dan 1980Leigh, Russ 1972Lenz, Dan 1978-79-80-82Lerma, Ernie 1961Lester, Dave 1984Lester, Robert 1952Lewis, Bill 1963Lewis, Bob 1961Lewis, Jesse 2008-09-10Lewis, Lawrence 1982Lindsay, Ralph 1938-39Lines, Jeff 1982Little, Brian 1978-79Loew, Jack 1978Loflin, Jim 1957London, Willie 1962-63-64-65Lontine, Tom 1981-82-83Loos, Barry 1969-70Lott, Austen 2010Love, Charlie 1973-74Lozano, Louie 2010Lucero, Ed 1981-83-84Lucero, Leo 1954Ludlow, Jack 1954Lueck, Kevin 1982-83-84Luppino, Dom 1966-67-68Lus, Randall 1976Lusk, Quizzy 1964-65-66-67Lutz, Jack 1958-59Luxa, Russ 1981Luzak, James 1967Lyles, Mike 1978
MMacaluso, Marco 2008-09MacGlanahan, Frank 1952Mack, Josh 2009Madson, Jeff 1976Magda, John 1958Magino, Fred 1938Mahler, John 1949-50-51Major, Kyle 2008-09-10Mangino, Ricky 1978-79Manguso, Tony 1960-61Manuel, Kenneth 1962-63Manzanares, Ed 1960Marccovechio, Charles 1954-55Marchbanks, Larry 1979Marcontonio, John 1981Marino, Frank 1968Marino, Paul 1980-81Marion, Tim 1982Markt, Steve 1972Marquez, Adrian 2008-09-10Marquez, Robert 1978-79Marr, Gary 1957Martin, Beau 2010Martin, Jeff 1978Martin, Kris 1975Martin, Tom 1961-62-63-64Martinez, Alolph 1954Martinez, Ernie 1974-75-76-77Martinez, George 1978Martinez, Joe 1956-57Martinez, Leonard 1983Martinez, Paul 1979
Martinez, Rich 1965-66-67Martinez, Tom 1976Martinez, Tom 1983-84Martin-Proctor, Garrett 2008-09-10Marvin, Larry 1976-77-78-79Mason, Doug 1973-74-75-76Mason, Joseph 1982Massullo, David 2008-09Masterson, Hank 1948Matese, Mark 1982-83-84Matheson, Don 1950-51Matthews, Kevin 1983Maurer, John 1970-71-72Maxey, Larry 1980Maxwell, Mike 1961-62-63May, Bruce 1980-81-82-83Mazzone, Bob 1967McBride, Joe 1970McCall, Kyle 2008-09-10McCall, Mick 1975-76-77-78McCall, Mike 1961-62McCann, Tom 1979McCarty, Jim 1961McCash, Justin 2010McCellan, Bill 1939McCloskey, Paul 1983McClure, Michael 1981McConnell, Casey 2008McCraith, Larry 1957McDade, Tom 1964-65McDonald, Byron 1975McDonnell, Sam 1948McGee, Dick 1939McGee, Terry 1963McGill, Jim 1960-61McGraw, Mike 1960-63McIntosh, B 1940-41McIntyre, Chuck 1961-62-63-64McKay, David 1965McMahan, Jack 1966McMinimee, Dan 1982-83-84McNair, Ricky 1980-81-82-83McOsker, Kevin 1983McQuarrie, Cliff 1949-50-51McSweeny, John 1959-60McWilliams, Jerry 2008-09Meade, Mike 1963Meek, David 1982Mehle, Gary 1972-73Meintz, Tim 1980Meisner, Lee 2008-09-10Mencin, Joe 1939Mendoza, Ray 1957-58Menger, Bob 1942Menum, Joseph 1938Merio, Bob 1976Mesar, Don 1938Meyer, Jack 1947-48Meyers, Bill 1952-53Meyers, J. 1941Meyers, Mike 1959
Middleton, Ben 1982Middleton, Gurt 1982Mihalek, Scott 1981Miles, Carl 1948-49Miles, Ray 1952Milich, M 1940-41Milkulka, Bob 1960-61Miller, Craig 1978-79Miller, Darryl 1972-73Miller, Reid 1958-59Miller, Ron 1959Milne, Bill 1938Mingus, Dave 1970Minton, Tate 2008Mitchell, Clint 1980Mitchell, Garth 1981Mitchell, Tom 1947-48Molzan, Bill 1979-80Monoco, Ed 1948Monroe, Art 1974Monroe, Tom 1973Montelongo, Darryl 2008-10Montelongo, Tom 1960Montgomery, Ron 1957Montoya, Don 1965-67-68Mooney, Mike 1965-67-68Moore, Alvin 1976Moore, Bob 1951Moore, John 1971Moore, Larry 1978Moore, Lloyd 1975-76-77-78Moore, Robert 1949-50Moran, Dick 1952-53More, Harold 1959Moreno, Jim 1975Morenzo, Jim 1961Morey, Tom 1952Morgan 1947Morgan, Curt 1982Morgan, Dennis 1965Morgan, Kelly 1982Morone, Paul 1953Morse, Randy 1978Morton, Stephen 1979Mucci, Louis 1981Mulay, Jim 1980Munoz, Zak 2009Murphy, Bob 1967-68-69-70Murphy, Leo 1939Murray, Walter 1976Musso, Carl 1942Musso, John 1980-81Myers, J 1940
NNails, Frank 1957Nash, Frank 1982-83-84Nauslar, Dennis 1969-70-71Nauslar, Kevin 1975-76-77Nauslar, Tim 1972-73-74
AARON HERNANDEZ2008-10
76
Navarro, Richard 1958Naylor, Rich 1980Neal, Dennis 1976-77-78Neal, Jack 1978Neibiger, Gary 1968Neil, Archie 1974-75-76-77Neinhuser, Greg 1980-81Nelson, Bob 1942Nelson, Denny 1958Nelson, Jim 1972-73Nelson, Michael 1979-80Nelson, Mike 1979Newberry, Randy 1978Niccoli, Troy 1981Nicholas, George 1957Nicholson, Greg 1957Nienhuser, Gregory 1979Nieto, Joe 1976Nisson, David 1980Nogare, Art 1953Nseka, Beldy 2009-10
OO’Brien, Joe 1973-74O’Connor, Frank 1981-82-83-84O’Dell, Steve 1975-76O’Hanlan, Mike 1982O’Keefe, Joe 1960-61-64O’Neal, Bill 1958O’Neil, Pat 1962-63Oakley, C.J. 2008Oatis, Don 1948Odell, Steve 1974-75-76-77Offdenkamp, G 1940-41Olander, Larry 1976Oliver, Warren 1949Orlich, G. 1953Oschner, Mark 1967Ossolinski, Bill 1959-60Osterman, Jeff 1982-83-84Otten, Brad 1975Otteson, Jack 1982Owens, Eddie 1962-63-64-65
PPace, Leonard 1955Pachak, Bill 1942Pacheco, Dave 1965Pacheco, Gus 1964Pagano, Sam 1955-56Page, Jerome 2008-09Palizzi 1947Palumbo, Joseph 1982Paluzzi, Phil 1982Paluzzio, Phil 1979Pannunzio, Joe 1957Pannunzio, Joe 1979-80-81Pannunzio, Nick 1982-83-84Pannunzio, Tom 1960-61Papasedero, Vinny 2008Parrish, Bob 1966-67-68-69Parsons, Jack 1948Passarelli, Tony 1982Paterson, Jeff 1982Patrick, Neil 1983-84Patrone, Dave 1973-74-75Patterson, B. 1952Patterson, Bill 1972Patterson, Bob 1948Patterson, Jeff 1982-83Patterson, Sedric 2008-09Paulson, Gary 1967Pavlik, Ricky 1980Peelman, Dan 1973Peerman, Mike 1975-76Pellant, Mark 1978Pena, Mark 1980-81-82-83Pendleton, Ed 1948-49Penn 1947Pennetta, Mike 1981Pepper, Hardy 1960Peralta, Larry 1963Perea Rich 1979-80-81-82Perez, Gus 1961-63-64Perez, Phillip 1981Perkins, Chuck 1970-71Perkins, Mal 1964Perkins, Ray 1938Perrian, Angelo 1975Perse, Dick 1947-48Peterson, D. 1953Peterson, Ed 1957Peterson, Mark 1968-69-70Peterson, Mike 1970
Peterson, Roy 1970Peterson, Tom 1978Petterson, Mark 1968-69Petty, Bob 1968Pezolt, L. 1953Pfannenschmid, Roger 2009-10Phebus, Hal 1959Phelan, Tom 1976Pineda, Joe 1978Pittenger, Rick 1979-80Pizzo, Allan Del 1973Plese 1947Pobst 1947Pollard, Ron 1980Pollock, Mark 1978Pomelo, Pete 1949-50-51Porter, Jack 1962-63Potestio, James 1952-53Poundstone, Donald 1978Pratts, Tony 1979-80-81Pratz, Tony 1979-80Presley, Bob 1961Pretzel, Tom 1968Pretzl, Tom 1968Pride, James 1980Priestly, Jeff 1976Printers, Glen 1973-74Pryor, Gil 1963Pullara, Joe 2009Pullaro, Sam 1952Pusedo, Ray 1956
QQualantone, Nick 1982Quinlan, Brad 1980-81Quinlan, Brian 1980-81Quintana, Victor 2008
RRader, Robert 1982Radiff, Dan 1973Rakestraw,Art 1964Ramirez, Greg 1956Ramos, Frank 1962Randolph, Bill 1952Randolph, C. 1953-54Randolph, Dan 1950-51-52Ratliff, Floyd 1938-39Redden, Darrell 1980Redding, Roger 1971Redmon, Edgar 1965Redmon, Willie 1965-65-66-67Redmond, Kevin 1978Redwine, Ron 1965Reece, Jarrell 2009Reed, Dave 1960-61-64-65Rees, Jon 1978-79-80-81Reeves, D 1940-41Reeves, Rene 1984Reitz, Richard 1978Remmo, Alex 2010Repice, James 1982Reppa, Mike 1972-73Reyes, Curtis 1980Reynolds, Vic 1981-82Ribens, Fred 1938Richards, Larry 1963-64Richardson, Mac 1978Richmond, Sutton 2009Richwine, Ron 1965Rider, Giovanni 2009-10Riggins, Steve 1983Rigsby, Kelly 1975Rios, Alex 2010Rivas, John 1952-53Rivera, Frank 1975Roarke, Lemon 1938Robbins, Pete 1974Roberson, Leamon 1971-72Roberts, Johnny 1962Robertson, Andy 1964-65-66Robertson, D 1940-41Robertson, Ken 1984Robinson, Allen 1982Robinson, Darryl 1979Robinson, Ron 1972-73Rodriguez, Charles 1959-60Rodriguez, Drew 2010Rodriguez, Fred 1960Rodriguez, John 1958Rodriguez, Juan 1967-68Rodriquez, Joe 1952Rodriquiz, Joe 1955Rogers, Bill 1962
Roitz, Alex 1964-66Roldan, Charles 1959Rollison, Pat 1965Romero, Frank 1958-59Romero, Mike 1957-58Rosalani, Dennis 1963Rosen, Irving 1939-40-41Rosolini, Dennis 1962-63-64Ross, Harold 1963Rossow, Timothy 1979Rotunno, Tim 1968Rowley, Scott 1979Rulon, Tom 1979Rumsey, Charles 1975-76-77-78Runco, Phil 1979-80Rush, Craig 2009Russel, Rod 1979Ryder, Dave 1981
SSabo, Andy 1971-72-73Sabye, Nick 2008-09-10Safonous, Rich 1977-78-79Salazar, David 1979Salazar, Jerry 1981Salazar, Josh 2010Salimeno, John 1964Sampson, Jim 1973-74Sanders, Don 1978-80Sandos, Dan 1976Sandoval, Josh 2010Sansome, Bob 1957-58Santos, Joe 1956Sarno, Tony 1962-63-64-65Sartoris, Larry 1967-68-69Satterfield, Dustin 1973Saunders, Earl 1956-57Saylor, Les 1976-77-78Saylor, Leslie 1976-78Schanze, George 1983-84Schiechl, Bob 1963Schiele, Damon 2009-10Schlagbaum, Brad 1982Schlagel, Mike 1980Schleis, Doug 1978-79Schlichting, Phil 1983-84Schmaltz, Richard 1953-54Schmidli, Don 1947Schnorr, Chuck 1971-73Schoen, Scott 1971Scholl, Shawn 1982-83Schultz, Scott 1980Scott, Carl 1978-79-81Scott, D 1940-41Scott, Dexter 2010Scranton, Mike 1984Scribner, Jeff 1976Scweer, Gary 1959Sebastyn, Bill 1974Seder, Bill 1959Seidl, Carl 1967Seigman, Dave 1980Selak, Jim 1965Sergent, Fletcher 2008Service, Scott 1979Shaddy, Dave 1978-79-80Shain, Mark 1979Shank, J. 1953Shank, P. 1953Shappell, Steve 1979Shea, Leslie 1976Shelly, Don 1950-51Sheppard, Kenneth 1976Shevock, Brian 1980Shineovich, George 1954Shineovich, George 1979-80Shisler, Lou 1962-64Shrader, Bill 1965-66-67-68Shrock, Richard 1956-57Sidner, Morgan 1978Siegman, Dave 1981Silva, Paul 1979Simmons, Bobby Joe 1971-72Simmons, Ronald 1982Simonson, Bob 1975Simonton, Donald 1979Sims, Bill 1949-50-51Singer, Bill 1949Siter, Mike 1978Skrivfvars, Charles 1952Skube, Henry 1938Skube, John 1954Slanovich, Gus 1956Slattery, Joe 1979-80Smart, Doug 1983
