twr-stonington-20101110-edition29-re
DESCRIPTION
The Weekly ReviewTRANSCRIPT
-
INSIDE BY THE BAY + WE LOVE IT + AGENTS CHOICE + PROPERT Y LISTINGS
POSTCODE
3186
288 PAGES OF MELBOURNES BEST PROPERTY
7PM: SATURDAYS AUCTION RESULTS ONLINE @ www.theweeklyreview.com.au
WHERE TO LIVE\ IN PARTNERSHIP WITH
COVER STORY\ P52
-
The real estate cover story (right),By The Bay and We love iT property reviews on the following pages have been visited by TWR journalists. agenTs choice and oUT oF ToWn are real-estate promotions provided by the agents unless tagged as written by a TWR journalist.
agents index\Abercrombys 216-222bennison mAckinnon 302-316buxton 188-193cAstrAn Gilbert 83christopher russell 223DAviD rew 121Fletchers 64-83Fmr st kilDA 215Foster & co 120GArvey & co 128GAry peer 128-129Gross wADDell 83hockinG stuArt 320-333JeFFery wilson 316-317Jellis crAiG 240-301kAy & burton 84-120mArshAll white 130-187mclAren 238-239morrell & koren 193noel Jones 224-237philip webb 301rt eDGAr 194-215synerGy 239williAms bAtters 318-319
wooDArDs 122-128
OUt OF tOWn\AquA 338-339bFp rurAl & urbAn 337DAviD rew 333elDers 334hAyDen 336JoAn GlADmAn 334keAtinGs 336pAt rice & hAwkins 334-335scott mccormick 334
+288 pages OF prime real estate
+aUctiOn resUlts Online @
melbOUrnes best prOperty
myrtle Grove, one of Brightons oldest houses, is still one of the suburbs landmark properties.The North Road mansion was built about 1850 when Brighton was a day trip by horse and carriage
from Melbourne. It became a private hospital in the 1920s and then a complex of 11 flats before being bought by real estate agent Glen Morley and his wife, Joan. With the help of master builder Burt Kaye, designer John Coote and landscape designer Paul Bangay, the house has been transformed from a run-down Victorian to an early-colonial-era homestead that has been in the Morley family for more than 25 years. It may be grand, but it is still very much a family home.
When the security gates swing open, you enter a formal garden with a gravel driveway lined with mature trees and clipped box hedges. The drive is designed so that five cars can be parked in it without interrupting access to the garage. The north-facing garden is a stunning mix of tall hedges framing the lawn and raised garden beds planted with a colourful array of flowers, from lavender to irises and acanthuses. A Roman-style swimming pool, surrounded by sandstone paving and
with its own purpose-built cabana, is at the side of the garden.
A path leads from the pool area to the informal living zone, so you can sit at the table in the dining area and look down to the pool and garden. A verandah leads to the front door, which features a Georgian-style fanlight window above it.
The beauty of Myrtle Grove lies in the proportions of the rooms and the way it has been rebuilt to suit modern life. The living room, reached by sliding doors from the hall, has two open fireplaces. Five large Georgian-style windows mean that the room is light and has a view over the garden and to the 18th-century English fountain, a focal point of the superb landscape.
This house is rock solid, built from double (and in some parts triple) brick. The windows are double-glazed so there is no noise from the street. Off the hall, the dining room could grace the pages of a decorating magazine with its pale green walls, open fireplace and massive table.
The spacious hall leads to another sitting room, which has french doors that lead to the large north-east facing al fresco entertainment area and parterre garden.
The serious family living zone begins at the end of the
1850s grandeUr lives Onpostcode
3186
Where tO live\ cOver stOry
www.theweeklyreview.com.au
satUrday 7pm
Where tO live team\eDitoriAl submissionsproperty eDitor \ mAriA [email protected]: 0409 009 766 FrAncescA [email protected]: 0438 562 729
tom [email protected]: 0425 532 092
ADvertisinG inquiriesreAl estAte sAles Director \ John [email protected]: 0418 323 009
-
Its no longer a day trip from the city by horse and carriage, but it is grand and of the times ... with plenty of lovely modern touches, writes MARIA HARRIS.
KAY & BURTON 9592 6522
50 North Road, Brighton
Expressions of interest: closing November 23
Price: $7 million +
Fast facts: Historic, fully rebuilt mansion, grand formal and informal rooms, study, conservatory-style dining area, granite kitchen, Miele appliances, rst- oor lounge, open replaces, marble bathrooms, three en suites, ducted heating, air-conditioning, ducted vacuum, alarm, cellar, sauna, basement gym, double garage.
BRIGHTON12 KILOMETRES SOUTH-EAST OF THE CBD.
Two big names are linked to this beachside suburb Henry Dendy and J. B. Were.
Dendy arrived in 1841 to claim the 20.72 square kilometres of Port Phillip land that he had bought sight unseen. The land, known as Dendys Survey, was bounded by the coastline, North, East Boundary and South roads. Unfortunately, the area did not have any sources of water, land sales were slow and suffered more in the Depression. Eventually the family of Dendys agent, Jonathan Binns Were, bought the land. Dendys business ventures all failed and he died a pauper. The same cannot be said of Were, who went on to found iconic Melbourne stockbroking house JBWere and Co. Were Street in Brighton is named after him, and the original gardeners cottage, which formed part of Weres extensive land holdings, is still a landmark property surrounded by botanic-style gardens. The house at 50 North Road, Brighton was on the boundary of Dendys estate. It was already four or ve years old when Brighton raised its rst rate book in 1859.
By the late 1840s, many stately homes were built on what is now known as The Esplanade and which overlooks the Dendy Street beach.
Brighton continues to attract the rich and famous. A few of its well-known citizens include cricketer Shane Warne, actor Eric Bana, and television identity and North Melbourne Football Club president James Brayshaw.
How this suburb has moved: Down by 4.8 per cent in the year to September 2010. *REIV stats
THE PROPORTIONS, THE GRANDEUR AND THE SETTING MAKE THIS RARE PROPERTY A REAL TROPHY HOME.
STEWART LOPEZ AGENT
5 5 7
hall. e study has deep olive green fabric-covered walls and co-ordinated checked curtains. e wide open-plan kitchen features tiled oors, granite nishes, an island bench plus benches against the walls tted with Miele appliances.
At the end of the room the glazed atrium-style ceiling allows the morning light to ood inside, and through the windows you have the most amazing long view past the parterre to the pool.
A grand house such as this deserves a grand staircase and Myrtle Grove doesnt disappoint. e staircase, lit by an overhead void, sweeps to the rst oor. e magni cent main bedroom is like something from a grand European hotel: muted yellow walls, white ceiling, an open replace and luxurious drapes over the windows. A door opens to the return balcony that mirrors the ground oor verandah. Its luxurious dressing room bigger than the bedrooms of many suburban houses has marble tiled oors, a mirrored marble dressing table and built-in wardrobes. It leads directly to the marble en suite with its bath, dual vanity and oversized shower. Two more large bedrooms each have marble en suites and windows to the balcony. ere is a lounge at the end of the hall and four steps lead to
another two bedrooms and a bathroom on the eastern side of this oor.
In the basement where Brightons infamous Tommy Bent was photographed playing cards there is a shower, sauna and gym.
With glorious gardens, glamorous interiors, plentiful accommodation and vast history, this house on Brightons famous boulevard looks certain to be admired for many years to come. \
-
WHERE TO LIVE\
boxed hedges and other plants. A large tree provides a shady canopy during the summer.
Upstairs are four bedrooms that each have built-in wardrobes and views of the surrounding rooftops. They all open onto a spacious living room, which has been masterfully tailored to suit the needs and requirements of teenage children. The built-in shelves and desk are perfect for school books and computers and the television cabinet is large enough to hold a plasma screen. \
MALVERN EASTOnce an Edwardian, this Malvern East house has been spectacularly renovated and extended, combining modern proportions with classical features. With four living areas and an outdoor terrace, the property clearly lends itself to entertaining.
At the front are the formal living and dining rooms, which have velvet drapes, warm colour palettes and timber detailing. With a large open replace, these rooms are perfect for hosting dinner parties during the colder months. In summer, the open design of the rear living areas allows guests to ow through to the outside spaces seamlessly, creating a sense of relaxation.
The family room connects to the all-timber kitchen. With its European appliances, plenty of cupboards and a wide island bench, the kitchen is perfect for large families. It also has views of the lush, green garden, which has citrus trees,
WE LOVE ITFRANCESCA CARTER goes east ... and nds four opportunities to settle in style and comfort.
POSTCODE
3142POSTCODE
3124
POSTCODE
3145
RT EDGAR, 9826 1000
16 Millicent Avenue
Price: $2 million +
Auction: November 13 at 1pm
JELLIS CRAIG, 9810 5000
3 Gilbert Place
Price: $1.8 million +
Auction: November 13 at 10am
TOORAK CAMBERWELL
With stylish interiors and quality ttings, this house is one that impresses inside and out. Built just eight years ago, everything has been lovingly maintained. At the front of the house, double doors open onto a study, which is drenched in natural light. Opposite is an automatic two-car garage with direct entry from inside. The living and dining room has been oriented to capture the western sunlight and has views of the outside paved courtyard. This room is ideal for entertaining as the extendable glass concertina doors ensure the transition between outdoor and indoor living areas is smooth and free owing. The kitchen is tasteful, with all-white cabinetry and a wide breakfast bar. The highlight of this magni cent house are the two bedrooms at the rear, each with a fully tiled en suite bathroom. Both rooms open onto the back timber deck a lovely setting in which to catch the afternoon sun. \
The strength and character of this house is stated at the outset with clean lines, a landscaped garden, automatic double garage and a muted colour palette. These exterior elements suggest sophistication and a classical in uence, a theme carried on throughout the house. The grand entry opens to a sweeping staircase with split entries leading to four bedrooms and a spacious rumpus room. Each bedroom includes a walk-in wardrobe and fully tiled en suite. The downstairs oor plan has been designed for entertaining. Every room is spacious and elegant and either opens or looks onto outdoor living spaces. On the left is a large undercover patio surrounded by lush gardens. An outdoor spa sets the scene for many summertime parties. Inside, the kitchen is stylish and features Miele appliances, granite benchtops and slick cabinetry providing plenty of storage. It fronts a casual family meals area that captures the light and views of the property. \
2 2 3 4 5 2
BENNISON MACKINNON, 9864 5000
5 Beech Street
Price: $1.6 million $1.8 million
Auction: November 13 at 11.30am
5 3 2
-
HAWTHORNThis immaculately presented Victorian fuses period grace with contemporary living. The front is about as Victorian as they come a double-fronted, tuck-pointed faade with a timber picket fence and decorative cast-iron trimmings. Inside however, is a mix of international interiors.
The in uence has been travel, says owner Sebastian Schwarz, who has spent the past two years renovating the house. We have done a lot of travelling through Europe and Asia and have picked up bits and pieces along the way.
The typically Victorian oor plan has three bedrooms off the central hallway. With original replaces, mocha-coloured carpet and elegant nishes, each room exhibits the type of texture and richness found in the latest interior design magazines. The main bedroom has views of the landscaped front garden and opens to an American oak walk-in wardrobe. This has been designed to give the effect of walking through the forest, before reaching a fully tiled en suite. The en suite has twin vanities, an indoor/outdoor shower, mother-of-pearl splashbacks and pebble features.
The back open-plan living area has been designed to incorporate the outside. With oor-to-ceiling bi-fold glass windows, this has a sensational backdrop of the west-facing garden. The living room has dark timber oorboards and Emporite paintwork ensuring the perfect setting for contemporary furniture and art. The replace creates a warm and inviting atmosphere during winter. The kitchen has slick white cabinetry and Miele appliances. \
POSTCODE
3122
MARSHALL WHITE, 9822 9999
12 Salisbury Grove
Price: $1.5 million +
Auction: November 20 at 10am
3 2 3
SPRINGS rst serious results are in and, as we are clearly in for a late market this year, its worth getting a sense of what is happening and
where the market may be heading. e million dollar-plus markets of
Boroondara, Stonnington and Bayside are Melbournes three jewels, and what happens in them and in turn, what happens in the key suburbs of Hawthorn, Brighton and Toorak determine what happens in Melbournes top-end real estate overall.
To summarise the character of each of these areas: Bayside is in many cases new money and a bit out there, Stonnington is old money and a bit conservative, while Boroondara is the up market family barometer.
So whats been happening in each area?
Boroondara: Big tick. Even with large stock numbers, weve seen very solid clearance rates of about 70 per cent. Hawthorn, Canterbury, Camberwell and Kew are continuing to be the bluest of blue chips and for one very good reason: schools. All investors in these areas should be
paying homage to the founders of MLC, Camberwell Grammar, Carey and Scotch as these have been the areas true long-term wealth creators, with demand coming not just from Melbourne families but also from overseas and expats looking for the best education for their children. is is an area of young families with strong future earning potential and a fair bit of disposable income. Result a strong and increasing market.
Stonnington: On the biggest auction weekend since March 2008, this market had a less than 50 per cent clearance rate, with many good properties having no bidders at all. On super Saturday weekend, we went to nine auctions of nine good houses, and saw nine pass-ins, with just two bidders in total. How can this be? East Malverns Gascoigne Estate has not become any less popular than Kews Sackville Ward overnight. Armadale still has the shops, schools and transport just like Hawthorn.
Our theory is that the Stonnington market is one of the most mistrusted in Melbourne. Many buyers are as sceptical about entering it as they are about jumping into the Queensland investor market. A
lot of that is to do with the step quoting tactics of the key agencies, where the quote keeps rising at each step of the process. So that, from an initial over-the-phone quote of, say, $1.8 million, it might rise to $2 million at the open-for-inspection stage, while the opening vendor bid at the auction may be $2.2 million and nally the property passes in on a reserve of $2.4 million.
is strategy may work a treat in a very strong market but it quickly loses its shine in a faltering one. When buyers see auction a er auction pass in on the back of inaccurate quote a er inaccurate quote, theyre likely to keep their hands rmly in their pockets. Its a questionable practice that is not doing vendors any favours either, when good houses are being ignored by disillusioned buyers.
