how dna is packed in the cell: chromosomes, genes, …€¦ · 05/06/2014  · chromosomes, genes,...

56
How DNA Is Packed In The Cell: Chromosomes, Genes, Nucleosomes Brian D. Strahl Department of Biochemistry & Biophysics UNC-School of Medicine Summer Course in Biophysics June 5, 2014

Upload: others

Post on 02-Aug-2020

2 views

Category:

Documents


0 download

TRANSCRIPT

Page 1: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

How DNA Is Packed In The Cell: Chromosomes, Genes, Nucleosomes

Brian D. StrahlDepartment of Biochemistry & Biophysics

UNC-School of Medicine

Summer Course in Biophysics

June 5, 2014

Page 2: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

OutlineI. Chromatin organization

• The DNA packaging problem• Histones and nucleosome core particle• Chromatin folding and nuclear organization• Euchromatin vs Heterochromatin

II. Factors that influence chromatin organization and gene function• Histone post-translational modifications (PTMs) and the ‘histone code’• Histone variants• DNA methylation

III. Tools and technologies leading the charge in chromatin research• Modification-specific antibodies and chromatin immunoprecipitation• High-throughput microarray/DNA sequencing technologies• Proteomics and mass spectrometric analyses

Page 3: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

The DNA packaging problem

-E. Coli: 1X 1 million base pairs(Chlamydia trachomatis)

-Yeast genome: 12X 12 million base pairs

-Fruit fly genome: 122X 122 million base pairs

-Human genome: 3400X 3.4 billion base pairs

If our strands of DNA were stretched out in a line, the 46 chromosomes making up the human genome would extend more than six feet (~ 2 meters)

Page 4: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

Mount Everest image: http://www.unu.edu/mountains2002/photoexhibit/thehimalaya.htm

pipet tip image: Biologix Research

8850 meters (~5.5 miles)

0.0043 meters

(0.17 inches)

A Matter of Fitting In!

(slide provided by Raymond Reeves)

Page 5: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

How is DNA packaging achieved?

Page 6: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

Organization of eukaryotic chromatin

DNA double helix

NucleosomesHistones

Solenoid

Chromatin loop:~100,000 bp DNAChromatin

H3H2BH2AH4

Page 7: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

First order of DNA compaction

Page 8: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

Nucleosomes are the building blocks of chromatin

Page 9: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

Histone structure

• 2/3 of chromatin mass is protein• 95% of chromatin protein are histones

N CH1

“Tail” domain•Regulatory domain•Involved in higher-order packing

“Globular” domain•Histone-histone interactions•DNA wrapping

Page 10: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

Nucleosome organization

H3-H4 tetramers build a “wall” that is “capped” by H2A-H2B dimers

10

Page 11: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

Blue= H2A/H2BWhite= H3/H4

11

Page 12: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

Luger et al, Nature 1997

H3

H4

H2A

H2B H3 ‘tail’

Page 13: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

Luger et al, Nature 1997

H3

H4

H2A

H2B

Page 14: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School
Page 15: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

Second order of DNA compaction

Page 16: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

Secondary Structure

• H1 : essential for the solenoid structure

Page 17: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

Third order of DNA compaction

Page 18: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

Histone-depleted metaphase chromosome

Protein scaffold

Loops of DNA

Page 19: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

Histone-depleted metaphase chromosome

Scaffold/Matrix attachment regions

Page 20: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

A condensed metaphase human chromosome

Page 21: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School
Page 22: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

Genome architecture: chromatin domains

Page 23: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

Heterochromatin vs. Euchromatin

• Highly condensed• Repetitive sequences• Replicates later in the cell cycle• Transcriptionally OFF

• Decondensed• Single copy sequences (genes)• Replicates early in the cell cycle• Transcriptionally ON

Page 24: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

OutlineI. Chromatin organization

• The DNA packaging problem• Histones and nucleosome core particle• Chromatin folding and nuclear organization• Euchromatin vs Heterochromatin

II. Factors that influence chromatin organization and gene function• Histone post-translational modifications (PTMs) and the ‘histone code’• Histone variants• DNA methylation