Smelek, Ray 1952Smith, B. 1940-41-42Smith, Belton 1961-63Smith, Bill 1969-70Smith, Grant 1975Smith, Greg 1969Smith, Kenneth 1982Smith, Loren 1978Smith, Mike 1976-78Smith, Rod 1970-71Smith, Todd 1978Smith, Walt 1968-69-70-71Smith, Wendell 1981-82-84Sneed, Randy 1979Snipes, Brian 1982Snyder, Paul 1976Solano, Nate 1973Solomon, Mike 1979Solono, William 1976Sondburg, Carl 1983Soole, Trevor 2008Spence, Shawn 1983Spencer, Bill 1959-60Spencer, Steve 1979Sperber, Jared 2010Spoerke, Glen 1964Spradley, Dale 1952Stabe, Allen 1980-81-82-84Stanton 1947Stanton, Bob 1952Starzynski, John 1960-61Stauss, Dan 1979-80-81-82Stecklein, Bob 1959-60Stecklein, Dick 1965Steed, Mike 1975Steinkke, Steve 1976Stephenson, Joe 1976Sterling, Mark 2008-10Stevens, Bart 1978-79-80Stevens, Kevin 1981-82Stewart, Jack 1939Stiles, P.R. 1963-64-65-66Stilson, Denny 1953-54Stilson, Ralph 1952Stines, Ken 1942Stirgus, Willie 1971Stoeber, Dan 1975-78-79Stovall, Steve 1942Strickland, Ewall 1976Strickland, Steve 1979-80Strouse, Chris 1982-83Stute, Royce 1965-66Sublett, Barry 1980-81Summers 1947Sutherland, Stephen 1981Swain, Lester 1956Swan, Bill 1956Swann, Bob 1954Swanson, William 1980Swartz, Drew 2009-10Swint, Vince 1976
TTafoya, Dave 1954-55Taibi, Joe 1981-83-84Taibi, Sam 2008Tapia, Gene 1980-81-82-83Tatham, Glen 1964Taylor, Gene 1967-68-69Taylor, Harold 1965Taylor, Larry 1956-60Tedesco, Rich 1982Tedford, Herb 1983-84Tedrow, Dave 1961Temple, David 1949-50-51Terrones, Orlando 1980Terry, Allan 1968Tetrault, Tony 1982-83Theotokatoc, George 1949Thill, Paul 1983Thomas, Emil 1954-55Thomas, Floyd 1982Thomas, Mike 1968Thomas, Mike 1979-80-81Thomas, Roy 1979-80-81-82Thompson, Charlie 1976Thompson, Randy 1960Thorson, Eric 1978Tierney, Steve 1968Tilford, Kyle 2008-09Timm, Craig 1978-79-80Tindall, Terry 1963Tisone, Joe 1978Toles, Wardell 1962Tolle, Corey 1977-78-79-80
Tollefson, Ron 1960-61Tondera, John 1983-84Torbet, B 1940-41Tornes, Randy 1980Torrez, Dan 1979Tracy, Scott 1978Trahan, John 1981-82-83-84Trejo, Phillip 1982Trimble, W. 1953Trinidad, Reuben 1959Trione, R.J. 2009Trujillo, Gilbert 1954Trujillo, Jim 1976Trujillo, John 1954Trujillo, John 1958-59Trujillo, Sebastian 2010Tubaugh, Larry 1960Tuiasosopo, Tim 2008Turnbull, Joe 1981Turnbull, Mike 1981-82Turner, Markus 2008-09
UUltes, Mark 1978
VValdez, Ed 1968Valdez, Harvey 1978Valdez, James 1984Valenta, John 1949Valentine, Bob 1959Valentine, Vince 1978-79Van Matre, Wes 1982VanZant, Emery 1965Vaughn, Bob 1954Vaughn, Chase 2008-09Vaughns, Roy 1984Veasley, Brock 2008Vendetta, Jim 1957Venturo, Mark 1975Verdugo, Rudy 1979Verhagen, David 1980-81Vicars, James 2010Vicars, Jon 2009-10Vigil, David 1979Vigil, Joe 2008-09Vinci, Dick 1950-51Vines, Michael 1976-78Vivoda, Mark 1955Vivoda, Rich 1960Vizyak, Joe 1968-69Voloshin, C. 1953
WWachsmann, Bob 1978Waddell, John 1981-82-83-84Wadsworth, Darwin 1949-50-51Walbye, George 1950-51Walden, Dwight 1978Walker, Allan 1954Wallerius, David 1980-81Wallick, Drake 1976Wallin, Scott 1981Ward, Craig 1979-80-81-82Ward, Larry 1959-60Warmack, Russell 1950Warren, Chris 2009-10Washington, Bobby 2008-09Waters, Bill 1956Waters, Dwight 1948Waters, Mike 1971-72-73Watkins, Ed 1974-75Watson, Mike 1976-77-78Watson, Mike 1982-83-84Watt, Paul 1978Watts, Milton 1979Weaver, Mike 1984Weaver, Tom 1983Webb, Bryan 1981-82-83Webb, Willie 1979Webster, Alan 1971-72-73-74Weeks, Cris 2008Weidermen, Dwane 1963Weimer, Bryan 1981Wells, Don 1976West, Tom 1971-73Whatley, James 1981Whealton, Anthony 1982Wheeler, Gene 1982-83White, Greg 1966White, Gregg 1962Whitehead, Ken 1978-79-80-81Whitwell, Bill 1965
Wichman, Bob 1968Wichman, Rudy 1966-67-68Wiley, Jim 1983-84Wilhite, Keith 1972Williams, Benny 1970-71-72-73Williams, Brandon 2008-09Williams, Denzel 2009-10Williams, Frank 1957Williams, Glenn1979Williams, John 1956-57Williams, Leroy 1983Williams, Ralph 1959-60Williams, Ray 1962-63-64-65Williams, Scott 1978Williams, Tim 1982Williamson, Kelly 1961Williamson, Marcial 2008-09Wilson 1947Wilson, George 1947-48Wilson, Keith 1983Wilson, Rick 1981-82-84Wilson, Spencer 1981Winters, Gary 1963-64-66Winters, Ron 1965-66Wisner, Newell 1957Wissing, Joe 1978-79-80-81Wissing, John 1979-80-81Wittek, Koby 2008-09-10Wofford, Joe 1983Wold, Harold 1939-41Wood, Johnny 2009Woods, Brian 1980Woods, Jerome 1955-56Woods, P 1940-41Woods, Tom 1976Woods, Walter 1976Wotipa, James 1964-65-66Wotipka, Jim 1964-65-66Wright, Oren 1962Wright, Robert 1982Wright, Roger 1981-82-83-84Wright, Tom 1982Wright, Tony 1978-79Wristen, John 1980-81-82-83
YYaklich, John 1948-49Yong, Joe 1982Yonker, Larry 1970-72Yonker, Rich 1972-73-74-75Young, Bill 1963Young, D. 1953Young, Jim 1958-59Young, Matt 1968-69
ZZabukovic, Frank 1957-58Zebroski, Darvin 1978Zeinemann, David 1957-58Zitek, Mike 1978-79-80Zorich 1947Zwiers, Doug 1982-83
ALL-TIME LETTERWINNERS
77
TEAM RECORDS
First DownsMOST FIRST DOWNSGame
27 – vs. Emporia State, 1966
Season208 – 2010
RushingMOST RUSHESGame
92 – vs. Fort Lewis, 1978
Season607 – 1978
MOST RUSHING YARDSGame
481 – vs. Westminster, 1977
Season3,096 – 1978
MOST AVERAGE YARDS PER RUSHSeason
5.65 – 2010
PassingMOST PASS ATTEMPTSGame
48 – vs. Northern Colorado, 1971
Season318 – 1984
MOST PASS COMPLETIONSGame
26 – vs. Nebraska-Kearney, 2010
Season158 – 2010
HIGHEST PCT. OF PASSES COMPLETEDSeason
57.0% – 2010
MOST PASSING YARDSGame
319 – vs. Chadron State, Sep. 19, 2009
Season2,323 – 1982
MOST PASS INTERCEPTIONSGame
6 – vs. Panhandle State, 1964
Season24 – 1984
LOWEST PASS INTERCEPTION PERCENTAGESeason
2.5% – 2010
Total OffenseMOST YARDS GAINEDGame
620 – Western New Mexico, 2009
Season4,362 – 1982
MOST PLAYSGame
101 – vs. Fort Lewis, 1978
Season774 – 1971
MOST YARDS GAINED PER PLAYSeason
6.1 – 2010
ScoringMOST POINTS SCOREDGame
66 – vs. New Mexico Highlands, 2010
Season404 – 2010 (11 games)
MOST TOUCHDOWNS SCOREDGame
9 – vs. New Mexico Highlands, 2010
Season51 – 2010 (11 games)
MOST RUSHING TOUCHDOWNSGame
8 – vs. New Mexico Highlands, 2010
Season31 – 2010 (11 games)
MOST PASSING TOUCHDOWNSGame
5 – vs. Western New Mexico, 1982; Fort Hays State, 1969
Season21 – 1982 (11 games)
MOST POINTS SCORED, BOTH TEAMS
94 – vs. Western State, 1978 (L, 43-51)
MOST POINTS SCORED IN A LOSS
43 – vs. Western State, 1978 (L, 43-51)
LARGEST MARGIN OF VICTORY
66 – New Mexico Highlands, 2010 (W, 66-0)
MOST POINTS SCORED, 1ST QUARTER
30 – Western New Mexico, 1980
MOST POINTS SCORED, 2ND QUARTER
29 – Fort Lewis, 1982
MOST POINTS SCORED, 3RD QUARTER
26 – Fort Lewis, 1972
MOST POINTS SCORED, 4TH QUARTER
21 – Numerous times
MOST POINTS SCORED, 1ST HALF
49 – Mesa State, 1978
MOST POINTS SCORED, 2ND HALF
35 – New Mexico Highlands, 2010
InterceptionsMOST INTERCEPTIONSGame
5 – Eastern New Mexico, Aug. 29, 2009; New Mexico Highlands, 1977; Fort Hays State, 1977; Cameron, 1975; Washburn, 1972
Season26 – 1982
INTERCEPTION RETURN YARDAGEGame
145 – Colorado Mines, 1967
Season455 – 2010
AVERAGE YARDS GAINED PER INTERCEPTION RETURNSeason
24.66 – 1968
PuntingMOST PUNTSGame
12 – Adams State, 1969; Northern Colorado, 1967
Season86 – 1972
MOST PUNT YARDAGEGame
553 – Adams State, 1968
Season3,273 – 1972
MOST YARDS PER PUNTSeason
43.6 – 2010
INDIVIDUAL RECORDSTotal Offense
MOST YARDS GAINEDGame
317 – Colin Clancy, Sept. 19, 2009, at Chadron State
Season1,838 – Colin Clancy, 2009
Career4,429 – Mick McCall, 1975-78
MOST YARDS GAINED BY A FRESHMANSeason
432 – Frank Hester, 1964
MOST YARDS GAINED PER PLAYSeason
7.90 – Jesse Lewis, 2010
Career6.96 – Bart Stevens, 1977-80
MOST TOUCHDOWNS RESPONSIBLE FOR(TDs scored and passed for)
Game6 – Joe Pannunzio, Fort Lewis, 1980
Season21 – Joe Pannunzio, 1980
Career46 – Mick McCall, 1975-78
RushingMOST RUSHESGame
38 – Bill Gower, Fort Lewis, 1978
Season226 – Bill Gower, 1978
Career727 – Bill Gower, 1977-80
MOST YARDS GAINEDGame
304 – Frank Hester, Emporia State, 1965
Season1,391 – Jesse Lewis, 2010
Career3,562 – Bill Gower, 1977-80
MOST YARDS GAINED BY A FRESHMANSeason
432 – Frank Hester, 1964
MOST SEASONS GAINING 1,000 YARDS OR MORE
3 – Bill Gower, 1978-80
MOST YARDS GAINED PER RUSHSeason
7.92 – Frank Hester, 1965
Career6.63 – Jesse Lewis, 2008-10
MOST RUSHING TOUCHDOWNSGame
4 – Joe Pannunzio, Fort Lewis, 1980; Bill Gower, Western New Mexico, 1980; Frank Hester, Emporia State, 1965.