Bayside: We love stats, but sometimes you have to dig deeper into them. e clearance rates at auctions have not been stellar in Bayside lately about 50 per cent since May. But we think this gure is being dragged down by the high number of pass-ins of low-quality stock in lower Bayside in particular houses that are not well built, on tight blocks or kilometres from amenities. Bayside also has some overhang (unsolds) from earlier in the year, and as more stock comes onto the market, buyers are more circumspect than in more buoyant times. With smaller numbers bidding at auction, the market is consequently limping along. But on good houses with prices at market levels, the deals are still happening, making the Bayside good home clearance rate well above 50 per cent.
Which is the general message for the whole top-end market: theres plenty of demand out there for fairly priced, good houses in sought-a er areas.
BIG FOUR SUBURBS A GOOD MARKET BAROMETER
MAL JAMESPrincipal Buyer Advocate
0408 107 988 \ 9804 3133WE ONLY BUY HOMES
www.james.net.au
MILLION DOLLAR-PLUS MARKETS ... DETERMINE WHAT HAPPENS IN MELBOURNES TOP-END
-
WHERE TO LIVE\
ornate ceilings, elaborate cornices and magni cent marble mantelpieces.
Formal areas include a living room, billiards room and dining room. Unlike many period houses, this is lled with natural light thanks to large windows.
The sparkling informal kitchen and meals zone is a showcase of the latest designer nishes and features, from the stone-topped benches to the large walk-in pantry and the best European appliances. The kitchen/meals area opens to a north-facing courtyard and also extends to the informal living area.
Upstairs there are up to six bedrooms and three exquisite en suite bathrooms. Balconies and wrap-around terraces have views through the plane trees to St Kilda Road and help make Airlie Mansion one of the jewels in Melbournes real-estate crown. \
MELBOURNEOne of the last remaining Victorian mansions on St Kilda Road is up for sale after an extensive renovation and refurbishment.
Airlie Mansion, with six bedrooms, three bathrooms and lavish entertaining rooms, is being touted as a luxurious house or an ambassadorial residence. Either way, the buyers will have the most gracious and meticulously restored property, with all renovations supervised by Heritage Victoria.
Built circa 1891, Airlie Mansion, on the north-west corner of Arthur Street, was the childhood home of Australias eighth Prime Minister, Stanley Melbourne Bruce, who served from 1923 to 1929 and attended Melbourne Grammar in Domain Road while living at Airlie Mansion.
Like many of the mansions that once lined Melbournes grandest residential boulevard, Airlie Mansion went from private home to genteel boarding house before becoming an administrative and of ce building.
Today, the mansions elegant contemporary features and interiors are in harmony with its renaissance revival and Italianate architecture.
Intricate period details include the tessellated-tiled verandah, mosaic-tiled entry hall, stained-glass windows, grand staircase,
MARIA HARRIS discovers one of the jewels in Melbournes real estate crown.
POSTCODE
3004KAY & BURTON, 9820 1111452 St Kilda Road
Price: $8 million +
Expressions of interest: close November 18
4 3 6
-
second oor, double doors open to a central hallway with rooms on either side. The rst on the left is an elegant library that has French provincial-style cabinetry and a Juliette balcony. Next to the library is the main bedroom, which has a spacious en suite and a double-sided walk-in wardrobe. With twin vanities and white tiles, the en suite has a real zen and spa-like quality.
On the other side of the hallway are two
BRIGHTONThis luxurious penthouse has been architecturally designed to encompass space and light with a clear focus on quality. The faade consists of wide arches, solid square pillars and tall French windows. The classical theme continues inside as a marble foyer opens to a spiralling staircase and a lift. On the
POSTCODE
3184POSTCODE
3186
POSTCODE
3186
BENNISON MACKINNON, 9694 5000
18 Addison Street
Price: $1.25 million $1.35 million
Auction: November 13 at 12.30pm
KAY & BURTON, 9592 6522
35 Cole Street
Price: $3.3 million +
Auction: November 13 at 11am
ELWOOD BRIGHTON
Through a high brick fence you will nd an elegantly renovated, semi-detached Edwardian residence in a neat garden with box hedges. Upon entry, you notice the attention to detail, as the owner has carried out renovations as a labour of love. Traditional features remain, such as polished oorboards, lead-lighting, and bedrooms off the hallway. All bedrooms have built-in wardrobes, and the main and second bedrooms have ornate replaces. The new central bathroom is light, with a travertine-tiled bath, porcelain tiles underfoot, a vanity with storage and glass shower. The family room continues into the new kitchen, with stainless steel appliances and CaesarStone benchtops. Theres also a European laundry. The open-plan kitchen and meals area opens to a substantial paved garden and undercover parking. With built-in cupboards, lighting, this is a great entertaining space, or it can simply be used as a garage with right-of-way access. \ MICHELLE OSTROW ZUKERMAN
This graceful Edwardian provides myriad options with either shared accommodation or the opportunity to create your own home. Only a few cosmetic changes would bring it back to its former glory, as already in place are Baltic oorboards, high ceilings and other original hallmarks. A common hallway divides two separate living quarters. The rst is to the left, with a bedroom, including built-in wardrobe, a second bedroom, modern kitchen and meals area, and the original art deco bathroom. On the ip side, a lockable door divides the rest of the house with its large character- lled dining, living and family rooms. Another bedroom or study, modern kitchen and bathroom with laundry facilities, open onto a sail-covered patio. Also attached to the house is a granny at and a separate brick double garage, currently used as a studio, with workshop and storeroom. This property is just steps to the beach, while shops and private schools are within walking distance. \ MICHELLE OSTROW ZUKERMAN
3 1 2 4 2 2
BUXTON, 95928000
4/9 Glyndon Avenue
Price: $3.3 million $3.5 million
Auction: November 20 at 12.30pm
3 3 3
WHERE TO LIVE\
BY THE BAYevenly sized bedrooms with built-in wardrobes and tiled en suites. The spacious living and dining area is tted with textured interiors such as parquetry oorboards and white cabinetry. French doors open to a landscaped terrace that serves as a private and sheltered meals area during summer.
The kitchen has all-white cabinetry and white countertops providing a chic and sophisticated look to the space. It also has a horizontal
window providing light and a sense of space.One of the bene ts of living at the top of an
apartment complex is the spectacular views, and this penthouse is no exception. From the rooftop terrace, there are 360-degree views that include the swells of Port Phillip Bay and the lights of the city. The space is also tted with a built-in barbecue, speakers, TV access and an automatic dumb waiter from the kitchen. \ FRANCESCA CARTEER
-
WHERE TO LIVE\ AGENTS CHOICE
Bennison Mackinnon 9864 5000
This beautifully bright, fully-renovated two-bedroom Victorian features large living/dining areas beneath cathedral ceilings close to Hawksburn Village.
2 1
Let's eat lunch @Cafe Latte, 521 Malvern RoadLet's eat dinner @ Lemnos Tavern, 445 High Street Let's drink coffee @Spoonful, 543 High Street
64 Pridham Street, Prahran
Price: $760,000 - $830,000
Auction Saturday November 27 at 12.30pm
3181POSTCODE
.................................................................
.................................................................
.................................................................
Marshall White9822 9999
Enjoy the superb ambience of this impeccably presented double-fronted Victorian residence c1890. It has been renovated to preserve its decorative period features and provide light-filled living spaces geared to a contemporary lifestyle.
4 2 2
Let's eat lunch @Osso, 80 Burwood RoadLet's eat dinner @ Barkers Wine Bar, 84 Barkers RoadLet's drink coffee @Liar Liar, 90 Kinkora Road
4 Oak Street, Hawthorn
Price: $1.6 million +
Auction Saturday November 13 at 10.30am
3122POSTCODE
.................................................................
.................................................................
.................................................................
Jellis Craig Hawthorn9810 5000
Brilliantly designed to encapsulate the essence of contemporary luxury, this stunning Edwardian house offers an indulgent family lifestyle with substantial space, exemplary quality and superb salt waterfall pool amidst a lush garden oasis.
4 3 3
Let's eat lunch @The Maling Room, 206 Canterbury RoadLet's eat dinner @ Blue River Thai, 239 Canterbury RoadLet's drink coffee @Cafe 88, 88 Maling Road
35 Logan Street, Canterbury
Price: $2.8 million +
Auction Saturday November 27 at 2pm
3126POSTCODE
.................................................................
.................................................................
.................................................................
Fletchers Kew9817 6551
This beautifully updated first-floor apartment with lovely views features floating timber floors, a new fully-equipped kitchen, renovated bathroom with twin vanities and intercom security entrance. Located near Kew Junction.
2 1 1
Let's eat lunch @QPO, 186 High StreetLet's eat dinner @ Milan @ Kew, 44 Cotham RoadLet's drink coffee @Fred Young of Kew, 204 High Street
6/94 Princess Street, Kew
Price: $480,000 - $525,000
Auction Saturday November 13 at 2pm
3101POSTCODE
.................................................................
.................................................................
.................................................................
Jellis Craig Balwyn9831 2800
Making an inspiring statement in architectural brilliance in a prime location close to Kew Junction, transport and freeway, this award-winning John Wardle house showcases a streamlined contemporary design.
3 2 2
Let's eat lunch @Snow Pony, 95 Whitehorse RoadLet's eat dinner @ Mabrown, 190 Belmore RoadLet's drink coffee @All About Coffee, 335 Whitehorse Road
123 Pakington Street, Kew
Price: $1.2 million +
Auction Saturday November 27 at 1pm
3101POSTCODE
.................................................................
.................................................................
.................................................................
POSTCODE
3125
NOEL JONES, 9809 2000
44 Somers Street, Burwood
Price: $900,000 +
Auction: November 13 at 2pm
BURWOOD
This charismatic two-storey house is hidden behind a ourishing front garden. Spacious living and family areas as well as three large bedrooms generate a comfortable family residence. Floor-to-ceiling windows from the family area allow uninterrupted views over a sizeable pool area, also featuring a pleasant undercover area for those scorching summers. The kitchen, which has pool views, is roomy and features modern appliances. It is raised above the family area to create a delightful communal atmosphere. A study and powder room are below the stairs, which lead up to the three bedrooms and a modernised bathroom with lovely blue tiling. Abundant in natural light, the main bedroom has a large private balcony overlooking the pool, wide windows, a walk-in wardrobe and en suite with his and hers basins. A large carport plus a double garage provides parking. Within close proximity to Burwood Village, Wattle Park and Presbyterian Ladies College this is an appealing property. \ TOM HYWOOD
3 3 2
Kay & Burton South Yarra9820 1111
Housed in a landmark architectural masterpiece by Nonda Katsalidis, this executive apartment features substantial open-plan living, immaculate finishes, resort-style facilities and panoramic city views.
3 2 1
Let's eat lunch @Cumulus Inc., 45 Flinders LaneLet's eat dinner @ Grossi Florentino, 80 Bourke StreetLet's drink coffee @Stassi Caf, 350 Queen Street
203/299 Queen Street, Melbourne
Price: $1.3 million +
Auction Saturday November 13 at 11am
3000POSTCODE
.................................................................
.................................................................
.................................................................
-
Hocking Stuart Hawthorn9944 3888
Character and modern lifestyle combined. Featuring spacious rooms, leadlight-style glass, a fireplace in the living room, marble en suite in the main bedroom, black granite in the kitchen. Garage and barbeque in rear courtyard.
3 2.5 2
Let's eat lunch @Magic City, 871 Burke RoadLet's eat dinner @ Choi's, 186 Riversdale RoadLet's drink coffee @Porgie & Mr Jones 291 Auburn Road
3A Campbell Grove, Hawthorn East
Price: $1 million - $1.08 million
Auction Saturday December 4 at 11.30am
3123POSTCODE
.................................................................
.................................................................
.................................................................
Marshall White9822 9999
Exclusively situated in an elite leafy cul-de-sac, this architect-designed residence successfully blends striking designer style and brilliant light-filled functionality, inside and out, which has resulted in an exceptional contemporary domain.
3 3 2
Let's eat lunch @Spoonful, 543 High StreetLet's eat dinner @ The Orchard, 24 Beatty AvenueLet's drink coffee @Sardine, 15 Morey Street
1B Barnato Grove, Armadale
Price: $1.5 million +
Auction Saturday November 27 at 9.30am
3143POSTCODE
.................................................................
.................................................................
.................................................................
POSTCODE
3104
FLETCHERS, 9859 9561
37A Viewhill Road
Price: $1.05 million $1.15 million
Auction: November 13 at 2pm
BALWYN NORTH
This elevated, split-level house has stunningly stylish interiors and all the features that create a luxurious lifestyle. Windows allowing street views and plenty of natural light surround the living area, which extends back into the dining room and into the kitchen. Complete with generous granite bench-tops, modern appliances and accessible drawers and cupboards, the kitchen is of the highest quality. All three bedrooms are at the rear of the property, as is the spacious family bathroom that has dual basins and a divine spa bath. The main bedroom has views onto the pool and spa out of oor-to-ceiling windows, as well as an en suite and walk-in wardrobe. The courtyard is sizable, continues around to the pool and is undercover. A laundry and fourth bedroom/study are also on the bottom oor. With extras including ducted heating, split-system cooling and a remote-control garage, and a location near Balwyn High School, this house is well worth an inspection. \ TOM HYWOOD
4 2 2
SEARCH & WIN 1 of 8 $1000 Prizes
* Terms and conditions apply. For more information visit www.realestateview.com.au/search&win/terms
The best location in town to search for property is realestateVIEW.com.au. With hundreds of thousands of properties listed online and easy to use search features, realestateVIEW.com.au can make finding your ideal property a breeze.
Visit realestateVIEW.com.au before the 12th of November and you could win one of 8 $1000 Bunnings vouchers.*
For your chance to win, log on to www.realestateVIEW.com.au/search&win
-
WHERE TO LIVE\ AGENTS CHOICE
Jellis Craig Hawthorn9810 5000
An enchanting Edwardian brimming with warm character and occupying a large allotment with exciting scope for renovation/extension, complements a highly-coveted location near Maling Road Village and Riversdale Park.