III. Tools and technologies leading the charge in chromatin research• Modification-specific antibodies and chromatin immunoprecipitation• High-throughput microarray/DNA sequencing technologies• Proteomics and mass spectrometric analyses

Page 25: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

1. Chromatin remodeling complexes (e.g. Swi/Snf)

2. Histone modifications

Molecular mechanisms that influence chromatin structure and function

3. Histone variants (e.g. H2A.Z, CENP-A, etc.)

4. DNA methylation

Page 26: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

1. Chromatin remodeling complexes (e.g. Swi/Snf)

2. Histone modifications

Molecular mechanisms that influence chromatin structure and function

3. Histone variants (e.g. H2A.Z, CENP-A, etc.)

4. DNA methylation

Page 27: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

Histone CodeChromatinregulator

Tail Globular

Histone Modifications

AcetylationPhosphorylationMethylationADP-ribosylationUbiquitinationSumoylation

Page 28: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

Histone CodeChromatinregulator

Tail Globular

Histone Modifications

AcetylationPhosphorylationMethylationADP-ribosylationUbiquitinationSumoylation

Page 29: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

Histone acetylation and chromatin structure

(Adapted from Wade & Wolffe - Current Biology, 1997)

“Off” “On”

Page 30: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

Bromodomain-containing proteins can bind to acetylated histones

(Taken from E. Pennisi - Science, 2000)

(TBP)

TATAA

Page 31: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

Gardner, Allis & Strahl (2011) OPERating ON chromatin, a colorful language where context matters. J. Mol. Biol. 409:36-46.

Epigenetic ‘Toolkit’

Page 32: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

PHD bromoPHDDDT

PHDPHD tudor tudorJmjcJmjnJMJD2A

(demethylase)

BPTF(NURF)

Histone Code ‘readers’

bromo HMGBAHbromo bromo bromo bromo bromo BAH BAF180(SWI/SNF)

PHD chromo chromoPHD CHD4(NuRD)

DEXD HELIC

(Figure from Abcam)

PWWP

Page 33: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

Histone CodeChromatinregulator

Tail Globular

Histone Modifications

AcetylationPhosphorylationMethylationADP-ribosylationUbiquitinationSumoylation

Page 34: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

Histone CodeHP1

Tail Globular

Histone Modifications

K9

H3

AcetylationPhosphorylationMethylationADP-ribosylationUbiquitinationSumoylation

Page 35: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

Histone H3 methylation

Set1MLL

H34 9 27 36

N-ARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVK- Globular domain

Gene repressionHeterochromatin

X-inactivation

Dot1

K79

SUV39ESETG9a EZH2

Set2NSD1

Geneactivation

Gene repressionX-inactivation

Geneactivation

Page 36: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

Staining of female metaphase chromosomes with site-specific methyl H3 antibodies

methyl (Lys 9) H3 methyl (Lys 4) H3

(Taken from Boggs BA et al. - Nat Genet., 2002)

Page 37: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

(Taken from Bannister et al. - Nature, 2001)

On Off

K4 MeK9 Me

Roles of H3 lysines 4 and 9 methylation

Page 38: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

Post-translational modifications decorate histones

Page 39: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

1. Chromatin remodeling complexes (e.g. Swi/Snf)

2. Histone modifications

Molecular mechanisms that influence chromatin structure and function

3. Histone variants (e.g. H2A.Z, CENP-A, etc.) 4. DNA methylation

Page 40: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

HTZ1 (H2A.Z)

Figure from Millipore/Upstate

Page 41: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

Histone Variants

(HTZ1)

(Table from Henikoff and Ahmad, Annu. Rev. Cell Dev. Biol, 2005)

Page 42: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

1. Chromatin remodeling complexes (e.g. Swi/Snf)

2. Histone modifications

Molecular mechanisms that influence chromatin structure and function

3. Histone variants (e.g. H2A.Z, CENP-A, etc.)

4. DNA methylation

Page 43: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

DNA methylation

Occurs in:(1) select organisms and (2) usually at CpG dinucleotide

residues

1. Organisms found in:

HumansMiceFrogsFlies*(low levels and CpT)

2. Occurs on Cytosine:

Page 44: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

How DNA methylation regulates gene repression?