Season14 – Jesse Lewis, 2010
Career28 – Bill Gower, 1977-80
MOST RUSHING TOUCHDOWNS BY A FRESHMAN
6 – Frank Hester, 1964
MOST RUSHING TOUCHDOWNS BY A QUARTERBACK
11 – Joe Pannunzio, 1980
LONGEST RUSHING PLAY
95 – Frank Hester, Emporia State, Oct. 16, 1965
PassingHIGHEST PASSING EFFICIENCYSeason
182.6 – John Wristen (121 attempts, 68 completions, 2 interceptions, 1,358 yards, 13 TD passes)
Career154.8 – John Wristen (346 attempts, 192 completions, 9 interceptions, 3,283 yards, 26 TD passes)
MOST PASSES ATTEMPTEDGame
46 – Kurt Emzinger, Northern Colorado, 1971
Season274 – Kurt Emzinger, 1971
Career462 – Kurt Emzinger, 1969-71
MOST PASSES COMPLETEDGame
23 – Ross Dausin, vs. Nebraska-Kearney, 2010
Season146 – Colin Clancy, 2009
Career192 – John Wristen, 1980-83
HIGHEST PCT. OF PASSES COMPLETEDSeason
56.9% – Joe Vigil, 2008 (58 of 102)
Career55.5% – John Wristen, 1980-83 (192 of 346)
MOST PASSES HAD INTERCEPTEDGame
6 – Bob Berry, Panhandle State, 1964
Season14 – Joe Pannunzio, 1981
Career27 – Mike Mooney, 1965, 1967-68
LOWEST PCT. OF PASSES HAD INTERCEPTEDSeason
1.7% – John Wristen, 1983 (2 of 121)
Career2.6% – John Wristen, 1980-83 (9 of 346)
MOST YARDS GAINEDGame
309 – Colin Clancy, North-west Oklahoma State, Sep. 5, 2009
Season1,841 – John Wristen, 1983
Career3,283 – John Wristen, 1980-83
MOST YARDS GAINED BY A FRESHMAN
497 – Joe Vigil, 2008
MOST YARDS GAINED PER ATTEMPTSeason
11.22 – John Wristen, 1982 (121 for 1,358)
Career9.49 – John Wristen, 1980-83 (346 for 3,283)
MOST YARDS GAINED PER COMPLETIONSeason
22.59 – Dan McMinimee, 1982 (27 for 610)
Career19.11 – Bart Stevens, 1977-80 (124 for 2,469)
FOOTBALL RECORD BOOK
78
FOOTBALL RECORD BOOKMOST TOUCHDOWN PASSESGame
4 – John Wristen, Western State, 1983; Dan McMinimee, Western New Mexico, 1982
Season14 – Bart Stevens, 1979; Colin Clancy, 2009
Career26 – John Wristen, 1980-83
MOST TOUCHDOWN PASSES BY A FRESHMANGame
4 – Dan McMinimee, West-ern New Mexico, 1982
Season7 – Dan McMinimee, 1982
LONGEST COMPLETION
99 – Nick Pannunzio to Herman Heard, vs. Adams State, Nov. 6, 1982 (NCAA D-II Record)
ReceivingMOST PASSES CAUGHTGame
12 –John Trahan, Mesa State, 1982
Season54 – Frank Grant, 1971
Career127 – John Trahan, 1981-84
MOST PASSES CAUGHT BY A TIGHT ENDSeason
33 – John Rees, 1981
Career57 – John Rees, 1978-81
MOST PASSES CAUGHT BY A RUNNING BACKSeason
41 – Roy Thomas, 1981
Career86 – Roy Thomas, 1979-82
MOST YARDS GAINEDGame
207 – John Trahan, Mesa State, 1982
Season994 – John Trahan, 1982
Career2,251 – John Trahan, 1981-84
MOST YARDS GAINED BY A TIGHT ENDSeason
410 – John Rees, 1981
Career797 – John Rees, 1978-81
MOST YARDS GAINED BY A RUNNING BACKSeason
583 – Herman Heard, 1983
Career1,581 – Roy Thomas, 1979-82
MOST YARDS GAINED PER RECEPTIONSeason
29.46 – Clyde Kenebrew, 1976
Career25.60 – Corey Tolle, 1978-80
MOST YARDS GAINED PER RECEPTION BY A RUNNING BACKSeason
19.8 – Jesse Lewis, 2009
Career19.2 – Herman Heard, 1982-83
MOST TOUCHDOWN PASSES CAUGHTGame
3 – Roy Thomas, Southern Utah, 1982; Anthony Flenoy, Western State, 1978; Clyde Kenebrew, E. New Mexico, 1974
Season11 – John Trahan, 1982; Corey Tolle, 1979
Career18 – Corey Tolle, 1978-80
LONGEST RECEPTION
99 – Herman Heard, from Nick Pannunzio vs. Adams State, Nov. 6, 1982 (NCAA D-II Record)
InterceptionsMOST PASSES INTERCEPTEDGame
3 – Dale Cephers, Pan-handle St., 1980; Mark Keisling, Washburn, 1969; Al Helein, Emporia State, 1965.
Season7 – Dickie Johnson, 1978; Steve Chavez, 1967
Career14 – Billy Baker, 1977-80
MOST YARDS ON INTERCEPTION RETURNSGame
100 – Keno Aleman, Empo-ria State, 1968
Season158 – Glen Printers, 1973
Career197 – Steve Chavez, 1966-67
MOST YARDS PER INTERCEPTION RETURNSeason
39.5 – Glen Printers, 1973
Career36.8 – Glen Printers, 1973-74
LONGEST INTER-CEPTION RETURN
100 – Keno Aleman, Emporia State, Oct. 12, 1968 (NCAA D-II Record)
Punt ReturnsMOST PUNT RETURNSGame
6 – Marquise Enoch, vs. Northwest-ern Oklahoma State, 2010
Season23 – Dickie Johnson, 1977
Career50 – Dickie Johnson, 1975-78
MOST YARDS ON PUNT RETURNSGame
107 – Markus Turner, vs. Oklahoma Panhandle State, Sept. 6, 2008
Season234 – Markus Turner, 2008
Career470 – Alan Webster, 1971-74
MOST YARDS PER PUNT RETURNSeason
29.3 – Isaac Barnes, 1967
Career23.09– Isaac Barnes, 1966-67
MOST TOUCHDOWNS SCORED ON PUNT RETURNSSeason, Game, Career
1 – Held by numerous players
LONGEST PUNT RETURN
94 – Isaac Barnes, Washburn, Oct. 7, 1967
Kickoff ReturnsMOST KICKOFF RETURNSGame
7 – Augustine Agyei, 2009, Nebraska-Kearney
Season25 – Augustine Agyei, 2009
Career53 – Dickie Johnson, 1975-78
MOST YARDS ON KICKOFF RETURNSGame
190 – Bryan Webb, Colorado Mines, 1981
Season653 – Augustine Agyei, 2009
Career1,278 – Dickie Johnson, 1975-78
MOST YARDS PER KICKOFF RETURNSeason
44.6 – Glen Printers, 1974
Career34.0 – Glen Printers, 1973-74 (NCAA D-II Record)
MOST TOUCHDOWNS ON KICKOFF RETURNSSeason
2 – Glen Printers, 1973
LONGEST KICKOFF RETURN
100 – Glen Printers, Pittsburg State, Oct. 27, 1973; Bryan Webb, Western State, Oct. 22, 1983.
All-Purpose YardsMOST YARDS GAINEDGame
304 – Frank Hester, Emporia State, 1965
Season1,594 – Herman Heard, 1983
Career3,562 – Bill Gower, 1977-80
MOST YARDS GAINED BY A FRESHMANSeason
483 – Jesse Lewis, 2008
ScoringMOST POINTS SCOREDGame
24 – Roy Thomas, Southern Utah, 1982; Bill Gower, Western New Mexico, 1980; Joe Pannunzio, Fort Lewis, 1980; Frank Hester, Emporia State, 1965.
Season96 – Kyle Major, 2010
Career199 – Kyle Major, 2008-10
MOST POINTS SCORED BY A FRESHMANSeason
41 – Kyle Major, 2008
MOST POINTS SCORED BY A QUARTERBACKSeason
72 – Mick McCall, 1978
Career158 – Mick McCall, 1975-78
MOST TOUCHDOWNS SCOREDGame
4 – Roy Thomas, Southern Utah, 1982; Bill Gower, Western New Mexico, 1980; Joe Pannunzio, Fort Lewis, 1980; Frank Hester, Emporia State, 1965.
Season14 – Jesse Lewis, 2010; Herman Heard, 1983; Herman Heard, 1982
Career30 – Bill Gower, 1977-80
MOST TOUCHDOWNS SCORED BY A FRESHMANSeason
6 – Frank Hester, 1964
MOST TOUCHDOWNS SCORED BY A QUARTERBACKSeason
12 – Mick McCall, 1978
Career26 – Mick McCall, 1975-78
MOST POINTS SCORED BY KICKING GAMESeason
96 – Kyle Major, 2010
Career199 – Kyle Major, 2008-10
Defensive Records(Note: Tackles marks are only since 1970, and fumble re-covery marks have only been kept since roughly 1977. Sack statistics have only been kept since 2008).