3 1 1
Let's eat lunch @Cafe Eden, 78 Maling RoadLet's eat dinner @ Riversdale Thai, 655 Riversdale RoadLet's drink coffee @Brunetti, 1/3 Prospect Hill Road
25 Spencer Road, Camberwell
Price: $1.4 million +
Auction Saturday November 20 at 11am
3124POSTCODE
.................................................................
.................................................................
.................................................................
Marshall White9822 9999
A beautiful garden setting complements this superbly presented and extended traditional Californian bungalow combining period character and modern comforts creating the perfect family living and entertaining environment.
4 2 2
Let's eat lunch @Glen Iris Milk Bar, 106 Glen Iris RoadLet's eat dinner @ Perrins Restaurant, 32 High StreetLet's drink coffee @Third Earth Caf, 1461 Malvern Road
17 Walerna Road, Glen Iris
Price: $1.4 million +
Auction Saturday November 13 at 10.30am
3146POSTCODE
.................................................................
.................................................................
.................................................................
Kay & Burton Brighton9592 6522
Offering luxurious yet low-maintenance living, this impeccably presented house features elegant living spaces alongside a spectacular Miele kitchen, cinema, cellar and glass-fenced pool.
4 3 5
Let's eat lunch @The Pantry, 1 Church StreetLet's eat dinner @ Caf Florentine, 22 Church StreetLet's drink coffee @Laurent, 71 Church Street
2B Rothesay Avenue, Brighton
Price: $2.85 million +
EOI closing November 15 at 5pm
3186POSTCODE
.................................................................
.................................................................
.................................................................
Noel Jones Kew9817 4535
Within minutes of the buzz of High Street and the serenity of the Yarra River, this superbly positioned double-storey townhouse apartment offers bright, easy living over two levels.
2 1 1
Let's eat lunch @Boulevard Restaurant, 121 Studley Park RdLet's eat dinner @ Studley Park Boathouse, Boathouse RdLet's drink coffee @Studio Movida, 138 Cotham Rd
2/2 Fenwick Street, Kew
Price: $590,000 - $640,000
Auction Saturday November 20 at 11am
3101POSTCODE
.................................................................
.................................................................
.................................................................
Jellis Craig Glen Iris9809 8999
This attractive Edwardian residence has been meticulously renovated and extended to showcase its impressive period beauty. There is a large private al fresco garden terrace and mod-grass rear garden.
5 3 2
Let's eat lunch @Red Mullett Fishcaf, 210 Glenferrie RoadLet's eat dinner @ Assaggi, 99 Glenferrie RoadLet's drink coffee @Giorgios, 1235 High Street
116 Stanhope Street, Malvern
Price: $2.8 million +
Auction Saturday November 20 at 11am
3144POSTCODE
.................................................................
.................................................................
.................................................................
RT Edgar Toorak9826 1000
This landmark building in the famous St Kilda Road boulevard is minutes to the CBD and Botanical Gardens, offers stunning views over the city, has an extremely large surrounding outdoor entertainment terrace and superb open-plan living.
3 2 2
Let's eat lunch @Belgium Beer Cafe, 557 St Kilda RoadLet's eat dinner @ Windows Restaurant, 65 Queens RoadLet's drink coffee @Il Locale, 582 St Kilda Road
915/250 St Kilda Road, Melbourne
Price: $2.5 million - $2.75 million
EOI closing Friday 3 December
3000POSTCODE
.................................................................
.................................................................
.................................................................
POSTCODE
3123
HOCKING STUART, 9944 3888
3 Buley Street
Price: $3.65 million +
Auction: November 13 at 12.30pm
HAWTHORN EAST
The exterior of this executive residence is 21st century, yet unassuming. At 62 squares, the vastness is breathtaking. The entry hall gives an uninterrupted view to the back of the house. Off the entry is a study, access to the garage and a powder room. The lounge has an open replace with a step down into a dining room, with a designer bar. Double doors open onto a large outdoor terrace with barbecue, low-maintenance gardens and lap pool. The kitchen includes stainless steel Miele appliances, a walk-in pantry and island bench. Further along is a bathroom and theatre room with retractable cinema screen. Upstairs is a retreat with built-in cupboards, while the main bedroom has stunning views, a walk-in wardrobe and en suite with spa bath, double vanity, shower and toilet. One of the four other bedrooms also has an en suite and two others share a balcony and bathroom. Bialek College, Hawthorn Secondary College and Tooronga Village Shopping Centre are nearby. \ MICHELLE OSTROW ZUKERMAN
5 4 2
-
Woodards Hawthorn9818 3456
Tastefully renovated with a wealth of period features throughout, this two-bedroom house has a lovely welcoming, comfortable feel about it complemented by an expansive wonderland rear garden.
2 1 2
Let's eat lunch @Cafe Baba, 311 Waverley RoadLet's eat dinner @ L'Olivo, 171 Waverley RoadLet's drink coffee @Servery & Spoon, 137-139 Waverley Road
34 Sydare Avenue, Malvern East
Price: $680,000 +
Auction Saturday November 27 at noon
3145POSTCODE
.................................................................
.................................................................
.................................................................
Marshall White9822 9999
Only recently completed, this totally captivating single-level luxury residence has been completely rebuilt to the original Wayne Gillespie specifications in a secluded cul-de-sac walking distance to High Street and Orrong Park.
3 2 2
Let's eat lunch @The Orchard, 24 Beatty AvenueLet's eat dinner @ Vin Cellar, 212 High StreetLet's drink coffee @Spoonful, 543 High Street
10a Pickford Street, Prahran East
Price: $1 million +
Auction Saturday November 20 at 11.30am
3181POSTCODE
.................................................................
.................................................................
.................................................................
POSTCODE
3103
JEFFREY WILSON, 9819 9999
142 Winmalee Road
Price: $3 million $3.3 million
Auction: November 20 at 1pm
BALWYN
Renovations give this elevated 1930s house eclectic appeal. A recent addition is the atrium-like entry, leading to a guest room with en suite. The formal living room, dining room and study are traditional, while the contemporary kitchen has African slate underfoot, stainless steel appliances and granite benchtops. The adjoining open-plan meals and family room has an air conditioner and access outdoors. Central stairs lead up to the main bedroom with lounge area, a walk-in wardrobe plus an en suite. There are three other bedrooms with built-in wardrobes. One has a replace; two have built-in desks. They share a period-style bathroom. Outside, a laundry has an art deco shower and separate toilet. And theres a double garage with access to a rumpus room. Outside there is a solar-heated salt-water pool and a grass tennis court and gazebo. \ MICHELLE OSTROW ZUKERMAN
5 4 3
SEARCH & WIN 1 of 8 $1000 Prizes
* Terms and conditions apply. For more information visit www.realestateview.com.au/search&win/terms
Whether you are renting or buying realestateVIEW.com.au takes the hard work and hassle out of finding your dream home. With hundreds of thousands of properties listed online and easy to use search features, its no wonder more and more Australians are turning to realestateVIEW.com.au to search for property.
Visit realestateVIEW.com.au before the 12th of November and you could win one of 8 $1000 Bunnings vouchers.*
For your chance to win, log on to www.realestateVIEW.com.au/search&win
-
WHERE TO LIVE\ PROPERTY LISTINGS
ADDRESS AGENT PAGE
ALBERT PARK56 Victoria Ave RT Edgar 211
ANGLESEA24A Melba Pde Hayden 336
ARMADALE1B Barnato Gve Marshall White 138806 Malvern Rd Abercrombys 21612 Munro St Abercrombys 2172/17 Inverness Ave Jellis Craig 24622 Rose St Bennison Mackinnon 3022/48 New St Jeffrey Wilson 3164/15 Wattletree Rd Williams Batters 3195/13 Denbigh Rd Hocking Stuart 3288/23 Kooyong Rd Hocking Stuart 328
ASHBURTON59 St Georges Cres Marshall White 1791/10 Johnston St Noel Jones 23223 Donald St Jellis Craig 28021 Boyle St Jellis Craig 298
ASHWOOD13 Ashwood Dve Marshall White 1801 Kennett St Noel Jones 23213 Reid St Noel Jones 2337 Tooronga Crt Noel Jones 23344 George St Hocking Stuart 329
BALACLAVA48 Grosvenor St Bennison Mackinnon 308
BALWYN2 Barnsbury Rd Fletchers 64145 Gordon St Fletchers 682/89 Balwyn Rd Fletchers 7876 Belmore Rd Fletchers 7818 Kenilworth St Fletchers 8052A Banool Rd Fletchers 8110 Hertford Cres Marshall White 17030 Gordon St Marshall White 17133 Hardwicke St Marshall White 17230 Raynes St Marshall White 18612 Knutsford St Abercrombys 221337 Union Rd Noel Jones 226210 Belmore Rd Jellis Craig 25021 King St Jellis Craig 2513 Millah Rd Jellis Craig 25216 Percy St Jellis Craig 25633 Yongala St Jellis Craig 2572 Austin St Jellis Craig 2801/8-10 Kalimna St Jellis Craig 2817 Lydia Crt Jellis Craig 28228 Narrak Rd Jellis Craig 2842/1 Westminster St Jellis Craig 299142 Winmalee Rd Jeffrey Wilson 3176 Ropley Ave Hocking Stuart 32217 May St Hocking Stuart 3252/2a Parring Rd Hocking Stuart 32958 Narrak Rd Hocking Stuart 329
BALWYN NORTH5 Millicent Ave Fletchers 6725 Stephens St Fletchers 6937A Viewhill Rd Fletchers 7431 The Blvd Fletchers 7610 The Blvd Fletchers 7734 Sylvander St Fletchers 801 Hillview Rd Fletchers 8275 Hill Rd Woodards 126326 Balwyn Rd Marshall White 17323 Ferdinand Ave Marshall White 187301 Balwyn Rd Marshall White 18731 Hood St Noel Jones 22619 Sweyn St Noel Jones 2337/1078 Burke Rd Noel Jones 23347 Yeneda St Noel Jones 2342A Buchanan Ave Jellis Craig 25343 Dempster Ave Jellis Craig 25422 Maylands Ave Jellis Craig 25553 Bulleen Rd Jellis Craig 28211a Millicent Ave Jellis Craig 28318 Rookwood St Jellis Craig 2832/34 Kenny St Jellis Craig 2981 View Point Rd Hocking Stuart 323
BARWON HEADS3 Flinders Pde Fletchers 70
BLACK ROCK21 Arranmore Ave Hocking Stuart 324
BLACKBURN34 Wolseley Cres Woodards 1255 Larch St Noel Jones 234
BLACKBURN NORTH43 Caroline Cres Fletchers 83
BLACKBURN SOUTH23 Dundee St Fletchers 721 and 2 / 168 Holland Rd Foster & Co 120
BLACKWOOD1 Prayer Hill Ln RT Edgar 214
BLAIRGOWRIE17 Moonah Ave Kay & Burton 1162939 Point Nepean Rd Kay & Burton 120
BOX HILL62 Margaret St Fletchers 77
BOX HILL NORTH3/2 Mersey St Jellis Craig 284
BOX HILL SOUTH18 Roberts Ave Woodards 12611 Surrey St Jellis Craig 285
BRIGHT16 Prices Rd Kay & Burton 115
BRIGHTON1 Bay St Kay & Burton 9950 North Rd Kay & Burton 10070 Roslyn St Kay & Burton 1012B Rothesay Ave Kay & Burton 1023/17 Well St Kay & Burton 10356 Cochrane St Kay & Burton 1154/9 Glyndon Ave Buxton 1892&3/23 St Ninians Rd Buxton 1913 Maroona Rd Buxton 1914/15-17 Bent St Buxton 1915 Lawrence St Buxton 1911/188 The Esplanade Buxton 19216 Thomson St Buxton 192
BULLEEN7 Ilma Crt Jellis Craig 258