A) By sterically blocking the binding of transcription factors (e.g. E2F, NF-kB, CTCFB) & C) By recruiting chromatin modifying activitiesD) By affecting RNA Polymerase II transcription

HDACs

(figure from Klose & Bird, Trends Biochem Sci., 2006)

Page 45: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

OutlineI. Chromatin organization

• The DNA packaging problem• Histones and nucleosome core particle• Chromatin folding and nuclear organization• Euchromatin vs Heterochromatin

II. Factors that influence chromatin organization and gene function• Histone post-translational modifications (PTMs) and the ‘histone code’• Histone variants• DNA methylation

III. Tools and technologies leading the charge in chromatin research• Modification-specific antibodies and chromatin immunoprecipitation• High-throughput microarray/DNA sequencing technologies• Proteomics and mass spectrometric analyses

Page 46: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

Histone modification-specific antibodies have enabled the study of chromatin!

methyl (Lys 9) H3 methyl (Lys 4) H3

(Taken from Boggs BA et al. - Nat Genet., 2002)

Page 47: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

The ChIP-chip procedureCrosslink Chromatin with Formaldehyde

Shear Chromatin by Sonication

Hybridize To Microarray

Reverse CrosslinksRecover Input DNA

Amplify, Label Green

Incubate with Antibody

Reverse Crosslinks Recover IP DNA

Amplify, Label Red

(Provided by Jason Lieb, UNC)

Page 48: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

DNA(0.1-1.0 ug)

Single molecule arraySample

preparation Cluster growth5’

5’3’

G

T

C

A

G

T

C

A

G

T

C

A

C

A

G

TC

A

T

C

A

C

C

TAG

CG

TA

GT

1 2 3 7 8 94 5 6

Image acquisition Base calling

T G C T A C G A T …

Sequencing

Solexa Sequencing (Illumina)

Page 49: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

Enriched by ChIP

ChIP-Seq• Follow standard ChIP procedure

• Identify uniquely aligned sequences in human genome

Page 50: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

Mass spectrometry is a vital tool in combinatorial PTM discovery

A. Bottom-up MS

H3H3

RP-HPLC Trypsin RP-HPLCMS

ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA-134

B. Top-down MS

H3H3RP-HPLC HILIC

(hydrophilic interaction liquid chromatography)

MS

ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA-134

Page 51: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

Mass Spectrometry technologies have revealed novel histone ‘marks’ and specific histone codes

Page 52: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

Mass spectrometry is a vital tool in combinatorial PTM discovery

Page 53: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

SILAC-based approaches are unlocking identification of novel effector proteins

Beadpeptide Beadpeptide

Unlabeled extracts

Isotope-labeled extracts

Beadpeptide Beadpeptide

SDS/PAGE and tryptic digestion

m / z

(Stable isotope labeling by amino acids in cell culture)

Page 54: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

Bromodomain-containing proteins can bind to acetylated histones

(Taken from E. Pennisi - Science, 2000)

(TBP)

TATAAK4

PHD

Page 55: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

Semi-synthetic modified nucleosomes explore multivalent engagements in chromatin

HN

O

SH

HN

O

N+

HN

O

S

HN

O

N+

Br

base

Methyl-lysine analogue (MLA)(Shokat et al.)

methyl aminoethylhalide

H2NO

HS

HN

S

O

R

HN

O

SH

HN

O

NT peptide

NT peptide

thioester cysteine

peptide ligation

Native chemical ligation (NCL) and Expressed protein ligation(EPL)

(Kent/Cole/Muir labs)

Page 56: How DNA Is Packed In The Cell: Chromosomes, Genes, …€¦ · 05/06/2014  · Chromosomes, Genes, Nucleosomes. Brian D. Strahl. Department of Biochemistry & Biophysics. UNC-School

Thank you!