TOTAL TACKLESSeason
177 – Norm Fleischauer, 1974(Is currently higher than the NCAA D-II single season mark. Official NCAA records only include tackle marks since 2000)
Career415 – Dan DeRose, 1981-83
SOLO TACKLESSeason
98 – Norm Fleischauer, 1974
Career191 – Collon Kennedy, 1970-72
ASSISTED TACKLESSeason
91 – Dan DeRose, 1983
Career255 – Dan DeRose, 1981-83
SACKSGame
4.5 – Chase Vaughn, vs. Oklahoma Panhandle State, Sept. 6, 2008
Season10.5 – Chase Vaughn, 2008
Career15.5 – Chase Vaughn, 2008-09; Grant Jansen, 2008-10
FUMBLE RECOVERIESSeason
5 – Rich Perea, 1981
Career10 – Rich Perea, 1979-82
LONGEST FUMBLE RETURN
69 – Dan DeRose, vs. New Mexico Highlands, Sept. 17, 1983
KickingLONGEST FIELD GOAL MADE
55 – Mitch Johnson, Adams State, Sept. 20, 1975
MOST FIELD GOALSSeason
16 – Kyle Major, 2010
Career32 – Kyle Major, 2008-10
LONGEST PUNT70 – Pat Rollison, Adams State, Oct. 12, 1966
79
FOOTBALL RECORD BOOKTOP TEN CAREER RECORDS TOTAL OFFENSE PER GAME (Min. 2 seasons played)Player Years Games Plays Rush Pass Total YPGJohn Wristen 1980-83 22 504 -139 3283 3144 142.9Bart Stevens 1977-80 18 374 97 2469 2566 142.6Mick McCall 1975-78 37 814 1687 2742 4429 119.7Joe Pannunzio 1978-81 25 570 278 2703 2981 119.2Matt Young 1968-69 19 351 1752 0 1752 92.2
Bill Gower 1977-80 40 727 3562 0 3562 89.1Herman Heard 1982-83 21 299 1794 0 1794 85.4jesse lewis 2008-pres. 31 399 2633 0 2633 84.9Kurt Enzminger 1969-71 29 560 4 2332 2336 80.6Bob Berry 1963-64 18 307 -91 1467 1376 76.4
TOTAL OFFENSEPlayer Years Games Plays Rush Pass Total YPGMick McCall 1975-78 37 814 1687 2742 4429 119.7Bill Gower 1977-80 40 727 3562 0 3562 89.1John Wristen 1980-83 22 504 -139 3283 3144 142.9Joe Pannunzio 1978-81 25 570 278 2703 2981 119.2jesse lewis 2008-10 31 399 2633 0 2633 84.9
Bart Stevens 1977-80 18 374 97 2469 2566 142.6Frank Hester 1964-67 40 513 2528 0 2528 63.2Kurt Enzminger 1969-71 29 560 4 2332 2336 80.6Ray Brown 1974-76 28 433 2053 0 2053 73.3Colin Clancy 2009 11 338 153 1711 1864 169.5
RUSHING YARDS PER GAME (Min. 2 seasons played)Player Years Games Att. Yards YPGMatt Young 1968-69 19 351 1752 92.2Bill Gower 1977-80 40 727 3562 89.1Herman Heard 1982-83 21 299 1794 85.4jesse lewis 2008-10 31 397 2633 84.9Ray Brown 1974-76 28 433 2053 73.3
John Moore 1970-71 20 318 1284 64.2Frank Hester 1964-67 40 513 2528 63.2Al Brooks 1967-69 27 407 1596 59.1Jeff Patterson 1982-83 21 240 1151 54.8jamaal johnson 2008-10 30 237 1519 50.6
TOTAL RUSHING YARDSPlayer Years Games Att. Yards YPGBill Gower 1977-80 40 727 3562 89.1jesse lewis 2008-10 31 397 2633 84.9Frank Hester 1964-67 40 513 2528 63.2Ray Brown 1974-76 28 433 2053 73.3Herman Heard 1982-83 21 299 1794 85.4
Wayne Harris 1971-74 39 427 1762 45.2Matt Young 1968-69 19 351 1752 92.2Mick McCall 1975-78 37 407 1687 45.6Al Brooks 1967-69 27 407 1596 59.1jamaal johnson 2008-10 30 237 1519 50.6
PASSING YARDS PER GAME (Min. 2 seasons played)Player Years Games Att. Comp. Yds YPGJohn Wristen 1980-83 22 346 192 3283 149.2Bart Stevens 1977-80 18 271 124 2469 137.2Joe Pannunzio 1978-81 25 387 178 2703 108.1Nick Pannunzio 1982-84 11 202 80 1011 91.9Dan McMinimee 1982-84 14 222 78 1236 88.3
Bob Berry 1963-64 18 258 123 1477 82.1Jim Nelson 1972-73 20 335 129 1628 81.4Kurt Enzminger 1969-71 29 462 190 2332 80.4Mick McCall 1975-78 37 407 150 2742 74.1 Barry Loos 1969-70 13 144 65 822 63.2
TOTAL PASSING YARDSPlayer Years Games Att. Comp. Yds YPGJohn Wristen 1980-83 22 346 192 3283 149.2Mick McCall 1975-78 37 407 150 2742 74.1Joe Pannunzio 1978-81 25 387 178 2703 108.1Bart Stevens 1977-80 18 271 124 2469 137.2Kurt Enzminger 1969-71 29 462 190 2332 80.4 Colin Clancy 2009 11 270 148 1711 155.5Ross dausin 2010 11 239 135 1674 152.2Jim Nelson 1972-73 20 335 129 1628 81.4Bob Berry 1963-64 18 258 123 1477 82.1Mike Mooney 1965-68 24 237 96 1461 60.9
RECEPTIONS PER GAME (Min. 2 seasons played)Player Years Games Rec. Yards RPGJohn Trahan 1981-84 32 127 2251 4.0Corey Tolle 1979-80 20 66 1708 3.3Frank Grant 1969-71 29 94 1504 3.2Clyde Kenebrew 1974-76 28 70 1332 2.5Demetrius Gilmore 2008-09 20 49 503 2.5
Bob Murphy 1969-70 19 44 612 2.3Dan Connors 1970-73 40 92 1317 2.3Herman Heard 1982-83 21 47 901 2.2Rudy Wichmann 1967-67 20 43 657 2.2John Rees 1979-81 30 59 797 2.0
RECEPTIONSPlayer Years Games Rec. Yards RPGJohn Trahan 1981-84 32 127 2251 4.0Frank Grant 1969-71 29 94 1504 3.2Dan Connors 1970-73 40 92 1317 2.3Roy Thomas 1979-82 39 72 1167 1.8Clyde Kenebrew 1974-76 28 70 1332 2.5
Corey Tolle 1979-80 20 66 1708 3.3Randy Eddy 1963-66 38 62 848 1.6John Rees 1979-81 30 59 797 2.0Tony Gradishar 1982-84 31 58 766 1.9Demetrius Gilmore 2008-09 20 49 503 2.5
RECEIVING YARDS PER GAME (Min. 2 seasons played)Player Years Games Rec. Yards YPGCorey Tolle 1979-80 20 66 1708 85.4John Trahan 1981-84 32 127 2251 70.3Frank Grant 1969-71 29 94 1504 51.9Clyde Kenebrew 1974-76 28 70 1332 47.6Herman Heard 1982-83 21 47 901 42.9
Anthony Flenoy 1977-78 20 39 733 36.7Dan Connors 1970-73 40 92 1317 32.9Rudy Wichmann 1967-67 20 43 657 32.9Bob Murphy 1969-70 19 44 612 32.2Roy Thomas 1979-82 39 72 1167 29.9
RECEIVING YARDSPlayer Years Games Rec. Yards YPGJohn Trahan 1981-84 32 127 2251 70.3Corey Tolle 1979-80 20 66 1708 85.4Frank Grant 1969-71 29 94 1504 51.9Clyde Kenebrew 1974-76 28 70 1332 47.6Dan Connors 1970-73 40 92 1317 32.9 Roy Thomas 1979-82 39 72 1167 29.9Herman Heard 1982-83 21 47 901 42.9Randy Eddy 1963-66 38 62 848 22.3John Rees 1979-81 30 59 797 26.6Tony Gradishar 1982-84 31 58 766 24.7
POINTS SCORED PER GAME (Min. 2 seasons played)Player Year G TD XP FG Pts. PPGHerman Heard 1982-83 21 28 2 0 170 8.1kyle majoR 2008-10 32 0 103 32 199 6.2Corey Tolle 1979-80 20 18 0 0 108 5.4jesse lewis 2008-10 31 27 0 0 162 5.2Matt Young 1968-69 19 16 0 0 96 5.1
Kurt Enzminger 1969-71 29 3 66 19 141 4.9Dan Cholas 1964-65 20 15 5 0 95 4.8Bill Gower 1977-80 40 29 6 0 180 4.5Frank Hester 1964-67 40 28 0 0 168 4.2Mick McCall 1975-78 37 26 0 0 156 4.2
TOTAL POINTS SCOREDPlayer Years G TD XP FG Pts. PPGkyle majoR 2008-10 32 0 103 32 199 6.2 Bill Gower 1977-80 40 29 6 0 180 4.5Herman Heard 1982-83 21 28 2 0 170 8.1Frank Hester 1964-67 40 28 0 0 168 4.2jesse lewis 2008-10 31 27 0 0 162 5.2
Mick McCall 1975-78 37 26 0 0 156 4.2Mitch Johnson 1974-77 38 0 85 21 148 3.9Kurt Enzminger 1969-71 29 3 66 19 141 4.9Sheldon Anderson 1979-83 40 0 89 17 140 3.5Corey Tolle 1979-80 20 18 0 0 108 5.4
80
FOOTBALL RECORD BOOKTOP TEN CAREER RECORDS PASSING EFFICIENCY (Min. 2 seasons played)Player Years Att. Comp Int. Comp % Yards TD RatingJohn Wristen 1980-83 346 192 9 55.5 3283 26 154.8Bart Stevens 1977-80 271 124 19 45.7 2469 22 135.1Joe Pannunzio 1978-81 387 178 25 46.0 2703 22 110.5Royal Hurst 1974-75 114 52 16 45.6 777 10 103.7Barry Loos 1969-70 144 65 8 45.1 822 9 102.6
Mick McCall 1975-78 407 150 28 36.9 2742 21 96.7Bob Berry 1963-64 258 123 19 47.7 1477 10 93.8Joe Vigil 2007-09 104 58 6 55.8 497 2 90.7Kurt Enzminger 1969-70 462 190 22 41.1 2332 20 88.3Dan McMinimee 1982-84 222 78 20 35.1 1236 13 83.2Mike Mooney 1965-68 237 96 27 40.5 1461 8 80.6
ALL PURPOSE YARDSPlayer Years G Rush Rec Int. PR KR Yards YPGBill Gower 1977-80 40 3562 148 0 0 0 3710 92.8jesse lewis 2008-10 31 2633 437 0 0 248 3318 107.0Roy Thomas 1979-82 39 1444 1450 0 33 96 3023 77.5Frank Hester 1964-67 40 2528 304 0 0 99 2931 73.3Herman Heard 1982-83 21 1794 901 0 0 0 2695 128.3
Willie Redmon 1965-67 30 593 562 40 100 1168 2463 82.1John Trahan 1981-84 32 0 2251 0 13 90 2354 73.6Frank Grant 1969-71 29 47 1544 123 34 561 2309 79.6Corey Tolle 1979-80 20 38 1717 0 140 235 2130 106.5Ray Brown 1974-76 28 2053 73 0 0 0 2126 75.9
ALL PURPOSE YARDS PER GAME (Min. 2 seasons played)Player Years G Rush Rec Int. PR KR Yards YPGHerman Heard 1982-83 21 1794 901 0 0 0 2695 128.3jesse lewis 2008-10 31 2633 437 0 0 248 3318 107.0 Corey Tolle 1979-80 20 38 1717 0 140 235 2130 106.5Matt Young 1968-69 19 1752 267 0 0 0 2019 106.3Bill Gower 1977-80 40 3562 148 0 0 0 3710 92.8
Willie Redmon 1965-67 30 593 562 40 100 1168 2463 82.1Frank Grant 1969-71 29 47 1544 123 34 561 2309 79.6Roy Thomas 1979-82 39 1444 1450 0 33 96 3023 77.5Ray Brown 1974-76 28 2053 73 0 0 0 2126 75.9John Trahan 1981-84 32 0 2251 0 13 90 2354 73.6
INTERCEPTIONSPlayer Years Ints. YardsBilly Baker 1977-80 15 105Dickie Johnson 1975-78 12 148Steve Chavez 1966-67 10 197Chris Brown 2008-10 10 132Bryan Webb 1981-83 10 105
Mark Keisling 1969-70 10 98John Maurer 1970-72 10 94Ken Whitehead 1978-81 9 103Alan Webster 1971-74 8 126Rich Yonker 1973-75 8 125Dan Barnes 1972-73 8 82
TACKLES*Player Years Solo Assist TacklesDan DeRose 1981-83 160 255 415Collon Kennedy 1970-72 191 173 364Dale Cephers 1978-81 109 212 321Dale Cresswell 1982-84 149 171 320Rich Perea 1979-82 112 195 307
Norm Fleischauer 1974-75 147 157 304Dave Evans 1976-79 99 201 300Mike Housh 1974-77 86 178 264Paul Cassidy 1970-73 132 122 254Lloyd Moore 1975-78 98 155 253* Official NCAA Tackle rankings do not include seasons concluded prior to 2000.