BURWOOD44 Somers St Noel Jones 227112 Roslyn St Jellis Craig 2999 Sunhill Ave Jellis Craig 29935 Mcintyre St Hocking Stuart 329
CAMBERWELL66 Hunter Rd Fletchers 7915 Webster St Garvey & Co 128937 Toorak Rd Marshall White 1637 Netherway St Marshall White 16410 Moorhouse St Marshall White 16537 Bringa Ave Marshall White 16618 Immarna St Marshall White 1834 East Crt Marshall White 18451 Cooloongatta Rd Marshall White 18446 Cooloongatta Rd Noel Jones 22512 Green St Noel Jones 22711 Matlock St Noel Jones 228133 Through Rd Noel Jones 22812A Aisbett Ave Noel Jones 2344/9 Acheron Ave Noel Jones 2341 Beech St Noel Jones 2352 30 Regent St Noel Jones 23521 BRdway Jellis Craig 25927 Currajong Ave Jellis Craig 26037 Fair eld Ave Jellis Craig 2613 Gilbert Pde Jellis Craig 26225 Spencer Rd Jellis Craig 26315 Marlborough Ave Jellis Craig 2853 Merton St Jellis Craig 286
CANTERBURY40 Monomeath Ave Kay & Burton 94176 Mont Albert Rd Marshall White 15923 Myrtle Rd Marshall White 1604 Snowden Plc Marshall White 16127 Wattle Valley Rd Marshall White 16235 Logan St Jellis Craig 26440 Matlock St Jellis Craig 2659 Dorothea St Jellis Craig 2861/45 Canterbury Rd Jellis Craig 29934 Maling Rd Hocking Stuart 32034 Maling Rd Hocking Stuart 3213/124 Canterbury Rd Hocking Stuart 330
CARNEGIE26 Leamington Cres Woodards 128
CAULFIELD15 Edinburgh Ave Gary Peer 129
CAULFIELD EAST1/14 Queen St RT Edgar 210
CAULFIELD NORTH1/13 Crotonhurst Ave Gary Peer 12820 Bambra Rd Marshall White 149
CAULFIELD SOUTH440 Kooyong Rd TBM 127
CHADSTONE2/32 Melinga Cres Noel Jones 235
CLEMATIS4 Ogilvy Rd RT Edgar 215
DROMANA135 Wallaces Rd Kay & Burton 118
EAST MELBOURNEPenthouse 3/150 Clarendon St Kay & Burton 96105 George St RT Edgar 1991712/80 Clarendon St RT Edgar 213403/150 Clarendon St Abercrombys 222
ELSTERNWICK1/34-44 Regent St Gary Peer 12921a Riddell Pde Bennison Mackinnon 315
ELWOOD7/210 Tennyson St Kay & Burton 11416a Dickens St Buxton 192384-386 Barkly St RT Edgar 2113/30A Ormond Rd RT Edgar 21378 Dickens St FMR St Kilda 215
FINGAL355-357 Truemans Rd Bennison Mackinnon 314
FLINDERS29 Bass St Kay & Burton 1172C Panton Rd Kay & Burton 117
FRANKSTON SOUTH26 Bembridge Ave David Rew 121
GLEN IRIS16 Sherwood St TBM 124
4 Flowerdale Rd Woodards 12717 Walerna Rd Marshall White 15010 Dillon Gve Marshall White 15131 Dorrington Ave Marshall White 1522A Saxby Rd Marshall White 1788 Goodwin St Marshall White 17821 Cloverdale Rd Marshall White 179112 Summerhill Rd Christopher Russell 2231 Dent St Noel Jones 22966 Gardiner Pde Noel Jones 2292/23 Gardiner Pde Noel Jones 2356/36-38 Osborne Ave Noel Jones 2362 Martin Cres Jellis Craig 24721 Wilson St Jellis Craig 24847 Ferndale Rd Jellis Craig 26651 Valley Pde Jellis Craig 2672/45 Osborne Ave Jellis Craig 28722 Cusdin St Jellis Craig 2871a Southland St Jellis Craig 28820 Saxby Rd Jellis Craig 2882 Dorrington Ave Bennison Mackinnon 30335 Ranfurlie Cres Bennison Mackinnon 3045 Wilson St Bennison Mackinnon 30836 Erica Ave Bennison Mackinnon 309
GLENBURN820 Break ODay Rd Philip Webb 301
GNARWARRE40 Gnarwarre Rd Kay & Burton 104
HAWTHORN13 Manningtree Rd Fletchers 666 Melville St Fletchers 7133/177 Power St Fletchers 82115 Church St Gross Waddell 835 Yarra St Marshall White 130130 Church St Marshall White 15326 Elphin Gve Marshall White 15412 Salisbury Gve Marshall White 1554 Oak St Marshall White 15625 Manningtree Rd Marshall White 18012 Coppin Gve RT Edgar 19412 Coppin Gve RT Edgar 19515 Hambledon Rd Jellis Craig 26913 Henry St Jellis Craig 27019 Morang Rd Jellis Craig 27136 Swinburne Ave Jellis Craig 2724/150 Barkers Rd Jellis Craig 28954 Elgin St Jellis Craig 2903/15 Lisson Gve Jellis Craig 2914/1 Muir St Jellis Craig 29130/8 Wallen Rd Jellis Craig 29223/17-25 Yarra St Jellis Craig 300353 Auburn Rd Hocking Stuart 32521 Edward St Hocking Stuart 3261/6-10 Wyuna Ave Hocking Stuart 330
HAWTHORN EAST21 Caroline St Fletchers 824/11 Auburn Gve Woodards 1271 Anderson Rd Marshall White 15733 Invermay Gve Marshall White 1814 Tourello Ave Marshall White 1815 Oberon Ave Jellis Craig 2681 Kemsley Crt Jellis Craig 28920 Stewart St Jellis Craig 290320 Riversdale Rd Hocking Stuart 330536 Tooronga Rd Hocking Stuart 330
HEATH HILL65 Cameron Rd Pat Rice & Hawkins 335
HESKET29 Falls Rd RT Edgar 208
IVANHOE9 Nyorie Crt Jellis Craig 273
KERRIE131 Shannons Ln Keatings 336
KEW1/72 Harp Rd Fletchers 811179 Burke Rd Marshall White 18231 Gladstone St Marshall White 18249A Walpole St Marshall White 1831161 Burke Christopher Russell 223170 Princess St Noel Jones 230
2/2 Fenwick St Noel Jones 2362/44 Grandview Terrace Noel Jones 2366/60 Princess St McLaren 2382/18 Ross eld Ave McLaren 23920 Barrington Ave Jellis Craig 2407 Eamon Crt Jellis Craig 2424 Downton Gve Jellis Craig 27422A Fellows St Jellis Craig 275123 Pakington St Jellis Craig 27628 Stevenson St Jellis Craig 2771A Kellett Gve Jellis Craig 2935/69-73 Earl St Jellis Craig 29313/57 Parkhill Rd Jellis Craig 2946/41 Parkhill Rd Jellis Craig 29416/36-38 Disraeli St Jellis Craig 3004 & 7/377 Barkers Rd Bennison Mackinnon 3056 Stirling St Bennison Mackinnon 31514/912 Glenferrie Rd Hocking Stuart 3313/12 Edward St Hocking Stuart 331
KEW EAST54 Elm Gve Fletchers 731479 Burke Rd Fletchers 752/58 Hartwood St Fletchers 832 Bennett Pde Woodards 1278 Walbundry Dve Marshall White 15845 White Ave Noel Jones 236123 Kilby Rd Jellis Craig 292
KOOYONG8 Mernda Rd Kay & Burton 958 Avenel Rd Marshall White 139
LITTLE RIVER325 Branch Rd Kay & Burton 116
MALVERN33 Wheatland Rd Fletchers 7946 Somers Ave Kay & Burton 931 Wilks Ave Marshall White 1406 McKinley Ave Marshall White 1411/52 Glendearg Gve Marshall White 1748 Milton Pde Marshall White 1751C Embling Rd RT Edgar 209116 Stanhope St Jellis Craig 24465 Wheatland Rd Jellis Craig 24999 Stanhope St Bennison Mackinnon 30615 Soudan St Bennison Mackinnon 3071 Lara St Bennison Mackinnon 309
MALVERN EAST34 Sydare Ave Woodards 12344 Darling Rd Marshall White 14212 Deakin St Marshall White 14328 Sycamore St Marshall White 17524 Wilmot St Noel Jones 23011 Mount eld Ave Noel Jones 23749 Webster St Jellis Craig 2955 Beech St Bennison Mackinnon 31067 Karma Ave Bennison Mackinnon 3101/316 Wattletree Rd Bennison Mackinnon 3118 Moama Rd Bennison Mackinnon 311
MELBOURNE452 St Kilda Rd Kay & Burton 97203/299 Queen St Kay & Burton 113505/26 Queens Rd Kay & Burton 1191002/430 St Kilda Rd TBM 122505 St Kilda Rd Marshall White 144502/401 St Kilda Rd Marshall White 145301/401 St Kilda Rd Marshall White 146915/250 St Kilda Rd RT Edgar 20418/59 Queens Rd Bennison Mackinnon 312
MERRICKS NORTH217 Bittern Dromana Rd Kay & Burton 106
MONT ALBERT8 Barloa Rd Woodards 1252 Serpentine St Marshall White 167629 Whitehorse Rd Noel Jones 23132 High St McLaren 23822 Black St Jellis Craig 27810 St Johns Ave Jellis Craig 29536 View St Jellis Craig 29626a Serpentine St Hocking Stuart 326
806 MALVERN ROAD, ARMADALEAgent: Abercrombys, 9864 5300. Auction: November 20 at 11.30am.
Price: $2.7 million - $3 million.
(PH
OTOL
IBRA
RY)
-
MONT ALBERT NORTH3/378 Belmore Rd Jellis Craig 30010 Watson Ave Hocking Stuart 327
MOOROODUC226 Coolart Rd Aqua 339
MORNINGTON19 Albert St RT Edgar 212820 Esplanade Aqua 339
MOUNT ELIZA56 Glen Shian Ln David Rew 1215 Bay Ave Aqua Real Estate 3382 Sturio Pde Aqua Real Estate 33980 Old Mornington Rd Aqua Real Estate 339
MOUNT MARTHA33 Lempriere Ave Kay & Burton 107413-414 Esplanade RT Edgar 206
MOUNT WAVERLEY2a Howard Ave Jellis Craig 300
MURCHISONRevi Resco Pat Rice & Hawkins 334
NEWHAM217 Forest Rd Joan Gladman 334
NUNAWADING1a Junction St Hocking Stuart 331
OCEAN GROVE30 The Avenue RT Edgar 214
PARKDALE58 Herbert St Buxton 192
PORT MELBOURNE26 Drysdale St Kay & Burton 113164 Nott St Kay & Burton 11417 Beach St Buxton 19063 Seisman Plc RT Edgar 20571 Albert St Bennison Mackinnon 312
PORTSEA16 Point King Rd Kay & Burton 867 Gavan St Kay & Burton 10821 Ibis Way Kay & Burton 1183 Wattle Gve Kay & Burton 120
PRAHRAN33-35 Greville St Marshall White 17662a Alfred St Marshall White 17632 Larnook St RT Edgar 213582 High St RT Edgar 21364 Pridham St Bennison Mackinnon 31328 Clifton St Hocking Stuart 33132 Union St Hocking Stuart 33234/8 Sydney St Hocking Stuart 3328c Highbury Gve Hocking Stuart 332
PRAHRAN EAST10a Pickford St Marshall White 17716 Chatsworth Rd Marshall White 177
RICHMOND177 Brighton St Bennison Mackinnon 31328 Brighton St Bennison Mackinnon 314367 Burnley St Bennison Mackinnon 316
RIDDELLS CREEK1336 Riddells Rd Scott McCormick 334
ROMSEYScotsburn Farm Elders 334
SANDRINGHAM10 Gladstone St Buxton 193
SHOREHAM27 Shoreham Rd Kay & Burton 1091 Nelson St RT Edgar 212
SOMERS6 The Promenade Kay & Burton 119
SORRENTO17 Kemp Rd Kay & Burton 1107 York St Bennison Mackinnon 315
SOUTH YARRA3/264 Walsh St Kay & Burton 112320A Walsh St Kay & Burton 11280 Caroline St Marshall White 136119 Alexandra Ave Marshall White 137103 Caroline St Marshall White 17416 William St RT Edgar 2001/223 Domain Rd RT Edgar 2014/44 Murphy St RT Edgar 2028 Penny Ln RT Edgar 21425 The Righi Abercrombys 2181/40 Howitt St Noel Jones 2312/12 Cromwell Rd Bennison Mackinnon 3169/49 Davis Ave Williams Batters 31811/49 Davis Ave Williams Batters 319
SOUTHBANK1 Queensbridge Square Marshall White 1472701/80 Clarendon St Marshall White 148
SPRING HILLLot 18 Coliban Rd RT Edgar 214
ST KILDA10 Robe St Kay & Burton 98
ST KILDA EAST12/6 Sidwell Ave Gary Peer 12913 Lynedoch Ave Gary Peer 1291/231 Alma Rd Williams Batters 318
SUGARLOAF CREEK/BROADFORD1320 Sugarloaf Creek Rd Pat Rice & Hawkins 335
SURREY HILLS235 Union Rd Woodards 1243/10 Valonia Ave Woodards 1269 James St Woodards 126241 Union Rd Marshall White 16899 Middlesex Rd Marshall White 169285 Elgar Rd Marshall White 1853/49 Wandsworth Rd Marshall White 1852/32 Russell St Marshall White 1861/9 Balmoral Cres Noel Jones 2321/27 Chestnut St Noel Jones 237226 Mont Albert Rd Noel Jones 23732 Croydon Rd Noel Jones 23727 Shepherd St Jellis Craig 279760 Canterbury Rd Jellis Craig 2962/51 Park Rd Jellis Craig 29729 Chestnut St Jellis Craig 2971/1A Pembroke St Jellis Craig 29814 Benson St Jellis Craig 3019 Edyvean St Hocking Stuart 32739 Everton Gve Hocking Stuart 32821 Windsor Cres Hocking Stuart 332
TOORAK2 Barnard Rd Kay & Burton 8412 Cleeve Crt Kay & Burton 88
16 Cole Crt Kay & Burton 892A Grosvenor Crt Kay & Burton 9036 St Georges Rd Kay & Burton 91494 Toorak Rd Kay & Burton 9218 Heyington Plc Kay & Burton 111644 Toorak Rd Kay & Burton 11112/2 Theodore Crt Kay & Burton 1195 Verdant Ave TBM 12388 Mathoura Rd Marshall White 13211 Landen Plc Marshall White 1332.06/1 Wallace Ave Marshall White 1343/25 Tintern Ave Marshall White 13552 Mathoura Rd RT Edgar 19616 Millicent Ave RT Edgar 197780 Orrong Rd RT Edgar 1982 Bromley Crt RT Edgar 20332 Linlithgow Rd RT Edgar 2092/18 Grange Rd RT Edgar 21011 Rathmines St Abercrombys 2194 Mathoura Rd Abercrombys 220
TRAWOOL8416 Goulburn Valley Hwy Pat Rice & Hawkins 335
TUERONG430 Old Moorooduc Rd Kay & Burton 105
WINDSOR152 Peel St Castran Gilbert 8337 McIlwrick St McLaren 238
WOODEND71 Chambers Rd Keatings 336
YARRA GLEN48 Mt Wise Rd RT Edgar 215
YEA4663 Goulburn Valley Highway RT Edgar 207* LISTINGS SUPPLIED BY CAMPAIGNTRACK
IN PARTNERSHIP WITH
+AUCTIONS SATURDAYS RESULTS ONLINE @
www.theweeklyreview.com.au
On sale at selected Borders,
Angus and Robertson
and other good bookshops
from Monday, November 15.
See www.theweeklyreview.com.au for shop locations.
(PH
OTOL
IBRA
RY)
NEED ACAFFEINE HIT?