OTHER CAREER LEADERBOARDSSACKS*Player Years Sacks Yds. LostChase Vaughn 2008-09 15.5 112gRant jansen 2008-10 15.5 58Jerry McWilliams 2008-09 9.5 69Beau Martin 2010 7.5 42lee meisneR 2008-10 6.5 41* Sack statistics were not kept until 2008
KICKOFF RETURN AVERAGE (Min. 1.2 Ret./Gm. & 10 GP)Player Years No. Yards TD Avg.Glen Printers 1973-74 25 851 2 34.0Augustine Agyei 2009 27 696 1 25.8Bryan Webb 1981-83 39 1001 2 25.7Willie Redmon 1965-67 47 1168 3 24.9Marquise Enoch 2009-10 26 628 1 24.2
KICKOFF RETURN YARDAGEPlayer Years No. Yards TD Avg.Dickie Johnson 1975-78 53 1278 3 24.1Willie Redmon 1965-67 47 1168 3 24.9Alan Webster 1971-74 42 1056 2 25.1Bryan Webb 1981-83 39 1001 2 25.7Glen Printers 1973-74 25 851 2 34.0
PUNT RETURN AVERAGE (Min. 1.2 Ret./Gm. & 10 GP)Player Years No. Yards TD Avg.Markus Turner 2008-09 26 308 1 11.8Glen Printers 1973-74 24 272 1 11.3Dickie Johnson 1975-78 50 450 1 9.0
PUNT RETURN YARDAGEPlayer Years No. Yards TD Avg.Alan Webster 1971-74 45 470 1 10.4Dickie Johnson 1975-78 50 450 1 9.0Markus Turner 2008-09 26 308 1 11.8Glen Printers 1973-74 24 272 1 11.3Scott Heitman 1981-83 25 267 0 10.7
PUNTING AVERAGE (Minimum 100 punts)Player Years No. Yards Blk Avg.Mike Mooney 1965, 66-68 172 6832 4 39.7Rich Perea 1979-82 203 7786 2 38.4Charles Rumsey 1975-78 177 6638 2 37.5John Maurer 1970-72 212 7718 2 36.4
81
FOOTBALL RECORD BOOKSINGLE SEASON TOP TEN TOTAL OFFENSEPlayer Year Games Plays Rush Pass Total YPGColin Clancy 2009 11 338 153 1711 1864 169.5John Wristen 1983 10 294 -78 1841 1763 176.3Mick McCall 1977 10 267 815 900 1715 171.5Bart Stevens 1979 10 223 171 1508 1679 167.9Ross Dausin 2010 11 286 -10 1674 1664 151.3
Mick McCall 1978 10 246 655 879 1534 153.4Joe Pannunzio 1981 10 334 36 1461 1497 149.7John Wristen 1982 8 171 -17 1358 1341 167.6Jesse Lewis 2010 10 176 1391 0 1391 139.1Kurt Emzinger 1971 10 305 -40 1355 1315 131.5
TOTAL RUSHING YARDSPlayer Year Games Att. Yards YPGJesse Lewis 2010 10 176 1391 139.1Bill Gower 1979 10 214 1103 110.3Jesse Lewis 2009 11 165 1064 96.7Bill Gower 1980 10 210 1058 105.8Bill Gower 1978 10 226 1013 101.3
Herman Heard 1983 10 160 1011 101.1Matt Young 1969 9 200 995 105.5Frank Hester 1965 10 120 950 95.0Jamaal Johnson 2009 11 129 906 82.3Al Brooks 1968 10 165 832 83.2
TOTAL PASSING YARDSPlayer Year Games Att. Comp. Yds YPGJohn Wristen 1983 10 203 115 1841 184.1Colin Clancy 2009 11 270 148 1711 155.5Ross Dausin 2010 11 239 135 1674 152.2Bart Stevens 1979 10 142 74 1508 150.8Joe Pannunzio 1981 10 242 110 1461 146.1
John Wristen 1982 8 121 68 1358 169.8Kurt Enzminger 1971 10 274 115 1355 135.5Jim Nelson 1973 10 174 71 996 99.6Joe Pannunzio 1980 10 108 47 973 97.3Bobby Washington 2008 7 161 72 906 129.4
RECEPTIONSPlayer Year Games Rec. Yards RPGFrank Grant 1971 10 54 760 5.4Dan Connors 1972 10 45 570 4.5John Trahan 1982 11 45 994 4.1John Trahan 1983 10 44 722 4.4Roy Thomas 1981 10 41 433 4.1
Corey Tolle 1979 10 37 912 3.7John Trahan 1984 10 37 528 3.7John Rees 1981 10 35 410 3.5Herman Heard 1983 10 34 583 3.4Augustine Agyei 2009 11 34 547 3.1
RECEIVING YARDSPlayer Year Games Rec. Yards YPGJohn Trahan 1982 11 45 994 90.4Corey Tolle 1979 10 37 912 91.2Corey Tolle 1980 10 29 796 79.6Frank Grant 1971 10 54 760 76.0John Trahan 1983 10 44 722 72.2
Anthony Flenoy 1978 10 28 616 61.6Frank Grant 1970 10 32 613 61.3Herman Heard 1983 10 34 583 58.3Dan Connors 1972 10 45 570 57.0Augustine Agyei 2009 11 34 547 49.7
TOTAL POINTS SCOREDPlayer Year G TD XP FG Pts. PPGKyle Major 2010 11 0 48 16 96 8.7Herman Heard 1983 10 14 2 0 86 8.6Jesse Lewis 2010 10 14 0 0 84 8.4Herman Heard 1982 11 14 0 0 84 7.6Mick McCall 1978 10 11 6 0 72 7.2
Jesse Lewis 2009 11 12 0 0 72 6.5Joe Pannunzio 1980 10 11 2 0 68 6.8Bill Gower 1980 10 11 2 0 68 6.8Corey Tolle 1979 10 11 0 0 66 6.6John Trahan 1982 11 11 0 0 66 6.6
PASSING EFFICIENCYPlayer Year Att. Comp Int. Comp% Yards TD RatingJohn Wristen 1982 121 68 2 56.2 1358 13 182.6Bart Stevens 1979 142 74 11 52.1 1508 14 158.4Mick McCall 1978 98 50 3 51.0 879 9 150.5John Wristen 1983 203 115 7 56.7 1841 12 145.4Joe Pannunzio 1980 108 48 9 44.4 973 10 134.0
Ross Dausin 2010 239 135 6 56.5 1674 12 126.9Colin Clancy 2009 148 270 8 54.8 1711 14 119.2Barry Loos 1969 88 42 6 47.7 560 7 113.8Bobby Washington 2008 161 72 3 44.7 906 2 104.7Joe Pannunzio 1981 242 110 14 45.5 1461 12 101.0
ALL PURPOSE YARDSPlayer Year G Rush Rec Int. PR KR Yards YPGHerman Heard 1983 10 1011 583 0 0 0 1594 159.4Jesse Lewis 2010 10 1391 62 0 0 0 1453 145.3Jesse Lewis 2009 11 1064 318 0 0 0 1382 125.6Augustine Agyei 2009 11 17 547 0 1 696 1261 114.6Matt Young 1969 9 995 140 0 0 0 1135 126.1
Bill Gower 1979 10 1103 24 0 0 0 1127 112.7Bill Gower 1980 10 1058 45 0 0 0 1103 110.3Herman Heard 1982 11 783 318 0 0 0 1101 100.1Corey Tolle 1979 10 15 912 0 51 113 1091 109.1Bill Gower 1978 10 1013 72 0 0 0 1085 108.5
INTERCEPTIONSPlayer Year Ints. YardsSteve Chavez 1967 7 126Dickie Johnson 1978 6 83Billy Baker 1980 6 39Jeff Bell 1982 6 47Bryan Webb 1983 6 22Mark Keisling 1969 6 16Six tied with five interceptions
TACKLES*Player Year Solo Assist TacklesNorm Fleischauer 1974 98 79 177Dan DeRose 1983 66 91 157Dale Cresswell 1984 64 78 142Collon Kennedy 1972 78 58 136Dan DeRose 1981 40 90 130
Dan DeRose 1982 54 74 128Norm Fleischauer 1975 49 78 127Collon Kennedy 1970 54 68 122Lee Meisner 2010 50 74 124Dave Evans 1976 38 76 114Bob Busia 1963 N/A N/A 114* Official NCAA Tackle rankings do not include seasons concluded prior to 2000.
SACKS*Player Year Sacks Yds. LostChase Vaughn 2008 10.5 73Beau Martin 2010 7.5 42Grant Jansen 2010 7.0 28Grant Jansen 2008 6.0 25Three tied with five sacks* Sack statistics were not kept until 2008
KICKOFF RETURN AVERAGE (Min. 1.2 Ret./Gm)Player Year No. Yards TD Avg.Glen Printers 1973 20 628 2 31.4Willie Redmon 1967 14 400 0 28.6Alan Webster 1972 16 449 2 28.0Dickie Johnson 1978 16 443 2 27.7Bryan Webb 1981 16 422 0 26.4
PUNT RETURN AVERAGE (Min. 1.2 Ret./Gm.)Player Year No. Yards TD Avg.Keno Aleman 1968 11 177 1 16.1Scott Heitman 1983 13 183 0 14.1Markus Turner 2008 18 234 1 13.0Dickie Johnson 1976 13 165 0 12.7Grant Crunkleton 2009 18 222 0 12.3
PUNTING AVERAGEPlayer Year No. Yards Blk Avg.Brandon Kliesen 2010 50 2158 0 43.2Mike Mooney 1968 55 2345 3 42.6Rich Perea 1980 42 1765 0 42.0Charles Rumsey 1976 58 2351 0 40.5Rich Perea 1979 29 1159 1 40.0
82
FOOTBALL RECORD BOOKINDIVIDUAL SEASON LEADERS TOTAL OFFENSEYear Player Plays Rush Pass Total YPG1963 Bob Berry (QB) 143 -38 689 651 81.41964 Bob Berry (QB) 165 -53 788 735 73.51965 Frank Hester (RB) 121 950 0 950 95.01966 Frank Hester (RB) 175 707 4 711 71.11967 Mike Mooney (QB) 179 -172 785 613 61.31968 Al Brooks (RB) 165 832 0 832 83.21969 Matthew Young (RB) 203 995 0 995 110.61970 John Moore (RB) 178 769 0 769 76.91971 Kurt Enzminger (QB) 305 -40 1355 1315 131.51972 Russ Leigh (QB) 152 231 315 546 54.61973 Jim Nelson (QB) 220 -119 996 877 87.71974 Ray Brown (RB) 134 693 0 693 77.01975 Ray Brown (RB) 125 550 0 550 78.61976 Mick McCall (QB) 225 248 580 828 75.31977 Mick McCall (QB) 267 815 900 1715 171.51978 Mick McCall (QB) 246 655 879 1534 153.41979 Bart Stevens (QB) 223 171 1508 1679 167.91980 Joe Pannunzio (QB) 199 265 973 1238 123.81981 Joe Pannunzio (QB) 334 36 1461 1497 149.71982 John Wristen (QB) 171 -17 1358 1341 167.61983 John Wristen (QB) 294 -78 1841 1763 176.31984 Nick Pannunzio (QB) 230 275 724 999 99.92008 Bobby Washinton (QB) 219 3 906 909 129.92009 Colin Clancy (QB) 338 153 1711 1864 169.52010 Ross Dausin (QB) 286 -10 1674 1664 151.3
RUSHING YARDSYear Player Att Yards Avg. TD1963 Chet Foster 67 430 6.5 51964 Chet Foster 75 561 7.5 101965 Frank Hester 120 950 7.9 101966 Frank Hester 172 707 4.1 51967 Frank Hester 133 439 3.3 61968 Al Brooks 165 832 5.0 61969 Matthew Young 200 995 5.0 91970 John Moore 178 769 4.3 41971 John Moore 140 515 3.7 41972 Wayne Harris 113 393 3.4 41973 Benny Williams 179 627 3.5 51974 Ray Brown 134 693 5.2 41975 Ray Brown 125 550 4.4 61976 Ray Brown 174 837 4.7 71977 Mick McCall (QB) 134 815 6.1 101978 Bill Gower 226 1013 4.5 81979 Bill Gower 214 1103 5.2 101980 Bill Gower 210 1058 5.0 101981 Roy Thomas 144 575 4.0 21982 Jeff Patterson 168 818 4.9 101983 Herman Heard 160 1011 6.3 81984 Jason Johnson 93 356 3.8 22008 Brandon Gray 110 401 3.6 22009 Jesse Lewis 165 1064 6.4 92010 Jesse Lewis 176 1391 7.9 14
PASSING YARDSYear Player Att. Comp. Int. Comp% Yds TD1963 Bob Berry 123 57 9 46.3 689 41964 Bob Berry 135 66 10 48.9 788 61965 Chet Foster 78 30 6 38.4 346 41966 Tom Giasson 95 39 6 41.0 544 61967 Mike Mooney 125 52 12 41.6 785 61968 Ed Valdez 132 52 12 41.6 785 61969 Barry Loos 88 42 6 47.7 560 71970 Kurt Enzminger 102 47 5 38.8 678 81971 Kurt Enzminger 274 115 10 41.9 1355 91972 Jim Nelson 161 58 5 36.0 632 51973 Jim Nelson 174 71 13 40.8 996 61974 Royal Hurst 69 31 6 44.9 434 51975 Mick McCall 53 20 5 37.7 383 11976 Mick McCall 123 34 10 27.6 580 71977 Mick McCall 133 46 10 34.6 900 41978 Mick McCall 98 50 3 51.0 879 91979 Bart Stevens 142 74 11 52.1 1508 141980 Joe Pannunzio 108 48 9 44.4 973 101981 Joe Pannunzio 242 110 14 45.5 1461 121982 John Wristen 121 68 2 56.2 1358 131983 John Wristen 203 115 7 56.7 1841 121984 Nick Pannunzio 174 69 9 39.7 724 42008 Bobby Washington 161 72 3 44.7 906 82009 Colin Clancy 270 148 8 54.8 1711 142010 Ross Dausin 239 135 6 56.5 1674 12
RECEIVING YARDSYear Player No. Yards Avg. TD1963 Tony Sarno 20 286 14.3 N/A1964 Randy Eddy 30 432 14.4 61965 Ron Halliburton 11 200 18.1 21966 Dick Brobst 18 229 12.7 11967 Rudy Wichmann 20 343 17.2 21968 Rudy Wichmann 23 314 13.7 11969 Bob Murphy 23 270 11.7 61970 Frank Grant 32 613 19.1 61971 Frank Grant 54 760 14.1 61972 Dan Connors 45 570 12.7 41973 Dan Connors 28 523 18.7 41974 Clyde Kenebrew 22 402 18.3 91975 Clyde Kenebrew 18 318 17.7 11976 Clyde Kenebrew 13 383 29.5 51977 Greg Groves 13 395 30.4 11978 Anthony Flenoy 28 616 22.0 71979 Corey Tolle 37 912 24.6 111980 Corey Tolle 29 796 27.4 71981 Roy Thomas 41 443 10.8 31982 John Trahan 45 994 22.1 111983 John Trahan 44 722 16.4 31984 John Trahan 37 528 14.3 22008 Aromous Robinson 22 250 11.4 22009 Augustine Agyei 34 547 16.1 72010 Bernard Jackson 32 453 14.2 3