ORDER ONLINE & SAVE
-
BALWYN 2 Barnsbury Road
Millbra. Enter the grounds of this exemplary 1920s property on the Golden Mile and you return to the age of African Safaris and extravagant entertaining. This magical circa 1920 double storey 5 bedroom residence faces north viewing large grounds with a heated pool. It features decorative plaster work, bevelled glass, open fireplaces, a timber panelled Baronial hall with a marvellous staircase, a generous living room and grand music room opening to the garden. The timber panelled dining room adjoins the updated kitchen-meals area-family room and the garden. The downstairs study/5th bedroom is next to a bathroom and there is a magnificent upstairs marble bathroom. The sunroom with 3 walls of glass views the pool, gardens and distant hills. This fabulous property is near Camberwell Grammar, Burke and Whitehorse roads trams, and local shops.
fletchers.net.au
-
Inspect Thurs 6-7pm & Sat 3-4pmLand 1,122 sq m approx. irregularMelway 46 A8Contact Jason Salan 0417664431, Lyndal Linkin 0409123721,
Rob Fletcher 0411222988Office 61 Doncaster Road, Balwyn North 9859 9561
Auction Saturday 27 November at 11am
-
276 Toorak Road South Yarra / 9827 1177
castrangilbert.com.au
Windsor 152 Peel Street
DEVELOPED BY
Superbly located less than 200 metres from Chapel Street, walk to Prahran Market.
Monda Apartments offer:
- Exceptional living spaces with landscaped courtyards or terraces
- Designer finishes including reverse cycle heating and cooling
- Secure basement car parking available
- Select apartments with stunning city views and penthouse apartments available
- Storage cages provided
INSPECT Sales Office 152 Peel Street, Windsor Melway Reference 58 : D7 Open Saturday & Sunday 11.30 2.00
CONTACTMark Forytarz 0407 766 308
STYLISH
1 & 2 Bedroom Apartments FROM $385,000
Artist's impression
GRAN
D
OPEN
ING
03 9654 8666www.grosswaddell.com.auLEVEL 6, 172-192 FLINDERS ST, MELBOURNE
LandArea:535m2*
Ononetitle
3streetfrontages
Subjecttotenancies
Multiunitdevelopmentsite(STCA)
Zoning:PartBusiness2&PartResidential1
auction 12noon Thursday November 25
*approx
AndrewGreenway0409547626MichaelGross0419355561
occupy/invest/develop115 church street & 50 mason street, hawthorn
to be sold as one
-
5003",#BSOBSE3PBE5PPSBL-VYVSZ0O5IF(SBOEFTU4DBMF)NGENIOUSLYCRAFTEDBY)VO+RIVANEKTHISARTICULATEFAMILYRESIDENCESHOWCASES4OORAKLIVINGONTHEGRANDESTOFSCALES!CCOMPANIEDBYOPULENTYETCONVIVIALINTERIORSCONCEPTUALISEDBYWORLDRENOWNEDDESIGNERS(ENDRIX!LLARDYCETHEHOMEREPRESENTSTHEPINNACLEOFLIVABLELUXURY"EHINDTHEMAJESTICSANDHUEDFACADETHEHOUSEEXEMPLIFIESEFFORTLESSSTYLESOPHISTICATIONANDFUNCTIONALITY4HEKEYFEATURESOFTHEHOUSEINCLUDEEXTENSIVE
LIVINGDININGAREAS%UROPEANKITCHENWITH'AGGENAUAND6IKINGAPPLIANCESIMPRESSIVEMAINSUITEWITHLUXURIOUSENSUITE7)2SOFSUBLIMEPROPORTIONSADDITIONALBEDROOMSWITHENSUITES")2SGRANDLIBRARYHOMETHEATREFULLYMIRROREDGYMPOWDERROOMCOLUMNFREEMULTICARBASEMENTGARAGEANDLIFTACCESSTOALLFLOORS3ETAMIDSTVERDANTGARDENSDESIGNEDBY2ICK%CKERSLEY
KAYBURTONCOMAU
-
THEHOUSEALSOCOMPRISESOFAVILLASTYLEPOOLALONGSIDESTYLISH4ASMANIANSANDSTONECOURTYARDS!DDITIONALHIGHLIGHTSINCLUDE&RENCHLIMESTONEFLOORINGONYXAND"RECCIAMARBLECOUNTERTOPSMAHOGANYINTERIORSSEPARATELAUNDRY/&0HIGHLYSOPHISTICATEDZONEDHEATINGCOOLINGFLOORHEATINGENERGYEFFICIENTGLAZINGHIGHQUALITYSOUNDSYSTEMTHROUGHOUTSECURITY##46INTERCOMHOMEAUTOMATIONANDSMARTWIRING
%XPRESSIONSOF)NTEREST#LOSE4UETH.OVPM6IEW "Y!PPOINTMENT#ALL -ICHAEL'IBSON 2OSS3AVAS/FFICE 4OORAK2OAD3OUTH9ARRA
!LBERT0ARK"RIGHTON&LINDERS0ORTSEA3OUTH9ARRAAlbert Park. 9252 1800 Brighton. 9592 6522 Flinders. 5989 1000 Portsea. 5984 4744 South Yarra. 9820 1111
-
10354&"1PJOU,JOH3PBEm*MZVLBn/NEOF!USTRALIASMOSTSIGNIFICANTPROPERTIES)LYUKAEVOKESASENSEOFHISTORYELEGANCEANDTIMELESSSOPHISTICATION(OLDINGTHEPREMIERLOCATIONATOP0ORTSEASCOVETEDCLIFFTOPTHISICONICS3PANISH-ISSIONSTYLERESIDENCEWASDESIGNEDFORA4EXASOIL"ARRONTOCAPTURETHEGRANDEURANDELEGANCEOF(OLLYWOODINITSGOLDENERA3INCETHEN)LYUKAANABORIGINALWORDMEANINGhBYTHESEAvHASEARNEDITSPLACEASONEOF6ICTORIASMOST
REVERED%STATESANDAGENUINEWORLDCLASSDESTINATION3UPERBLYRESTOREDANDRENOVATEDUNDERITSCURRENTOWNERTHEHOUSENOWOFFERSTHEVERYFINESTINMODERNFAMILYLIVINGSETAMONGSTASWEEPOFBEAUTIFULLYPROPORTIONEDLIVINGDININGANDENTERTAININGROOMSALLDESIGNEDWITHACAPTIVATINGPERSPECTIVEACROSSTHESTUNNINGGROUNDSOFALMOSTACRESANDONTO
KAYBURTONCOMAU
-
THESEA7ITHBEDROOMSANDBATHROOMS)LYUKAISABLETOACCOMMODATEONTHELARGESTSCALE)NCLUDEDAMONGSTTHEROLLCALLOFOUTSTANDINGFEATURESAREAFULLSIZEDGRASSTENNISCOURTBASEMENTCELLAREXQUISITELONGGRAVELDRIVEWAYPRIVATESTEPSTOEXCLUSIVE0OINT+INGBEACHANDACCESSTOAPRIVATEJETTY
%XPRESSIONSOF)NTEREST#LOSE3ATTH$ECPM6IEW "Y!PPOINTMENT#ALL 2OSS3AVAS7EB WWWILYUKACOM/FFICE 0OINT.EPEAN2OAD0ORTSEA
!LBERT0ARK"RIGHTON&LINDERS0ORTSEA3OUTH9ARRAAlbert Park. 9252 1800 Brighton. 9592 6522 Flinders. 5989 1000 Portsea. 5984 4744 South Yarra. 9820 1111
-
!5#4)/.4()33!452$!9
5003",$MFFWF$PVSU$POUFNQPSBSZ&MFHBODF3ETINONEOF4OORAKSMOSTPRESTIGIOUSCULDESACSISTHISBEAUTIFULLYPROPORTIONEDCONTEMPORARYBEDROOMHOME)MMERSEDINNATURALSUNLIGHTTHROUGHOUTITCOMPRISESBEDROOMSPLUSSTUDYMAINBEDROOMWITHLUXURIOUSENSUITEAND7)2SFORMALLIVINGANDDININGROOMSANDTHESPACIOUSOPENPLANFAMILYLIVINGWITH.ORTHERNORIENTATIONOPENINGTOTHECOURTYARDANDPOOLWITHGARAGINGFOR&EATURESHEATINGANDCOOLINGSECURITYALARMMETICULOUSATTENTIONTODETAILANDQUALITYFIXTURESTHROUGHOUT
!UCTION 3ATURDAYTH.OVAM6IEW 7EDNESDAYPMPM#ALL .ICOLE'LEESON !NTHONY#ANTOR/FFICE 4OORAK2OAD3OUTH9ARRA
KAYBURTONCOMAU !LBERT0ARK"RIGHTON&LINDERS0ORTSEA3OUTH9ARRAAlbert Park. 9252 1800 Brighton. 9592 6522 Flinders. 5989 1000 Portsea. 5984 4744 South Yarra. 9820 1111
-
5003",$PMF$PVSU%FTJSBCMF$PVSU-PDBUJPO3ITUATEDINTHISHIGHLYDESIRABLECOURTLOCATIONTHISCHARMINGTOWNHOUSEOFFERSLUXURYANDCOMFORTWITHCOMPLETEPRIVACYANDSECURITY4HEHOMEFEATURESAGRANDENTRYANDANIDEALLAYOUTFEATURINGOPENPLANLIVINGSPACESANDQUALITYKITCHENWITH%UROPEANAPPLIANCESOPENINGTOAPRIVATECOURTYARDWITHPLUNGEPOOL5PSTAIRSAREBEDROOMSINCLUDINGMAINWITHWALKINROBEENSUITEANDBALCONY&EATURESLARGESTUDYAREADUCTEDHEATINGANDCOOLINGALARMANDREMOTEGARAGING
!UCTION 3ATURDAYTH.OVPM6IEW 4HURSDAYPMPM#ALL .ICOLE'LEESON 2OSS3AVAS *ASON3CILLIO/FFICE 4OORAK2OAD3OUTH9ARRA
KAYBURTONCOMAU !LBERT0ARK"RIGHTON&LINDERS0ORTSEA3OUTH9ARRAAlbert Park. 9252 1800 Brighton. 9592 6522 Flinders. 5989 1000 Portsea. 5984 4744 South Yarra. 9820 1111
-
5003","(SPTWFOPS$PVSU(SBOE5PPSBL3FTJEFODF4HISELEGANTANDMOSTATTRACTIVEFAMILYRESIDENCEOF'RANDPROPORTIONSISBEAUTIFULLYAPPOINTEDANDORIENTATEDTOCAPTUREMAXIMUMNATURALLIGHT#OMPRISINGSTUNNINGENTRYTOGENEROUSLIVINGROOMSANDFEATURINGALARGECASUALLIVINGAREAWHICHOPENSONTOATERRACEANDMANICUREDGARDENS5PSTAIRSTHEREARELARGEBEDROOMSANDBATHROOMS
!UCTION 3ATURDAYTH.OVPM6IEW 4HURSDAYPM#ALL !NDREW"AINES $ARREN,EWENBERG/FFICE 4OORAK2OAD3OUTH9ARRA
KAYBURTONCOMAU !LBERT0ARK"RIGHTON&LINDERS0ORTSEA3OUTH9ARRAAlbert Park. 9252 1800 Brighton. 9592 6522 Flinders. 5989 1000 Portsea. 5984 4744 South Yarra. 9820 1111
-
5003",4U(FPSHFT3PBE(SBOE$POUFNQPSBSZ)BWFO*O1SFTUJHJPVT-PDBMF)NGENIOUSLYREDESIGNEDEXTENDEDWHILERETAININGCHARACTERISTICSOFITSICONICS%NGLISHSTYLEARCHITECTURETHISIMMACULATECONTEMPORARYRESIDENCECOMPRISESOFBEDROOMSPLUSSTUDYMAINSUITEWITH7)2SENSUITEBALCONYLARGEFAMILYAREAFORMALDININGROOMCASUALLIVINGSPACEKITCHENWITH'AGGENAU,IEBHERRAPPLIANCESBUTLERSPANTRYLAUNDRYAREASECUREDOUBLECARPORTCONJOINEDINDOOROUTDOORZONESWHICHENABLEVERSATILEENTERTAINING!DDITIONALFEATURESINCLUDE*ACK-ERLOGARDENS!MERICAN/AK&RENCHLIMESTONEFLOORINGHOMEAUTOMATIONCUSTOMDESIGNEDSTEELFRAMEDDOORSWINDOWSCONCEALEDHYDRONICHEATINGCOOLINGINTERCOMSECURITYFULLYAUTOMATEDIRRIGATIONUNDERGROUNDWATERSTORAGE
%XPRESSIONSOF)NTEREST#LOSE4UETH.OVPM6IEW "Y!PPOINTMENT7EDNESDAYPM
PM#ALL 3AM7ILKINSON -ICHAEL'IBSON/FFICE 4OORAK2OAD3OUTH9ARRA
KAYBURTONCOMAU !LBERT0ARK"RIGHTON&LINDERS0ORTSEA3OUTH9ARRAAlbert Park. 9252 1800 Brighton. 9592 6522 Flinders. 5989 1000 Portsea. 5984 4744 South Yarra. 9820 1111
-
5003",5PPSBL3PBE3FOPWBUF0S%FWFMPQ3UPERBLYPOSITIONEDONLYAMOMENTFROMTHEPRESTIGIOUS4OORAK6ILLAGETHISSOLIDBRICKDUPLEXAPARTMENTBUILDINGOFFERSANAMAZINGOPPORTUNITYTORENOVATEORDEVELOP34#!ONAPPROXSQFTOFPRIMELAND%ACHAPARTMENTCOMPRISESSECURITYENTRANCEBEDROOMSSECONDBEDROOMWITHSHOWERROOMPLUSASTUDYFORMALLIVING/&0ANDDININGROOMWITHSEPARATEBARCENTRALBATHROOMPOWDERROOMKITCHENANDASEPARATELAUNDRY!DDITIONALFEATURESINCLUDELARGEREARCOMMUNALGARDENCENTRALHEATINGINTERCOMALARMANDX,5'WITHADDITIONAL/30.OTE%XISTING0ERMITFOR,UXURY2ESIDENCES
%XPRESSIONSOF)NTEREST#LOSE4UETH.OVPM6IEW 7EDNESDAYPM#ALL 0ETER+UDELKA !NDREW3AHHAR 2OSS3AVAS/FFICE 4OORAK2OAD3OUTH9ARRA
KAYBURTONCOMAU !LBERT0ARK"RIGHTON&LINDERS0ORTSEA3OUTH9ARRAAlbert Park. 9252 1800 Brighton. 9592 6522 Flinders. 5989 1000 Portsea. 5984 4744 South Yarra. 9820 1111
-
!5#4)/.4()33!452$!9
."-7&3/4PNFST"WFOVF$POUFNQPSBSZ#SJMMJBODF#Z&EHBSE1JSSPUUB3URROUNDEDBYANIMPOSINGEXTERIOROFLUSHFOLIAGETHISDELIGHTFULFAMILYHOMEFEATURESPERFECTPROPORTIONSSTYLISHCONTEMPORARYINTERIORSANDQUALITYAMENITIES%XEMPLIFYINGTHERENOWNEDARCHITECTURALBRILLIANCEOF%DGARD0IRROTTATHEHOUSECOMPRISESELEGANTSITTINGDININGROOMSEXTENSIVEOPENPLANFAMILYAREAWITHMODERNKITCHENRETREATSTUDYMASTERBEDROOMWITH7)2SANDENSUITEPLUSADDITIONALBEDROOMS/THERHIGHLIGHTSINCLUDEALARGEINGROUNDPOOLSAUNAANDTENNISCOURT/&0SHEATINGCOOLINGANDSECUREPARKINGCOMPLETETHISLIGHTFILLEDFAMILYRESIDENCE0LEASENOTETHATTHEHOUSESQFTAPPROXANDTENNISCOURTSQFTAPPROXn-OUNTVIEW2DWILLBEOFFEREDSEPARATELY
!UCTION 3ATURDAYTH.OVPM6IEW 7EDNESDAYPMPM#ALL .ICOLE'LEESON -ICHAEL'IBSON/FFICE 4OORAK2OAD3OUTH9ARRA#ONJ 'ARY0EER 0HILLIP+INGSTON $ARREN+RONGOLD
KAYBURTONCOMAU !LBERT0ARK"RIGHTON&LINDERS0ORTSEA3OUTH9ARRAAlbert Park. 9252 1800 Brighton. 9592 6522 Flinders. 5989 1000 Portsea. 5984 4744 South Yarra. 9820 1111
-
$"/5&3#63:.POPNFBUI"WFOVF*NNBDVMBUF5JNFMFTT3ITUATEDINONEOF-ELBOURNESMOSTEMINENTPRESTIGIOUSPRECINCTSTHISMAJESTICESTATESITUATEDONAPPROXMSQFTOFFERSINDULGENTCHTEAULIVINGTHROUGHGENEROUSLIVINGZONES&ABULOUSENTERTAINERSHOMESHOWCASINGPALATIALARCHITECTUREALONGSIDE&RENCHINSPIREDINTERIORSTHISSOLIDBRICKHOMECOMPOFLARGEFORMALLIVINGDININGROOMSINFORMALFAMILYDININGRMSSTUDYSTUDIOLOUNGEWITHFULLYFITTEDBARALARGE%UROPEANKITCHENWITH-IELEAPP7)PANTRY5PSTAIRSMAINBEDRMWITH7)2SLARGEENSUITEANADJOININGRETREATOFFICEADDITIONALBEDRMSWITH")2SnWITHENSnALONGWITHACENTRALBATHRMBILLIARDRMOUTDOORTERRACE3ETAMIDSTIMPECCABLEGARDENSOUTDOORENTERTAINMENTFACILSALFRESCODININGPOOLTENNISCOURT&EATSCARBASEMENTGARAGEGYMCELLARCOOLRMSAUNA2#HEATCOOLFLOORHTGINTERCOMSECURITY
%XPRESSIONSOF)NTEREST#LOSE-ONTH.OVPM6IEW "Y!PPOINTMENT4HURSDAYAM
PM#ALL 2OSS3AVAS -ICHAEL!RMSTRONG 3AM7ILKINSON/FFICE 4OORAK2OAD3OUTH9ARRA
KAYBURTONCOMAU !LBERT0ARK"RIGHTON&LINDERS0ORTSEA3OUTH9ARRAAlbert Park. 9252 1800 Brighton. 9592 6522 Flinders. 5989 1000 Portsea. 5984 4744 South Yarra. 9820 1111
-
,00:0/(.FSOEB3PBE#SBOE/FX4UPSFZ5PXOIPVTF3ECUREDINAQUIETTREELINEDSTREETCLOSETO+OOYONG4ENNIS#LUB+OOYONG6ILLAGEISTHISSPECTACULARBRANDNEWTOWNRESIDENCEBOASTINGTHEVERYBESTINCONTEMPORARYLIVING3ETOVERLEVELSANDFINISHEDTODELIGHTTHEMOSTDISCERNINGCLIENTELETHEHOMEHASBEENDESIGNEDFORENTERTAININGINMINDWITHSPACIOUSFORMALANDINFORMALLIVINGAREASSERVICEDBY'AGGENAUEQUIPPEDKITCHENWITHBUTLERSPANTRYOPENINGOUTTOMAGNIFICENTOUTDOORTERRACEANDCOURTYARDGARDENWITHWATERFEATURELARGEBEDROOMSCOMPLETETHEUPPERLEVELWITHASPACIOUSMAINBEDROOMFEATURING7)2ANDFULLYMARBLETILEDENSUITE!LLFLOORSARESERVICEDWITHLIFTACCESSWITHDOUBLECARBASEMENTGARAGESTORAGEROOMANDGYMTHEATREROOMSITUATEDONLOWERGROUNDFLOOR
%XPRESSIONSOF)NTEREST#LOSE-ONTH.OVPM6IEW 7EDNESDAYPMPM#ALL 'OWAN3TUBBINGS -ATT$AVIS/FFICE 4OORAK2OAD3OUTH9ARRA
KAYBURTONCOMAU !LBERT0ARK"RIGHTON&LINDERS0ORTSEA3OUTH9ARRAAlbert Park. 9252 1800 Brighton. 9592 6522 Flinders. 5989 1000 Portsea. 5984 4744 South Yarra. 9820 1111
-
&"45.&-#063/&$MBSFOEPO4USFFU8PSME$MBTT-JWJOH*O"VTUSBMJBlT.PTU&YDMVTJWF3FTJEFOUJBM"EESFTT4IPXDBTJOH-VYVSZ4UZMF7ITHARANGEOFBESPOKEFINISHES@STATEOFTHEARTTECHNOLOGYTHROUGHOUTTHISISSIMPLYANUNRIVALLEDBUILDINGTHATSETSANEWBENCHMARK3ECURITYPARKINGINDIVIDUALWINECELLARSSTORAGEAREASPLUSASUITEOFFACILITIESINCLUDING#ONCIERGE#INEMA0OOL'YM"OARDRMFUNCTIONRM!PARTMENT,UXURIOUSLYAPPOINTEDBEDRMAPARTMENTOPENPLANKITCHENWITH-IELEAPPLIANCES,ARGELIVINGDININGAREAOPENINGONTOGENEROUSTERRACEWITHSTUNNINGVIEWSACROSS&ITZROY'ARDENS&EATSHEATCOOLLAUNDRYSECUREPARKINGFORCARS!PARTMENT3PACIOUSOPENPLANLIVINGDININGRMSWITHBALCONYBEDRMSBOTHWITHENS7)2STUDY%UROPEANKITCHENWITH-IELEAPPLIANCESHEATCOOLLAUNDRYBASEMENTPARKINGFORCARS
0RIVATE3ALE6IEW 4HURSDAYPM#ALL 4IM"LACKETT 'ARY/RMROD 2OSS3AVAS/FFICE 4OORAK2OAD3OUTH9ARRA#ONJ $INGLE0ARTNERS !NTON7ONGTRAKUN
KAYBURTONCOMAU !LBERT0ARK"RIGHTON&LINDERS0ORTSEA3OUTH9ARRAAlbert Park. 9252 1800 Brighton. 9592 6522 Flinders. 5989 1000 Portsea. 5984 4744 South Yarra. 9820 1111
-
.&-#063/&4U,JMEB3PBEm"JSMJF.BOTJPOn$JSDB-JWF8IFSF5IF1SJNF.JOJTUFS-JWFE%MINENTLYKNOWNASTHE@!IRLIE-ANSIONTHISSTATELY6ICTORIANRESIDENCEWASFORMERLYHOMETO3TANLEY-ELBOURNE"RUCE0RIME-INISTEROF!USTRALIA-ETICULOUSLYRESTOREDANDSUBSTANTIALLYREFURBISHEDTHEMANSIONFEATURESSUBLIMECONTEMPORARYINTERIORSALONGSIDEILLUSTRIOUS2ENAISSANCE2EVIVALAND)TALIANATEARCHITECTURE4HE'RANDRESIDENCECOMPRISESOFFORMALANDINFORMALSITTINGDININGROOMSPOTENTIALFORUPTOLUXURIOUSBEDROOMSFORMALSTUDYBILLIARDROOMANDEXTENSIVEOUTDOORTERRACESANDCOURTYARDS!DDITIONALFEATURESINCLUDEREVERSECYCLEHEATINGCOOLINGALARM#"53BASEMENTCELLARSTORAGEANDPARKINGFORCARS
%XPRESSIONSOF)NTEREST#LOSE4HUTH.OVPM6IEW 7EDNESDAYPMPM#ALL 'ERALD$ELANY 2OSS3AVAS -ICHAEL'IBSON/FFICE 4OORAK2OAD3OUTH9ARRA
KAYBURTONCOMAU !LBERT0ARK"RIGHTON&LINDERS0ORTSEA3OUTH9ARRAAlbert Park. 9252 1800 Brighton. 9592 6522 Flinders. 5989 1000 Portsea. 5984 4744 South Yarra. 9820 1111
-
45,*-%"3PCF4USFFU3BWFOTXPPE$4HISISATRULYRAREOPPORTUNITYTOACQUIREONEOF-ELBOURNESMOSTICONIC'EORGIANHOUSES-ETICULOUSLYRENOVATEDTOCOMBINETHEREALPRESTIGEOFTH#ENTURY-ELBOURNEWITHCONTEMPORARYARCHITECTURALDESIGNTHEHOMECOMPGRANDENTRY"2SMASTERWITH7)2SENSUITESTUDYFORMALLOUNGEDININGOPENPLANKITCHENLIVINGROOMSWITHRETRACTABLEDOORS%UROPEANAPPLIANCESPOLISHEDCONCRETEFLOORS"ALTICFLOORBOARDSX/&0SPRIVATESUNDECKAIRCONHYDRONICHEATINGMONITOREDSECURITYLANDSCAPEDGARDENSWITHAUTOIRRIGATIONAUTOGARAGE,ANDAPPROXMPLUSX/30
!UCTION 3UNDAYTH.OVPM6IEW 7EDNESDAYPMPM#ALL 'OWAN3TUBBINGS -ATT$AVIS 4OM3TAUGHTON/FFICE $UNDAS0LACE!LBERT0ARK
KAYBURTONCOMAU !LBERT0ARK"RIGHTON&LINDERS0ORTSEA3OUTH9ARRAAlbert Park. 9252 1800 Brighton. 9592 6522 Flinders. 5989 1000 Portsea. 5984 4744 South Yarra. 9820 1111
-
#3*()50/#BZ4USFFU$PSOFS0G#BZ4U"OE1PSU1IJMMJQ#BZ4OTALLINGAROUNDSQFTSQMONTITLESTHISBEACHFRONTCORNEROFFERSAGRAND3PANISH-ISSIONMANSIONPERMITSFORAPARTMENTSENDLESSPOSSIBILITIES3EETHROUGHTHIS6#!4APPROVEDPROJECTORSUBDIVIDEFURTHERTOALLOWMULTIPLELUXURYHOMESSUBJECTTO#OUNCIL!PPROVALDEVELOPANEWVISIONFORTHISUNUSUALLYRAREFTMBEACHFRONTAGEORREVIVETHISLANDMARKBEDROOMBATHROOM3PANISH-ISSIONBEAUTYWITHPOOLSPABASEMENTGARAGE!NHISTORICOPPORTUNITYATONEOF-ELBOURNESFINESTLOCATIONS
%XPRESSIONSOF)NTEREST#LOSE-ONTH.OVPM6IEW "Y!PPOINTMENT#ALL 3TEWART,OPEZ 'ERALD$ELANY/FFICE #HURCH3TREET"RIGHTON#ONJ 24%DGAR 'REG(ERMAN 3ARAH#ASE
KAYBURTONCOMAU !LBERT0ARK"RIGHTON&LINDERS0ORTSEA3OUTH9ARRAAlbert Park. 9252 1800 Brighton. 9592 6522 Flinders. 5989 1000 Portsea. 5984 4744 South Yarra. 9820 1111
-