ALL-PURPOSE YARDSYear Player Rush Rec Int. PR KR Yards1963 Chet Foster 430 0 0 0 0 4301964 Randy Eddy 210 432 0 0 0 6421965 Frank Hester 950 82 0 0 0 10321966 Willie Redmon 333 139 0 0 368 8401967 Willie Redmon 92 237 8 85 400 8221968 Matthew Young 757 127 0 0 0 8841969 Matthew Young 995 140 0 0 0 11351970 Frank Grant 0 613 0 9 198 8201971 Frank Grant 50 760 0 0 0 8101972 Dan Connors 0 570 0 0 0 5701973 Glen Printers 0 0 158 163 628 9491974 Ray Brown 693 4 0 0 0 6971975 Ray Brown 550 30 0 0 0 5801976 Ray Brown 810 39 0 0 0 8491977 Mick McCall 815 0 0 0 0 8151978 Bill Gower 1013 72 0 0 0 10851979 Bill Gower 1103 24 0 0 0 11271980 Bill Gower 1058 45 0 0 0 11031981 Roy Thomas 575 443 0 0 0 10181982 Herman Heard 783 318 0 0 0 11011983 Herman Heard 1011 583 0 0 0 15941984 John Trahan 0 528 0 0 0 528 2008 Markus Turner 36 179 0 234 187 6362009 Jesse Lewis 1064 318 0 0 0 13822010 Jesse Lewis 1391 62 0 0 0 1453
SCORINGYear Player TD XP FG Pts.1963 N/A1964 Chet Foster 10 0 0 601965 Frank Hester 10 0 0 601966 Frank Hester 6 0 0 361967 Frank Hester 6 0 0 361968 Matthew Young 7 0 0 421969 Matthew Young 9 0 0 541970 Kurt Enzminger 1 23 3 381971 Kurt Enzminger 1 23 8 531972 Del Bishop 0 19 9 461973 Del Bishop 0 16 6 341974 Clyde Kenebrew 9 0 0 541975 Ray Brown/Royal Hurst 6 0 0 361976 Mitch Johnson 0 24 9 511977 Mick McCall 10 0 0 601978 Mick McCall 10 3 0 721979 Corey Tolle 11 0 0 661981 Roy Thomas 5 0 0 301982 Herman Heard 14 0 0 841983 Herman Heard 14 1 0 861984 Matt Scranton 0 10 6 282008 Kyle Major 0 17 8 412009 Jesse Lewis 12 0 0 722010 Kyle Major 0 48 16 96
83
CSU-PUEBLO HONOR ROLLNJCAA ALL-AMERICANS
1957 Joe Martines, Back (HM)1958 Gordon Bell, TE (HM)1960 Larry Tubaugh, OG (1st)1962 John Hellard, TE (1st) Milton Banks, FB (HM)
ALL-AMERICANS1965 Dave Reid, OL (HM)1966 Sam Clay (HM) Jim Cain (HM)1969 Greg Smith, OL1971 Frank Grant, WR1974 Glen Printers, DB/KR (AP)1975 Kirk Brynjulson, LB (2nd)1979 Bill Gower, RB (HM)1980 Scott Gallas, OL (2nd)1982 John Trahan, WR Jeff England, OL2008 Chase Vaughn, DL (HM – Don Hansen’s Football Gazette)2010 Jesse Lewis, RB (3rd – AP Little All-America) (3rd – Don Hansen’s Football Gazette)
ACADEMIC ALL-AMERICA1972 Collon Kennedy (second team)1973 Jim Nelson (second team)1980 Bill Gower (second team)1983 Dan DeRose (first team)
ALL-REGION2008 Chase Vaughn, DL (2nd – Don Hansen’s Football Gazette)2010 Jesse Lewis, RB (1st – Don Hansen’s Football Gazette) (2nd – Daktronics) Lee Meisner, LB (1st – Daktronics) Grant Crunkleton, CB (1st – Daktronics)
CACTUS BOWL INVITE (D-II ALL-STAR GAME)
2009 Chase Vaughn, LB
ALL-NATIONAL FOOTBALL FOUNDATION ALL-COLORADO
2008 Chase Vaughn, DL (first team)2009 Jesse Lewis, RB (first team) Chase Vaughn, LB (first team) Jamaal Johnson, RB (second team) J.T. Haddan, OG (second team)2010 Jesse Lewis, RB (first team) Kyle Major, K (first team) Lee Meisner, LB (first team) Jamaal Johnson, RB (second team) Drew Swartz, OL (second team) Ryan Jensen, OL (second team) Damon Schiele, LB (second team) Jason Campbell, LB (second team) Grant Crunkleton, CB (second team) Grant Jansen, DL (second team)
ALL-ROCKY MOUNTAIN ATHLETIC CONFERENCE
1969 Matthew Young, RB (1st) Gene Taylor, OG (1st)1970 Frank Grant, SE (1st)1971 Frank Grant, SE (1st) Scott Schoen, OT (1st) Kurt Enziminger, QB (1st) Collon Kennedy, LB (1st)1976 Ray Brown, FB (1st) Archie Neil, DE (1st) Charles Rumsey, P (1st) Mitch Johnson, K (1st) Steve O’Dell, DL (2nd)1977 Dean Koester, OT (1st) Bobbie Bryant, LB (1st) Mike Housh, DT (1st) Archie Neil, DE (1st) Mick McCall, QB (2nd) Mike Elm, DB (2nd)1979 Bill Gower, FB (1st) Corey Tolle, SE (1st) Scott Gallas, C (1st) Rod Carlson, OG (1st) James Atkins, DT (1st) Wendell Burton, DE (1st) Rich Safonous, OG (2nd) Dale Cephers, LB (2nd) Billy Baker, DB (2nd)1980 Corey Tolle, WR (1st) Rod Carlson, OG (1st) Scott Galas, c (1st) Bill Gower, RB (1st) John Wissing, DT (1st)
Dale Cephers, LB (1st) Billy Baker, DB (1st) Roy Thomas, RB (2nd) Rich Perea, P (2nd) Dave Shaddy, DB (2nd) Sheldon Anderson, PK (HM) James Atkins, DT (HM) Joe Pannunzio, QB (HM) John Rees, WR (HM) Bart Stevens, QB (HM)1981 John Rees, TE (1st)1982 John Wristen, QB (1st) John Trahan, WR (1st) Jeff England, OL (1st) Craig Ward, DL (1st) Mark DeRose, LB (1st) Louis Florez, OL (2nd) Herman Heard, RB (2nd) Rich Perea, DL (2nd) Jeff Bell, DB (2nd) Tony Gradishar, TE (HM) Roy Thomas, WR (HM) Gene Tapia, OL (HM) Dan Stauss, OL (HM) Jeff Paterson, RB (HM) Dan DeRose, LB (HM) Dale Cresswell, LB (HM) 1983 John Trahan, WR (1st) Gene Tapia, OL (1st) Herman Heard, RB (1st) Dan DeRose, LB (1st) Bryan Webb, DB (1st) John Wristen, QB (2nd) Jeff Osterman, DL (2nd) Joe Taibi, DL (2nd) Tony Gradishar, TE (HM) Randy Drietz, OL (HM) Jeff England, OL (HM) Jeff Paterson, RB (HM) Scott Heitman, KR (HM) Greg Garner, DL (HM) Dale Cresswell, LB (HM) Scott Heitman, DB (HM) Lonnie Hampton, DB (HM) Scott Elizondo, DB (HM)1984 John Trahan, WR (1st) Jeff Osterman, DL (2nd) Dale Cresswell, LB (2nd) Tony Gradishar, (HM) Frank O’Connor, (HM) Greg Garner, (HM)2008 Chase Vaughn, DE (1st) Markus Turner, PR (2nd) Jerome Page, DB (3rd)2009 Jesse Lewis, RB (1st) Chase Vaughn, LB (1st) Jerry McWilliams, DL (2nd) Lee Meisner, LB (3rd) Chris Brown, CB (3rd) Augustine Agyei, KR (3rd) Jamaal Johnson, RB (3rd)2010 Lee Meisner, LB (1st) Jesse Lewis, RB (1st) Koby Wittek, TE (2nd) Ryan Jensen, OL (2nd) Drew Swartz, OL (2nd) Beau Martin, DE (2nd) Jason Campbell, OLB (2nd) Grant Crunkleton, CB (2nd) Jon Bailey, S (2nd) Kyle Major, K (2nd) Bernard Jackson, WR (3rd) J.T. Haddan, OL (3rd) Chris Brown, CB (3rd) Josh Costa, S (3rd)
ALL-GREAT PLAINS ATHLETIC CONFERENCE
1972 Henry Huber, OG (1st) Collon Kennedy, LB (1st) Bobby Joe Simmons, LB (1st)1973 Dan Connors, SE (1st) Mike Reppa, OT (1st) Glen Printers, DB (1st)1974 Glen Printers, DB (1st) Norm Fleischauer, LB (1st) Kirk Brjnjulson, DE (1st) Clyde Kenebrew, SE (1st)1975 Ray Brown, FB (1st) Tom Guinane, LB (1st) Doug Mason, DB (1st)
ACADEMIC ALL-RMAC2009 Lee Meisner, LB (1st) Nick Sabye, OL (2nd)
Grant Jansen, DL (2nd) Jon Bailey, DB (2nd) Jerry McWilliams, DL (honor roll) Roger Pfannenschmid, TE (honor roll) J.T. Haddan, OG (honor roll)2010 J.T. Haddan, OG (1st) Grant Jansen, DE (1st) Lee Meisner, LB (1st) Jon Bailey, DB (1st) Roger Pfannenschmid, TE (2nd) Drew Swartz, OL (2nd) Taylor Kelly, OL (2nd) Troy Graham, QB (honor roll) Sebastian Trujillo, QB (honor roll) Josh Salazar, RB (honor roll) Nick Sabye, OL (honor roll) Ben Hicks, DL (honor roll) Sutton Richmond, LB (honor roll) Alex Rios, LB (honor roll) Brandon Kliesen, P (honor roll)
FORMER USFL PLAYERS1983 Mark DeRose (Denver Gold) Craig Ward (Michigan Panthers)
DRAFTED BY NFL TEAM1973 Frank Grant (Washington)1974 Glen Printers (San Diego)1984 Herman Heard (Kansas City)
DRAFTED BY USFL TEAM1984 Jeff England (Oklahoma Outlaws)
SIGNED NFL CONTRACT/NFL TRYOUT
1966 Dan Cholas (Denver)1970 Jim Cain (N.Y. Jets)1974 Mike Reppa (Kansas City)1975 Glen Printers (Dallas) Alan Webster (Kansas City)1976 Del Bishop (Seattle)1978 Mitch Johnson (Denver)1979 Mick McCall (Detroit)1981 Scott Gallas (Houston Oilers) Bill Gower (Philadelphia)1983 Dan DeRose (Denver) Rich Perea (Denver)1984 Jeff England (Dallas) Jeff Patterson (Denver) John Wristen (Denver)2009 Augustine Agyei (Cincinnati)
84
THUNDERWOLVES IN THE PROS
FRANK GRANTWASHINGTON REDSKINS, 1973-78; TAMPA BAY BUCS, 1979
CSU-PUEBLO RECEIVER, 1968-71 DRAFTED IN 13TH ROUND OF 1972 NFL DRAFT
HERMAN HEARDKANSAS CITY CHIEFS, 1984-89
CSU-PUEBLO RUNNING BACK, 1982-83 DRAFTED IN 3RD ROUND OF 1984 NFL DRAFT
PLAYERS DRAFTED BY NFL1972: Frank Grant (13th round, Washing-ton Redskins) 1974: Glen Printers (13th round, San Diego Chargers) 1984: Herman Heard (3rd round, Kansas City Chiefs)
Glen Printers CSU-Pueblo DB, 1972-73 1973 All-American
1987 NFL REPLACEMENT PLAYERSIn 1987, the National Football League’s players’ strike created opportunities for over 500 pro hopefuls. Three CSU-Pueblo alums played during the strikeN.Y. Giants: Dan DeRose (@CSUP 1981-83); Joe Taibi (@CSUP 1982-84) Kansas City: John Trahan (@CSUP 1981-84)
Dan DeRose
CSU-Pueblo LB, 1981-83 N.Y. Giants Defensive Captain, 1987
NON-NFL PRO PLAYERS1983: Mark DeRose (@CSUP 1981-82) (USFL – Denver Gold) Craig Ward (@CSUP 1979-82) (USFL – Michigan Panthers) 1991-93: Myron Jefferson (@CSUP 1984) (AFL – Albany Firebirds) 2010-11: Chase Vaughn (@CSUP 2008-09) (UFL – Las Vegas Locos)
Chase Vaughn CSU-Pueblo LB, 2008-09 2008 All-American
NFL TRYOUTS1966 Dan Cholas (Denver)1966 Marty Collins (Saskatchewan – CFL)1970 Jim Cain (N.Y. Jets)1974 Mike Reppa (Kansas City)1975 Glen Printers (Dallas) Alan Webster (Kansas City)1976 Del Bishop (Seattle)1978 Mitch Johnson (Denver)1979 Mick McCall (Detroit)1981 Scott Gallas (Houston Oilers) Bill Gower (Philadelphia)1983 Dan DeRose (Denver) Rich Perea (Denver)1984 Jeff England (Dallas; Drafted by USFL) Jeff Patterson (Denver) John Wristen (Denver)2010 Augustine Agyei (Cincinnati)
85
CSU-PUEBLO & ATHLETIC DEPT. CSU-PUEBLO
PAGE 86PUEBLO & SOUTHERN COLORADO
PAGE 88NCAA DIVISION II
PAGE 89INTERIM PRESIDENT DR. JULIO LEON
PAGE 90ATHLETICS STAFF
PAGE 91
86
WE ARE CSU-PUEBLO!Colorado State University-Pueblo, the fastest-growing
university in the state of Colorado, offers students a high-quality education and a one-of-a-kind University experi-ence without the hassle and expense of larger colleges.