#3*()50//PSUI3PBEm.ZSUMF(SPWFnn$(SBOE(SBDJPVT$PMPOJBM)PNFTUFBE/NEOF"RIGHTONSEARLIESTGRANDESTMANSIONSh-YRTLE'ROVEvCSHOWCASESAREMARKABLERENOVATIONACROSSANEXTRAVAGANTBEDROOMHOMEOFFICEMARBLEBATHROOMFLOORPLANSETONAPPROXSQFTM&EATURINGGRANDFORMALAREASDRAWINGROOMSITTINGROOMDININGTOSEATCONSERVATORYSTYLECASUALLIVINGWITH-IELEGRANITEKITCHENASTFLRLOUNGETHEHOMESTARSASUBLIMEMASTERDOMAINWITH)TALIAN-ARBLEDRESSINGROOMENSUITEEVERYEXTRAINCLUDINGADOUBLEAUTOGARAGECARSPACESPLUSBOTTLECELLARBASEMENTGYMWITHSAUNATILEDHEATEDPOOLWITHCABANA/N"RIGHTONSFINESTBOULEVARDONEBLOCKFROMTHEBAYTHISISONEOF-ELBOURNESMOSTADMIREDRESIDENCES
%XPRESSIONSOF)NTEREST#LOSE4UERD.OVPM6IEW "Y!PPOINTMENT#ALL 3TEWART,OPEZ 'ERALD$ELANY/FFICE #HURCH3TREET"RIGHTON
KAYBURTONCOMAU !LBERT0ARK"RIGHTON&LINDERS0ORTSEA3OUTH9ARRAAlbert Park. 9252 1800 Brighton. 9592 6522 Flinders. 5989 1000 Portsea. 5984 4744 South Yarra. 9820 1111
-
#3*()50/3PTMZO4USFFU5SBEJUJPO8JUI"5XJTU.ESTLEDONTOPOF"RIGHTONSHILL7ARATAHISANELEGANTANDARTFULBEDROOMBATHROOMWEATHERBOARDBRICKHOUSEOFGLASSANDLIGHTONMAPPROXUNITEDBYBEAUTIFULGARDENSPACESWITHASOLARHEATEDPOOLAND(YDRO4HERAPEUTICSPAHOUSE/PENCONCEPTSINGLELEVELDESIGNCONFIGUREDFORENTERTAININGACROSSSQUARESAPPROXWITHALIBRARYOFFICEFORMALCASUALLIVINGADJOINEDBEDROOM'ARDEN#OTTAGEWITHBUTLERSKITCHEN4ANDEMCARPORT!TTHEGATEWAYTO#HURCH3TTHEBEACH
%XPRESSIONSOF)NTEREST#LOSE4UETH.OVPM6IEW "Y!PPOINTMENT7EDNESDAYPM#ALL 3TURT(INTON -ELANIE3HAW/FFICE #HURCH3TREET"RIGHTON
KAYBURTONCOMAU !LBERT0ARK"RIGHTON&LINDERS0ORTSEA3OUTH9ARRAAlbert Park. 9252 1800 Brighton. 9592 6522 Flinders. 5989 1000 Portsea. 5984 4744 South Yarra. 9820 1111
-
#3*()50/#3PUIFTBZ"WFOVF$MBTTJD2VBMJUZ*O"4U$MBTT$VM%F4BD*USTOFFTHE'OLDEN-ILEINAHIGHLYSOUGHTCOURTTHISARCHITECTDESIGNEDBEDROOMSTUDYBATHROOMHOMESTEPSUPABOVECARBASEMENTGARAGINGTOOFFERABASEMENTCINEMATRADITIONALFORMALFAMILYZONESEACHWITHGASSTONEFIREPLACEFLEXIBLESTFLRLIVING7ITHDELUXESUITESONLEVELSUPSTAIRSFORTHEMASTERGROUNDFLOORFORGUESTSTHISFINEHOMEFEATURESASPECTACULAR#ALCUTTAMARBLE-IELEKITCHENWITHBUTLERSPANTRYEVERYAPPOINTMENTHEATINGAIRCONVACUUMVIDEOINTERCOMALARMEXTRASINCLUDING,WATERSTORAGE,INTHEBASEMENTFORTHECAR,FORTHEGARDENSOLARFORTHEFULLYTILEDPOOLMTOTHEBEACHARIDETOSCHOOLSTHISISTHEULTIMATELOWFUSSFAMILYLIFESTYLE
%XPRESSIONSOF)NTEREST#LOSE-ONTH.OVPM6IEW 7EDNESDAYPM#ALL 3TEWART,OPEZ *USTIN&OLLETT/FFICE #HURCH3TREET"RIGHTON
KAYBURTONCOMAU !LBERT0ARK"RIGHTON&LINDERS0ORTSEA3OUTH9ARRAAlbert Park. 9252 1800 Brighton. 9592 6522 Flinders. 5989 1000 Portsea. 5984 4744 South Yarra. 9820 1111
-
!0!24-%.4
#3*()50/8FMM4USFFU4FWFOUFFO"/FX8BZ0G-JWJOH0RIVATESECURELIVINGINTHEHEARTOF"RIGHTON,UXURIOUSLYAPPOINTEDTHESELIGHTFILLEDEXPANSIVERESIDENCESWITHSOPHISTICATEDCONTEMPORARYINTERIORS,IVETHELIFESTYLEWITHRESTAURANTSTHEATREBOUTIQUESUPPLIERSPUBLICTRANSPORTONYOURDOORSTEP!0!24'RDFLROFFERS"2STUDYLIBRARYMULTIPLELIVINGZONES-IELEKITCHENGARDENCOURTYARDS4HISUNIQUERESIDENCEOFFERSPRIVATESTREETENTRYPRIVATELIFTACCESSATRADITIONALLOCKUPDOUBLEBASEMENTGARAGE!0!24&IRSTFLOORSTARCONTEMPORARYURBANLIVINGAPARTMENTBATHEDINNORTHERNSUNLIGHTSURROUNDEDBYFLOORTOCEILINGGLASS/FFERINGBEDRMPLUSSTUDYEXPANSIVELIVINGAREAS%UROPEANKITCHENOPENINGONTOPRIVATECOVEREDENTERTAININGAREASOPHISTICATEDPEACEFULLIVINGWITHSTATEOFTHEARTSECURITY
!UCTION !PARTMENT3ATTH.OVPM0RIVATE3ALE !PARTMENT6IEW 7EDNESDAYPMPM#ALL *ASON3CILLIO 3TURT(INTON )AN*ACKSON/FFICE #HURCH3TREET"RIGHTON
KAYBURTONCOMAU !LBERT0ARK"RIGHTON&LINDERS0ORTSEA3OUTH9ARRAAlbert Park. 9252 1800 Brighton. 9592 6522 Flinders. 5989 1000 Portsea. 5984 4744 South Yarra. 9820 1111
-
(/"38"33&(OBSXBSSF3PBEWJB(FFMPOH
m3PYCZ4PVUIn!LIFESTYLEOPPORTUNITYOFEXTRAVAGANTPROPORTIONSUNPARALLELEDQUALITYANDLUXURYISJUSTOVERANHOURSDRIVEFROM-ELBOURNE3ETUPONAPPROXACRESOFVERSATILERURALLANDTHISPICTURESQUEPROPERTYCONSISTSOFALUXURYRESIDENCEALONGSIDESPRAWLINGELEVATEDTERRAINANDVIEWSOFTHE9OU9ANGS#RAFTEDANDMAJESTICINSTATURETHEMANORCOMPRISESOFEXTENSIVELIVINGDININGAREASWITHFORMALINFORMALZONINGCOMPLEMENTEDBYACENTRALFIREPLACE%UROKITCHENANDBUTLERSPANTRYLARGEBEDROOMSWITHLUXURIOUS7)2SANDENSUITESSTUDYANDSECUREGARAGEPARKINGFORCARS4HEHOMEPROVIDESSEPARATEWOODFIREDPIZZERIAHOMETHEATREFACILITIESOUTDOORSPAALFRESCOPATIOSWITHZONEDHEATINGANDCOOLINGSECURITYANDINTERCOM
%XPRESSIONSOF)NTEREST#LOSE-ONTH.OVPM6IEW "Y!PPOINTMENT#ALL 'OWAN3TUBBINGS .ICOLE'LEESON/FFICE 4OORAK2OAD3OUTH9ARRA#ONJ (&2ICHARDSON#O !NDREW2ICE 7ILL2ICHARDSON
KAYBURTONCOMAU !LBERT0ARK"RIGHTON&LINDERS0ORTSEA3OUTH9ARRAAlbert Park. 9252 1800 Brighton. 9592 6522 Flinders. 5989 1000 Portsea. 5984 4744 South Yarra. 9820 1111
-
56&30/(0ME.PPSPPEVD3PBE"LFIVSTU#SJMMJBODF7ONDERFULLYLOCATEDWITHEASYACCESSTOALLTHE0ENINSULAHASTOOFFERISTHISMAGNIFICENT3TEPHEN!KEHURSTDESIGNEDBEDROOMFAMILYHOME3ETONAPRIVATEACRESOFLANDWITHWELLESTABLISHEDYEAROLDTREESFRAMINGTHEINCREDIBLEGARDEN&EATURESINCLUDELARGEOPENPLANLIVINGAREASSEPARATELIBRARYBEDROOMSBATHROOMSANAMAZINGENTRYFOYEROPENFIREPLACESMUDROOM
/UTSIDETHEREISALARGESTABLELIKEGARAGECOMPLEXINGROUNDPOOLFLOODLITTENNISCOURTSEPARATEENTRYDRIVEWAYFORFARMMACHINERYDAM.OTE4HREEPHASEPOWEROAKFLOORBOARDSCARVEDTIMBERSTAIRCASE&RENCHDOORSSUNDRENCHEDTERRACESMARBLEBENCHTOPSSLABHEATINGMAINSWATERAND"OSESOUNDSYSTEM
!UCTION 3UNDAYTH$ECPM6IEW "Y!PPOINTMENT#ALL !NDREW(INES 0RUE-C,AUGHLIN/FFICE !#OOK3TREET&LINDERS
KAYBURTONCOMAU !LBERT0ARK"RIGHTON&LINDERS0ORTSEA3OUTH9ARRAAlbert Park. 9252 1800 Brighton. 9592 6522 Flinders. 5989 1000 Portsea. 5984 4744 South Yarra. 9820 1111
-
!5#4)/.4()33!452$!9
.&33*$,4/035)#JUUFSO%SPNBOB3PBE4UPOOJOHUPO$PVOUSZ-JWJOH1FSGFDUFE2URALLUXURYANDSTUNNINGVIEWSCOMBINETOOFFEREXCLUSIVEPENINSULALIVINGONACRESAPPROXINONEOF-ERRICKS.ORTHMOSTSOUGHTAFTERLOCATIONS7ITHANAWEINSPIRINGVISTAOVER7ESTERN0ORTAND0HILLIP)SLANDASUPERBFOURBEDROOMHOMEWITHVASTLIVINGAREASANDGLORIOUSALFRESCOENTERTAININGOPTIONSWALLEDANDFORMALMANICUREDGARDENSATENNISCOURTINGROUNDPOOLSTABLESPOSTANDRAILFENCEDPADDOCKSFLOWINGDOWNTOAPICTURESQUELAKETHISISTHEULTIMATECLASSICCOUNTRYESTATEPERFECTFORPERMANENTORWEEKENDLIVING&EATURESLARGESECONDDAMSTABLESWITHTWOSTALLSTACKROOMANDWORKAREASGARAGINGFORSIXVEHICLESAMACHINERYANDHAYSHEDANDSTOCKYARDS
!UCTION 3ATURDAYTH.OVPM6IEW "Y!PPOINTMENT#ALL 0RUE-C,AUGHLIN !NDREW(INES/FFICE !#OOK3TREET&LINDERS
KAYBURTONCOMAU !LBERT0ARK"RIGHTON&LINDERS0ORTSEA3OUTH9ARRAAlbert Park. 9252 1800 Brighton. 9592 6522 Flinders. 5989 1000 Portsea. 5984 4744 South Yarra. 9820 1111
-
!5#4)/.4()335.$!9
.06/5."35)"-FNQSJFSF"WFOVF)BEEJOHUPO3BSF5SBORVJMMJUZ8JUI8BUFS7JFXT3UPERBLYLOCATEDINONEOF-T-ARTHASFINESTLOCATIONSARAREOPPORTUNITYAWAITSTOPURCHASETHISPREMIUMBEACHSIDEPROPERTYOFACRESAPPROXCOMBININGSECLUDEDTRANQUILLITYWITHVIEWSTO0ORT0HILLIPANDTHE(EADS!RELAXEDATMOSPHEREWITHANAIROFCHARACTERTHISSUPERBLYRENOVATEDHOMEWILLTICKALLTHEBOXES!SHORTWALKTOTHESANDYSHORESAT3OUTH"EACHTHE6ILLAGE9ACHT#LUBAND,IFE3AVING#LUB4HISBEDROOMHOMEOFFERSTWOOPENPLANLIVINGAREASSEPARATEMASTERWINGWITHENSUITEANDWALKINROBEANDOBSERVATIONDECK4HEBEAUTIFULESTABLISHEDGARDENSWITHTENNISCOURTCOMPLETETHISBEACHSIDEPICTURE!PERFECTFAMILYHOMEINTHEHEARTOFOLD-T-ARTHACOMEANDENJOYTHELIFESTYLE
!UCTION 3UNDAYTH.OVNOON6IEW "Y!PPOINTMENT#ALL 'ERALD$ELANY !NDREW(INES/FFICE !#OOK3TREET&LINDERS
KAYBURTONCOMAU !LBERT0ARK"RIGHTON&LINDERS0ORTSEA3OUTH9ARRAAlbert Park. 9252 1800 Brighton. 9592 6522 Flinders. 5989 1000 Portsea. 5984 4744 South Yarra. 9820 1111
-
10354&"m/PSGPMLnp0OF0G1PSUTFBlT#FTU0GG5IF$MJGG1SPQFSUJFT
4HEULTIMATEINSIXSTARCOASTALLIVINGISOFFEREDFORSALEFORTHEFIRSTTIME2AISINGTHEBARTOANEWLEVELTHISCONTEMPORARYMASTERPIECESHOWCASESANIMPECCABLEGARDENSETTINGSQMTHATPOSITIONSTHISSTUNNINGYEAROLDFAMILYRESIDENCEASONEOFTHEDISTRICTSFINEST%XPANSIVEINTERIORSOFTHISSINGLELEVELDESIGNFLOWINTOOVERSIZEDINDOOROUTDOORAREASWHICHEMBRACETHENORTHERNORIENTATIONOVERLOOKINGTHESTUNNINGPOOLSPATENNISCOURT,ARGESUNDRENCHEDALFRESCODININGAREASFURTHERADDTOTHEIMPRESSIVEPRIVATELIFESTYLEOFFERING)NSPECTIONISHIGHLYRECOMMENDED
!UCTION 3UNDAYST.OVNOON6IEW 3ATURDAY3UNDAYPM#ALL 2OB#URTAIN ,IZ*ENSEN/FFICE 0OINT.EPEAN2OAD0ORTSEA