CSU-Pueblo is not only one of the best educational values in the Rocky Mountain region, but in the entire United States.
Colorado State University-Pueblo is nestled in a histori-cally and culturally rich community of more than 100,000 people, located in the southern part of the state near the foothills of the Rocky Mountains—just a short drive to Denver and Colorado Springs.
The state’s geography and attractions create an excit-ing environment for this vibrant college campus. With a population of more then 5,000 students – and growing, CSU-Pueblo students thrive in small classes taught by world-class educators. Outside the classroom we foster an exciting, adventurous and social environment rich in cul-ture, athletics, and all the beauty the Pikes Peak region has to offer. And with over 300 days of sunshine a year, people here have a healthy love for the outdoors.
CSU-Pueblo also boasts one of the fastest-growing athletic programs in the United States. Ever since the athletic program expanded in 2008, adding the sports of football, track and field and wrestling, as well as new or refurbished athletic facilities, including Mas-sari Arena, the Neta and Eddie DeRose Thunder-Bowl and a new Student Recreation Center, it is no coincidence that the University’s enrollment has increased by more than 25 percent for the past three years.
It’s an exciting time to be a ThunderWolf and the entire Pack community – students, faculty and staff – proudly proclaim with pride WE ARE CSU-PUEBLO!
87
88
PUEBLO & SOUTHERN COLORADOCSU-Pueblo’s campus, spanning more than
275 acres, crowns the north end of Pueblo, Colorado. Pueblo is a historically and cultur-ally rich city of over 100,000 located in the heart of the state, along the Arkansas River near the Greenhorn Mountains in the color-ful Pikes Peak region of Southern Colorado.
The city of Pueblo, Colorado is a place where your dreams can be as big as the snow-capped mountains, where fleece jackets and tuxedos are equally trendy, where small-town charm meets big-city fusion. Pueblo contains a dynamic mix of arts and culture, shopping and dining, sports and entertainment.
Approximately 300 sunny days a year attract outdoor enthusiasts to a full slate of summer and winter recreation-al activities, encompassing water sports at Lake Pueblo, biking or running along Pueblo’s beautiful river trail system, golfing, playing tennis, hik-ing or skiing in the mountains to the west, or just getting some sun.
The nightlife venues feature local and national artists performing at the Sangre De Cristo Arts & Confer-ence Center, dinner theaters, and local nightclubs.
Nearby, mountain communities host unique festivals, world-renown ski slopes and abundant recreational adventures.
Take in the friendly atmosphere at one of the local coffee cafes, enjoy the rich and spicy dining experience that is making this region popular, or watch a sunset from the shore of Lake Pueblo.
We invite you to explore our beautiful city from the shopping malls and 14-screen theater approximately 2 miles from campus, to the Royal Gorge Bridge less than an hour away. We’re proud to be a part of such a beautiful and dynamic city, Pueblo Colorado, Home of Heroes (4 Congressional Medal of Honor recipients).
89
CSU-PUEBLO & NCAA DIVISION IIWhy Choose Division II?Many Division II student-athletes had opportunities to
play in NCAA Division I or Division III or the NAIA. But they chose Division II, and for almost all of them, the choice is a good one. A “balance” exists that emphasizes both academic excellence and athletics achievement, and an environment is created that leads to the student-athlete’s total personal development.
Almost none of the 80,000 student-athletes competing in Division II this year will receive a full athletics grant that covers all of their expenses, but most of them will receive some financial aid to help them through school. For the rest of their expenses, they’re on their own – us-ing scholarships, student loans and employment earn-ings just like most other students attending college. This healthy partnership is the essence of Division II, where student-athletes are valued for their athletics contri-bution and for being an important part of the overall student body.
Division II student-athletes play at a competitive level, and they most often play close to home. Division II em-phasizes regional competition so that student-athletes miss less class time because of travel. Division II student-athletes receive value-based educations at regional insti-tutions that often feature high teacher-to-student ratios.
Why Did CSU-Pueblo Choose Division II?Colorado State University-Pueblo is proud to be an
NCAA Division II institution. Division II’s conservative fiscal model permits CSU-Pueblo to conduct high-level athletics that are fully integrated into the overall Univer-sity. Rather than being financially self-sustaining, almost all Division II programs, CSU-Pueblo included, receive support from the institution itself – just like other de-partments of the college or university.
Division II’s regionalization philosophy encourages responsible spending by limiting travel. It also creates a local emphasis that lowers recruiting expenses.
What that means for CSU-Pueblo student-athletes is a balanced atmosphere for personal and athletic growth. At the Division I level, student-athletes are regularly defined by their athletic contributions, with their class-room contributions seen as somewhat secondary. At the Division III level, though, it is almost reversed, where student-athletes receive no athletic grants for competi-tion. Division II offers a balance between athletics and academics, enhancing the overall student-athlete experi-ence.
Does it work? CSU-Pueblo is proud to be member of the Rocky Moun-
tain Athletic Conference, which includes 14 universities from the Rocky Mountain region. The RMAC allows for elite competition as well as ideal travel partners for RMAC competition.
The average expense for a Division II program is only 36 percent of that for a typical Division I-AA program. The largest reported athletics budget in Division II is only about 10 percent higher than the average athletics budget in Division I-AA.
Do fans support Division II? They do, both at CSU-Pueblo and in Division II as a
whole.Division II football set an attendance record in 2005
with 2,989,274 fans. In fact, Division II total football attendance has increased each year since 2002, the only NCAA division or subdivision that can make such a claim. Division II men’s basketball also set an all-time atten-dance record in 2004.
At CSU-Pueblo, the ThunderWolves enjoyed some of the best attendance in all of Division II. The ThunderWolves’ football program has been ranked in the top 20 nation-ally in attendance each of the past two seasons, and both years the Pack outdrew Colorado’s only Football Championship Subdivision program, Northern Colorado, by over 2,000 fans per game. In 2009-10, CSU-Pueblo also led the RMAC in attendance in men’s and women’s basketball.
Many former CSU-Pueblo student athletes have enjoyed productive careers, both inside and outside athletics.Athlete Professional Sport (Yr.) Accomplishment Jason Allen PGA Tour Golfer Men’s Golf (‘96)Wendell Burton President, Select Oil Tools Football (‘79)Dax Charles Head Wrestling Coach, CSU-Pueblo Wrestling (‘94)Dan DeRose former NFL player; CEO, DD Marketing Football (‘83)Gina Gerbaz Senior Mgr., Capital Group Companies Basketball (‘94)Frank Grant Former NFL Player, Washington Redskins Football (‘72)Herman Heard Former NFL Player, Kansas City Chiefs Football (‘83)Josh Koschke Head Men’s Golf Coach, CSU-Pueblo Men’s Golf (‘04)Ryan Lown Executive Director, Parkview Hospital Baseball (‘01)Chris Martinez Vice President, Colorado Bank & Trust Baseball (‘94)Joey Newby pro baseball player, Seattle Mariners Baseball (‘04)Joe Pannunzio Assistant Foootball Coach, Miami (Fla.) Univ. Football (‘82)Nick Pannunzio President, Premier Homes Football (‘84)Tony Pechek pro baseball player, Milwaukee Brewers Baseball (‘09)Chuck Pipher Head Wrestling Coach, Mesa State Wrestling (‘89)Mike Roumph Executive Vice President, DD Marketing Basketball (‘91)Jennifer Salmans Head Volleyball Coach, Okla. City Univ. Volleyball (‘01)Albert Sandoval Strength/Conditioning, Colorado Rockies Baseball (‘03)John Smith Former ABA Player Basketball (‘68)Misha Stephenson Sr. Product Mktg. Mgr/TriZetto Group Softball (‘96)Niki Toussaint Assoc. Athletic Director, CSU-Pueblo Softball (‘01)Bob Warlick former NBA Player Basketball (‘61)Damon Williams pro basketball player, Finland Basketball (‘98)Jeff Williams pro baseball player, N.Y. Yankees Baseball (‘06)John Wristen Head Football Coach, CSU-Pueblo Football (‘83)
90
DR. JULIO LEONINTERIM PRESIDENT OF COLORADO STATE UNIVERSITY-PUEBLO • 2ND YEAR
The Colorado State University System Board of Governors appointed Dr. Julio Leon to the position of Interim Presi-dent of Colorado State University-Pueblo in November of 2010 to replace Joseph Garcia, who stepped down after being elected Lieutenant Governor of Colorado. Dr. Leon will serve as interim until a permanent president is named. Leon spent 25 years as president of Missouri Southern State University in Joplin, Missouri. In 1969, he joined Mis-souri Southern State University, where he was an assistant, associate, and full professor of business administration for seven years. He then went on to serve as dean of the School of Business Administration, a position he held for six years before being named president. He retired from Missouri Southern State University in 2007.
During his tenure at MSSU, he led the institution to university status, doubled the enrollment to 6,000 students, and oversaw capital construction of more than $120 million. Leon also developed an award-winning international education programs that resulted in obtaining a statewide mission in international education for the university and $2.8 million annually in state funding for international education programs. He also initiated a online degree program that now enroll more than 2000 students from Missouri, the U.S., and abroad in bachelor degree programs in business administration, criminal justice, and general studies.
Since he arrived at CSU-Pueblo, Leon has inducted 21 high-achieving incoming freshmen into the inaugural class of the University’s Honors Program, strengthened partnerships with both the Sangre de Cristo Arts Center and Pueblo Symphony in bringing a Viennese Ball to the community, and carried the torch as the Colorado Legislature changed the University’s mission to allow it to pursue its first-ever doctoral program, a Doctorate of Nursing Practice.
Throughout his career, he has held numerous national leadership positions, including Chairman of the Board of Directors of the American Association of State Colleges and Universities as well as service on the Board of Directors of the American Council on Education and the Council of Presidents of the Association of Governing Boards.
Leon earned a Bachelor of Science degree in English from Universidad de Santiago de Chile, in Santiago, Chile, a Mas-ter of Business Administration degree from University of North Texas in Denton, and a Doctor of Philosophy (Ph.D.) Business Administration and Economics from the University of Arkansas, Fayetteville.
91
JOE FOLDAATHLETICS DIRECTOR • NINTH YEAR / 24TH YEAR AT CSU-PUEBLO
Joe Folda will be entering his ninth year as the full-time and permanent Director of Athletics. Folda previously had two stints running the department, serving as interim AD in 2001 and 2003-05.
In his time as director of athletics, Folda has been behind the steering wheel of an athletics expansion that hasn’t been seen in the history of CSU-Pueblo Athletics. He has taken the lead on a variety of construction projects, including the renovation of Massari Arena, and the reinstatement of Football, Wrestling and Women’s Track and Field programs in 2008-09. Since the athletic expansion in 2008-09, the University’s enrollment has increased by 25 percent, and the amount of student-athletes at the University has more than doubled.
Prior to that, Folda spent 18 years as the head basketball coach of the men’s program at CSU-Pueblo. As a basket-ball coach, Folda distinguished himself as one of the top tacticians and teachers in the Rocky Mountain Athletic Conference. The all-time winningest coach in school his-tory, Folda’s dedication and intensity on the hardwood has carried over to the leadership he has used to lead the athletic department.
In his career at CSU-Pueblo, Folda led the Thunder-Wolves to the 1991 Colorado Athletic Conference Tournament Championship, a share of the 1994 and 1996 CAC regular-season title, the 1998 Rocky Mountain Athletic Conference West Division Championship, a berth in the 1998 North Central Regional Tourna-ment, as well as several ventures into the NCAA II Top 20, most recently a number 25 ranking on December 6, 1999.
During his tenure as the T-Wolves’ head coach, Folda guided the team to 14 consecutive seasons with an above .500 finish and extended the school’s streak of non-losing seasons to 25. He established a coaching philosophy of tough, man-to-man defense and fast break offense.
In 1991, Folda led his team to one of the best seasons in school history. That squad set a school record for wins in a season (25), won the first-ever CAC Tournament Championship and qualified for the NAIA National Tournament. That same year, Folda was crowned the NAIA District VII Coach of the Year. In 1997-98, Folda guided the ThunderWolves to a school-record 14 consecutive wins and their first RMAC West Division title.
Prior to arriving at CSU-Pueblo, Folda coached at Eastern Washington University - an NCAA Division I program. He spent 11 years at EWU, three as a graduate assistant, five as an assistant coach and three as head coach. He led his teams to a 42-42 record, including a 20-8 record in his second season at the reins of the EWU program.
Folda began his coaching career at Seibert (Colo.) High School in 1966. During the next 13 years, he coached at Holy Family High School in Denver, Sidney (Neb.) High School, and Sterling (Colo.) High School. Folda began his collegiate playing career at Northeastern Junior College in Sterling, Colo. As a two-year starter at Northeastern, he twice earned all-conference and all-region honors, and was named honorable mention All-American.
After NJC, Folda transferred to the University of Northern Colorado. He led his team to consecutive NCAA Division II National Tournament appearances and was the Bears’ top scorer as a senior, averaging 15.1 points per game. Folda earned all-conference, all-region and honorable mention All-American.
Folda received his Bachelor of Arts degree from Northern Colorado before earning his Masters degree from Eastern Washington.
Folda, and his wife, Rosalie, have three children: Cyndi, Duke, and Mike, who played guard for the T-Wolves in 2001 and 2002. He also has six grandchildren.
92
ATHLETIC ADMINISTRATIONNIKI WHITAKERAssociAte Athletic Director/swA 6th year at csu-pueblo
Niki Toussaint-Whitaker is entering her sixth year with the CSU-Pueblo Athletic Department as Associate Athletic Director and Senior Woman Administrator.
She is responsible for the department’s community relations projects and leads the department’s advertising and promotions.
Prior to joining the CSU-Pueblo Athletic Department, Niki was an All-American
softball player for the ThunderWolves, leading the team to an all-time best record of 52 wins in 2001. She was also the only CoSIDA Aca-demic All-American in the softball program’s history.
Niki and her wife, Ben, are the parents of three children: Tristan, Kamdyn and Macelyn. The family lives in Pueblo.
TODD KELLYAssociAte Athletic Director athletIc DeVelopMeNt DIrector 8th YeAr As AssociAte A.D. 18th year at csu-pueblo
Todd Kelly is entering his 17th year with the CSU-Pueblo Athletic Department, and his 7th year as Associate Athletic Director for Athletic Development.
Kelly is responsible for identifying and cultivating contributions for CSU-Pueblo athletics from alumni, friends, corporations,
organizations, and foundations. He also handles the department’s sea-son ticket sales, the Spank Blasing Run/Walk, the Lobster Bake, the ThunderWolves Golf Classic, and the corporate and individual giving for the ThunderWolves’ scholarship programs.
Before taking his current post, Kelly worked as the Assistant Commissioner for Media Relations and Championships at the Rocky Mountain Athletic Conference from June, 2001 through July 2003.
From 1991-2001, Kelly served as the ThunderWolves’ Sports In-formation Director. In that role, he received numerous citations from the College Sports Information Directors of America (CoSIDA) for publications. Kelly has staffed many special events, working in media relations. Among those events are the 1995 U.S. Olympic Festival, 1996 NCAA Division I Men’s Basketball Midwest Regional, 1994 & 1998 NCAA Division II Wrestling Championships and the 1994 NCAA Division II Baseball South Central Regional.
In 1990, he received his Bachelor’s in Mass Communications from the University of Southern Colorado. He received his master’s degree in sports administration from the University of Northern Colorado in 2006.
Kelly, and his wife Laura, have two children, Trent and Jillian.
JEREMY CAPOassIstaNt athletIc DIrector coMplIaNce & FacIlItIes 5th year at csu-pueblo
Jeremy Capo is entering his fourth year as Assistant Athletic Director for Compliance and Facilities at CSU-Pueblo.
Capo’s duties include providing oversight over the athletic department as it pertains to NCAA rules and regulations, as well as serving as the chief contact and administra-tor over the CSU-Pueblo athletic facilities,
some of the finest facilities in all of NCAA Division II. Capo, a 2002 graduate of Fort Hays State University, and his wife,
Darcie, who works in the admissions department at CSU-Pueblo, have three children: Ashton, Makenzie and Riley.
ANTHONY SANDSTROMassIstaNt athletIc DIrector MeDIa relatIoNs 5th year at csu-pueblo
Anthony Sandstrom is entering his fifth year as Assistant Athletic Director for Media Relations at CSU-Pueblo.
He is responsible for managing the de-partment’s media relations practices, and is the webmaster of the CSU-Pueblo athletics web site, GoThunderWolves.com.
Sandstrom was the recipient of numer-ous awards, including a 2008 Southern Colorado Press Club “Woolly Award for Media Excellence” for best sports feature, and a 2006 Colorado Press Association award for best feature story. In 2009, he was named the Colorado State University-Pueblo Outstanding Profes-sional Staff Member of the Year.
Sandstrom and his wife, Sarah, are the parents of one child, Hunter.
AMANDA BERRYaDMINIstratIVe assIstaNt 1st year at csu-pueblo
Amanda Berry is entering her first year as the administrative as-sistant for CSU-Pueblo Athletics.
Prior to her arrival with the CSU-Pueblo Department of Athletics, she had worked as an administrative assistant with the CSU-Pueblo Purchasing Department, a post she held both as a student and a pro-fessional from 2007-10.
In addition to her work history as an administrative assistant, she had also coached girls’ high school soccer, serving as an assistant coach at Pueblo West High School from 2007-11.
A 2010 graduate of CSU-Pueblo, she and her husband, Devin, reside in Pueblo West.
BEN LOCASCIOassIstaNt to the a.D./tIcKet MaNaGer 1st year at csu-pueblo
Ben LoCascio is entering his first year as the assistant to the athletic director.
As the assistant to the athletic director, LoCascio is responsible for CSU-Pueblo’s ticketing operations as well as the department’s fleet of vehicles.
Originally a native of Michigan, Locascio had been a teacher in Pueblo School District 60 before joining the CSU-Pueblo Department of Athletics.
93
STRENGTH & ATHLETIC TRAININGROGER CLARKDIrector oF athletIc traINING 10th year at csu-pueblo
Roger Clark is entering his first season as the head trainer for the CSU-Pueblo foot-ball team, but his 10th year at Colorado State University-Pueblo.
Clark is the director of the Athletic Train-ing program at CSU-Pueblo and also runs the athletic training room at the Neta and Eddie DeRose ThunderBowl, which serves all CSU-Pueblo student athletes and serves
as the main athletic training room for the football and women’s track and field programs.
As the director of the CSU-Pueblo Athletic Training Program, he takes a lead role instructing athletic training majors both in the class-room and on the field. Under his tutelage, he assigns trainers to spe-cific sports at CSU-Pueblo and oversees all degree-seeking students.
A graduate of Illinois-Urbana, Clark completed his Masters in Athletic Training from the University of Arizona before earning his Ph.D. in Exercise Physiology/Athletic Training from the University of Pittsburgh.
Dr. Clark’s hobbies are building and flying radio controlled model airplanes, cycling and playing acoustic guitar. He resides in Pueblo.
ALLEN HEDRICKstreNGth & coNDItIoNING coach 3rD year at csu-pueblo
Allen Hedrick, M.A., CSCS*D, FNSCA, Coach Practitioner, was named the first ever Head Strength and Conditioning Coach at Colorado State University - Pueblo in September, 2009. Hedrick is a graduate of California State University - Chico (B.A.) and California State University - Fresno (M.A.). Following graduation from CSU Fresno Hedrick was hired as a strength and
conditioning coach at the United States Olympic Training Center in Colorado Springs, CO. Initially Hedrick was hired as a one year long appointment but that position evolved into a permanent position and Hedrick was moved into that role. After working three years at the Olympic Training Center Hedrick was selected to fill the Assis-tant Strength and Conditioning Coach position at the United States Air Force Academy, also in Colorado Springs. Hedrick stayed in that position for three years before being named the Head Strength and Conditioning Coach at the Academy, a position he held for nine years. In that position Hedrick was personally responsible for the strength and conditioning programs for football and volleyball while oversee-ing the entire strength and conditioning program.
Hedrick then moved to the National Strength and Conditioning As-sociation’s headquarters, also in Colorado Springs, first as the Head Strength and Conditioning Coach position there and then into the Education Department as Education Coordinator. Hedrick stayed in that position until moving into his current position at CSU - Pueblo.
During his career Hedrick has worked with a variety of athletes, from elementary school age athletes to athletes at the professional and Olympic level, including athletes who have medaled in the Olym-pic games (Bonnie Blair, speed skating and Matt Ghaffari, Greco-Ro-man Wrestling). A frequent writer, Hedrick has been published over 100 times in a variety of publications on a variety of topics related to strength and conditioning and has published a book on strength and conditioning for football along with numerous DVD’s on a variety of topics related to strength and conditioning. In addition, Hedrick has spoken at numerous conferences and clinics, both nationally and internationally, including Guatemala, Japan, Australia, and China. In 2003 Hedrick was selected by his peers as the National Strength and Conditioning Association’s Collegiate Strength and Conditioning Coach of the Year. Hedrick and his wife Stephanie reside in Pueblo and have two children (Lindsey and Brandon). In addition to coach-ing Hedrick also competes in the sport of weightlifting and finished third at the National Masters Weightlifting Championships in 2009.
94