KAYBURTONCOMAU !LBERT0ARK"RIGHTON&LINDERS0ORTSEA3OUTH9ARRAAlbert Park. 9252 1800 Brighton. 9592 6522 Flinders. 5989 1000 Portsea. 5984 4744 South Yarra. 9820 1111
-
4)03&)".4IPSFIBN3PBEm#BSVOBIn8IBU.PSF$PVME:PV8BOU/NEOF-ORNINGTON0ENINSULASMOSTAMAZINGPROPERTIESALANDMARKPROPERTYSETONAROUNDACRESOF.ORTHFACINGLAND)NACOVETEDLOCATIONISTHISBEDROOMHOMEMASTERWITHENSUITE7)2TWOOPENPLANLIVINGAREASLARGEDECKINGOFFERINGEVERYTHINGTHATYOUHAVEBEENLOOKINGFOR&EATURESINCLUDEATRIPLEGARAGEWORKSHOPDOUBLECARPORTTRACTORHAYSHEDFULLYESTABLISHEDGARDENWITHDAMANDLAKETENNISCOURTANDFULLYFENCEDPADDOCKS4HEGARDENISACOMBINATIONOFYEAROLD%UROPEANTREESATREELINEDDRIVEWAYLANDSCAPEDROCKWALLSEXTENSIVEVEGETABLEGARDENWELLHEDGEDPRIVATEGARDENSDECKSGARDENDAMALAKEVIEWSTHROUGHTO7ESTERN0ORT4HISISTRULYAPROPERTYTHATYOUWILLWANTTOKEEPFOREVER6ISITPROPERTYATWWWBARUNAHCOM
!UCTION 3UNDAYST.OVPM6IEW "Y!PPOINTMENT#ALL !NDREW(INES 0AUL!RMSTRONG/FFICE !#OOK3TREET&LINDERS
KAYBURTONCOMAU !LBERT0ARK"RIGHTON&LINDERS0ORTSEA3OUTH9ARRAAlbert Park. 9252 1800 Brighton. 9592 6522 Flinders. 5989 1000 Portsea. 5984 4744 South Yarra. 9820 1111
-
4033&/50,FNQ3PBE&YDMVTJWF1FOJOTVMB-JWJOH+EMP2OADHASUNINTERRUPTEDVIEWSOVERTHE3ORRENTO'OLF#OURSETHHOLEANDFAIRWAYBEINGONLYMETERSFROMTHECLUBHOUSEGOLFERSPARADISEANDONLYAMINUTEWALKTO0OINT+ING"EACH4HEHOUSECOMPRISESFIVEDOUBLEBEDROOMSANDBATHROOMSFORMALANDINFORMALLIVINGAREASCOSYLIBRARYWITH/&0ANDLARGEFORMALMAINSITTINGROOMALSOWITH/&04HEFABULOUSKITCHENHAS-EILEOVENANDSTOVETOPWITHAGREATDOOR!'!FORTHEBESTOFCOOKS4HEWHOLEHOUSEISCENTRALLYHEATEDHYRDONICANDSELFSUFFICIENTINITSOWNLITRERAINWATERSUPPLY4HEGARDENNOWDROUGHTPROOFWITHITSOWNBOREHASBEENESTABLISHEDFOROVERYEARSANDITHASABEAUTIFULLYDESIGNEDPOOLSOLARHEATEDANDATENNISCOURT0LENTYOFSHELTEREDSUNTRAPAREASFOROUTSIDEENTERTAININGWITH7EBERMAINSGAS""1
%XPRESSIONSOF)NTEREST#LOSE&RIRD$ECPM6IEW "Y!PPOINTMENT#ALL ,IZ*ENSEN 4OM"ARR3MITH 0RUE-C,AUGHLIN/FFICE 0OINT.EPEAN2OAD0ORTSEA
KAYBURTONCOMAU !LBERT0ARK"RIGHTON&LINDERS0ORTSEA3OUTH9ARRAAlbert Park. 9252 1800 Brighton. 9592 6522 Flinders. 5989 1000 Portsea. 5984 4744 South Yarra. 9820 1111
-
kayburton.com.aukayburton.com.au Albert Park. 9252 1800 Brighton. 9592 6522 Flinders. 5989 1000 Portsea. 5984 4744 South Yarra. 9820 1111
!5#4)/.4()33!452$!9
5003",)FZJOHUPO1MBDF4UFFQFE*O$IBSN"OE&MFHBODF/NONEOF4OORAKSMOSTREVEREDTREELINEDAVENUESTHISISACHARMINGHOMEOFLIGHTFLOWINGSPACESTHATPROVIDEOUTSTANDINGFAMILYLIVING$OWNSTAIRSFRESHROOMSWITHHIGHCEILINGSOPENONTOANELEGANTFRONTCOURTYARDCITRUSGARDEN/FTHE"2STHEMASTERBEDOMEXTENDSTOAPRIVBALCONYWITHTRANQUILVIEWS
!UCTION3ATURDAYTH.OVNOON6IEW7EDNESDAYPM4HURSDAYPM
!NDREW"AINES'ERALD$ELANY4OORAK2OAD3OUTH9ARRA
5003",5PPSBL3PBE4QBDJPVT4UZMJTI'JSTU-FWFM-JWJOH4HISARTDECOINFLUENCEDAPARTMENTONEOFTWOCOMPAGENEROUSMASTERBEDRMADDITIONAL"2SALLWITH")2TWOBATHRMSFORMALLIVDININGAREAWITH/&0FAMILYRMLEADINGONTOATERRACEKITCHWITHMEALSAREALNDRY4HISIDYLLICTOWNRESIDENCECLOSETOTRANSPORTALSOINCLACARGARAGETWOSTORAGEROOMS
!UCTION3ATURDAYTH.OVNOON6IEW7EDNESDAYPMPM
#HRIS!LCOCK-ICHAEL'IBSON4OORAK2OAD3OUTH9ARRA
-
kayburton.com.aukayburton.com.au Albert Park. 9252 1800 Brighton. 9592 6522 Flinders. 5989 1000 Portsea. 5984 4744 South Yarra. 9820 1111
4065):"33""8BMTI4USFFU#PUBOJD(BSEFO1SFDJODU"OTHSTRIKINGINDESIGNANDLUXURIOUSINQUALITYISTHIS.ICHOLAS$AYGROUNDFLOORAPARTMENTINABOUTIQUEDEVELPMENTOFONLYTWO/FFERINGSPACIOUSBEDROOMSALLWITHENSSEPSTUDYBOTHFORMALINFORMALLIVINGZONESALLOPENINGOUTTOASUBSTANTIALNORTHFACINGTERRACE&EATSPRIVMULTICARGARAGESTOREROOM
!UCTION3ATURDAYTH.OVAM6IEW7EDNESDAYPM3ATURDAYAM
0ETER+UDELKA*ACQUI2ALPH4OORAK2OAD3OUTH9ARRA
4065):"33"8BMTI4USFFU5IF&QJUPNF0G$POUFNQPSBSZ-VYVSZ$ESIGNEDBY!RCHITECT2OBERT-ILLSTHISRESIDENCEISFLOODEDWITHNATURALLIGHTOFFERSAPERFECTBALANCEOFINDOOROUTDOORENTERTAININGSPACES&EAT"2SWITHENSOPENPLANLIVROOFTOPTERRACEWITHSPAPOOLFULLYINTEGRATED#"USSMARTWIRINGPRIVLIFTACCESSTOBASEMENTWINECELLARSTORAGEBASEMENTPARKING
%XPRESSIONSOF)NTEREST#LOSE-ONDAYND.OVPM6IEW7EDNESDAYPMPM
!NDREW"AINES$ARREN,EWENBERG4OORAK2OAD3OUTH9ARRA
-
kayburton.com.aukayburton.com.au Albert Park. 9252 1800 Brighton. 9592 6522 Flinders. 5989 1000 Portsea. 5984 4744 South Yarra. 9820 1111
.&-#063/&2VFFO4USFFU&YDFQUJPOBM7BMVF"OE-PDBUJPO4HISLANDMARKBEAUTYOFARCHITECTURALBRILLIANCEBYAWARDWINNINGARCHITECT.ONDA+ATSALIDISOFFERSNOTHINGBUTSHEERLUXURYFROMTHEMOMENTYOUSTEPINTOTHEFOYER4HISTHLEVEL"2BATHRMRESIDENCEOFFERSGREATPRIVACYOPENPLANLIVINGAREAWHEREYOUWILLNODOUBTENJOYTHEPANORAMICCITYVIEWS
!UCTION3ATURDAYTH.OVAM6IEW7EDNESDAYPMPM
*AMES(INDLE4OORAK2OAD3OUTH9ARRA
1035.&-#063/&%SZTEBMF4USFFU$POUFNQPSBSZ3FTJEFODF8JUI$JUZ7JFXT!RCHITECTURALLYDESIGNEDTHISBRANDNEWTOWNRESIDENCEISMOMENTSTO"AY3TREETSHOPSTRANSPORT/FFERING"2")2SPLUSSTUDYBATHOPENPLANKITCHENLIVINGDININGOPENINGOUTTOASUNFILLEDTERRACE!DD&EAT$,5'VIDEOINTERCOMALARMHEATCOOLAROOFTOPTERRACEIDEALFORENTERTAININGWITHVIEWSOFTHECITY
0RIVATE3ALE6IEW7EDNESDAYPMPM
4OM3TAUGHTON3TEPHANIE-ICHAEL!LEX3CHIAVO$UNDAS0LACE!LBERT0ARK
-
kayburton.com.aukayburton.com.au Albert Park. 9252 1800 Brighton. 9592 6522 Flinders. 5989 1000 Portsea. 5984 4744 South Yarra. 9820 1111
1035.&-#063/&/PUU4USFFU$POUFNQPSBSZ3FTJEFODF8JUI1FSJPE$IBSN!RCHITECTURALLYDESIGNEDOFFERINGBEDROOMSMAINWITHENSUITE")2SSTUDYTHBEDROOMAFURTHERBATHROOMSKITCHENWITHOPENPLANLIVINGDININGAREAOVERLOOKINGAMLAPPOOL!LSOFEATURINGBASEMENTHOMETHEATREROOMWITHBARGYMAREADUALSTREETFRONTAGESANDMOMENTSTO"AY3TREETSHOPS
!UCTION3ATURDAYTH.OVNOON6IEW7EDNESDAYPMPM
!LEX3CHIAVO4OM3TAUGHTON3TEPHANIE-ICHAEL$UNDAS0LACE!LBERT0ARK
&-800%5FOOZTPO4USFFU1BSLWJFX-JWJOH.FFUT1FOUIPVTF-JGFTUZMF0ENTHOUSELIVINGMEETSPARKSIDELIFEINTHIS6INCENT)NTERLANDIDESIGNED"2STUDYBATHROOMHOME7ITHPRIVATELIFTACCESSTHISMASTERPIECEHOMEHASLIVINGFLOWINGTOAWRAPAROUNDTERRACELUSHMASTERDOMAINDRESSRMDBLEENSUITEMARBLE%MPORITE-IELEKITCHEN#"53DBLEBMENTGARAGINGPLUSSTORE
%XPRESSIONSOF)NTEREST#LOSE-ONDAYTH.OVPM6IEW7EDNESDAYPM
3TEWART,OPEZ3TURT(INTON#HURCH3TREET"RIGHTON
-
kayburton.com.aukayburton.com.au Albert Park. 9252 1800 Brighton. 9592 6522 Flinders. 5989 1000 Portsea. 5984 4744 South Yarra. 9820 1111
#3*()50/$PDISBOF4USFFU*OGJOJUF1PTTJCJMJUJFT0VUTUBOEJOH1PTJUJPO4HISSUBSTANTIALALLOTMENTOFSQMSQFTAPPROXONTHECORNEROF%LM'ROVEPROVIDESEXCEPTIONALSCOPEFORRENOVATIONNEWHOMESITEORREDEVELOPMENT34#!'ENEROUSFORMALLOUNGEEXPANSIVELIVING/&0DININGGRANITEKITCHENMEALSBEDRMSBATHRMS$BLEGARAGE
!UCTION3ATURDAYTH.OVNOON6IEW7EDNESDAYPM
)AN*ACKSON'AIL0ULLEN#HURCH3TREET"RIGHTON
#3*()51SJDFT3PBE5IF#BSO#SJHIUT.PTU0VUTUBOEJOH1SPQFSUZ3ITUATEDON.THFACINGSIDEOFTHE/VENS6ALLEYINTHEHEARTOF"RIGHTISTHISUNIQUEHOME/FFEREDEITHERONENTIREACRESAPPROXORTHEHOMEONACRE0ROVIDINGBEDROOMSBATHROOMSSTUDYLRGELIVAREASSEPGUESTHOUSECARGARAGE
%XPRESSIONSOF)NTEREST#LOSE-ONDAYTH.OVPM6IEW"Y!PPOINTMENT#/.*$ICKENS2EAL%STATE"RIGHT'ERARD'REY
'OWAN3TUBBINGS-ATT$AVIS4OORAK2OAD3OUTH9ARRA
-
kayburton.com.aukayburton.com.au Albert Park. 9252 1800 Brighton. 9592 6522 Flinders. 5989 1000 Portsea. 5984 4744 South Yarra. 9820 1111
-*55-&3*7&3#SBODI3PBE"O&YUSBPSEJOBSZ-JGFTUZMF"XBJUT.ESTLEDBETWEEN-ELBOURNE'EELONGADJACENTTOTHE9OU9ANGSTHISUNIQUEPROPERTYFEATURESBEDROOMSBATHROOMSBRICKRESIDENCEWITHOPENPLANLIVINGFORMALDININGROOMSTUDYREARENTERTAINERSDECK&EATURINGTENNISCOURTPOOLPADDOCKSSTABLES
%XPRESSIONSOF)NTEREST#LOSE-ONDAYTH.OVPM6IEW"Y!PPOINTMENT#/.*!NDREW2ICE
'OWAN3TUBBINGS-ATT$AVIS4OORAK2OAD3OUTH9ARRA
#-"*3(083*&.PPOBI"WFOVFm$BQUJWBUJOH0DFBO4JEF-JWJOHn4HISMAGNIFICENTHOMEINATRANQUILSETTINGWITHREMARKABLEATTENTIONTODETAILISATIMELESSMASTERPIECESETINSQM&EATBDRMSBTHRMSOPLANLIVINGFORMALLOUNGEDININGSITTINGROOMALLFACINGESTABLISHEDLEVELGARDENTENNISCOURTPOOLSPAWATERFEATUREDBLECARPORTSTORAGEGAMESTROPHYROOMx
!UCTION3UNDAYST.OVPM6IEW3TRICTLYBYAPPOIN