drives and controls abb micro drives acs250 price list … · abb micro drives acs250 price list....

Drives and controls

ABB Micro DrivesACS250 price list

CONFIDENTIAL: DO NOT COPY. DO NOT DISTRIBUTE

ABB ACS250 price list 3CONFIDENTIAL: DO NOT COPY. DO NOT DISTRIBUTE

ACS250 price listTable of contents

ACS250 IP20

Overview 5

Type code sheet 6

Data sheet 7

List prices 8

Frame options 9

Options 10

Dimensions and weights 11

ACS250 IP66

Overview 13

Type code sheet 14

Data sheet 15

List prices 16

Frame options 17

Options 18

Dimensions and weights 19

ACS250 IP20 & IP66

Braking resistors 20

Resistor technical data 25

Additional resources

QR codes 26

Drive life cycle 27

Glossary of terms 28

4 ABB ACS250 price list CONFIDENTIAL: DO NOT COPY. DO NOT DISTRIBUTE CONFIDENTIAL: DO NOT COPY. DO NOT DISTRIBUTE

ACS250 Drive selection chart

ACS250 IP20 ACS250 IP66 - NEMA 4X

Main attributes Main attributes

Feed-thru wiring, embedded Modbus-RTU, built-in macros for simple machine interface

Wide range of input voltages, high protection class enclosure for harsh environments, Modbus-RTU as standard

HP range HP range

1~115 V - 0.5 to 1.5 HP3~600 V - 0.75 - 20 HP

1~115 V - 0.5 to 1.5 HP1~230 V - 0.5 to 3 HP3~230 V - 0.5 to 5 HP3~460 V - 1 to 10 HP3~600 V - 0.75 - 15 HP

Voltage range Voltage range

1~120 V In / 3~ 230 V Out3~600 V In / Out

1~115 V In / 3~230 V Out1~230 V In / 3~230 V Out3~230 V In / Out3~460 V In / Out3~600 V In / Out

Enclosure type Enclosure type

UL type 0 (IP20) UL type 4X (IP66)

Control mode Control mode

Scalar (V/Hz) variable torque and constant torque V/Hz profiles Scalar (V/Hz) variable torque and constant torque V/Hz profiles

Communications options Communications options

Embedded Modbus-RTU Embedded Modbus-RTU

Operator interface Operator interface

Integral and/or remote mount keypad

Integral and/or remote mount keypad


Replacing a motor starter or soft starter with a drive can help your customer improve their overall energy efficiency, reduce mechanical stresses and enhance their process control. With its feed-thru wiring, the ACS250 can easily replace motor starters for general purpose low power applications, such as; augers, mixers, pumps, fans and conveyors. The key features include a integrated keypad for easy configuration, precise process control with an enhanced V/Hz control with variable torque and constant torque V/Hz profiles, and embedded, Modbus-RTU communication interface for real time control and monitoring.

Main features

- Integrated display and keypad - Feed-thru wiring- 50°C no de-rate / 60°C max.- Built-in macros and only the essential parameters make commissioning straightforward - Enhanced V/Hz control (all models)- Adjustable current limit- Power loss ride-through - DC injection braking- DC magnetizing start (provides maximum starting torque)- Internal braking chopper (except frame E1) -Modbus-RTUfieldbusasstandard - Open loop vector - speed & torque control (600 V only) - SIL2 Safe torque-off (600 V only) Applications

- Variable torque, constant torque or constant horsepower applications requiring a compact drive solution for cabinet mounting

Capabilities

- V/Hz control with peak overload capacity of 175%- Feed-thru wiring DIN rail mountable IP20 enclosure- Intuitive integrated keypad - Designed to be easy to program for simple machine interface

ACS250 IP20 Overview


ACS250 IP20Type code sheet

A 5SC 02

A 5SC 02

- -

- X

-Product code

1 - 250 HP, wall mount and floor standing

1...6

7...10

Product series

Phase

-11...15 Nominal current

Phase: -01 = single phase, -03 = three phase

EMC info (X): -U=noEMCfilter,-E=includesEMCfilter

-16...17 Supply voltage

1 = 115 V 6 = 600 V

Frame size E1 Frame size E2 Frame size P2 Frame size P3

115 V 02A3, 04A3 02A3, 04A3 02A3, 04A3 02A3, 04A3

600 V 02A1, 03A1, 04A1,

06A5, 09A0

12A0, 17A0, 22A0


ACS250 IP20Data sheet

Performance features Control modes 115 VAC: V/Hz

600 VAC: V/Hz and open loop vector

Operator interface module Integral drive mounted

Display lines 6-character LED display

Programmable preset speeds Four

Analog output: one One (0-10 VDC)

Auto restart Yes – up to 5 attempts

Frequency avoidance One band

Fault history Last four faults

Digital inputs: four Two programmable digital inputs, two user selectable analog/digital inputs

Digital inputs type Pull-up

Drive specifications Analog inputs: two 0-10 VDC, 4 to 20mA

Relay output: one Built-in form C relay

Analog output / digital outout 0-10 VDC: one analog usable for meter (freq., current, voltage) or digital output

Overload capacity Drive output 150% for one minute and 175% for 2 seconds

Maximum load 1.5 HP @ 120 V In/230 V Out, 20 HP @ 600 V In/Out

Input voltage ranges 115 VAC (99-126); 600 VAC (450-660)

Rated input frequency 50-60 Hz (±5%)

Carrier frequency 4-32 kHz (8 kHz default)

Operating temperature -10° to 50°C

Snubber (dynamic braking) Built-in transistor (frames 2 and 3)

Dynamic braking external Up to 150% dynamic braking with appropriately sized resistor

DC injection braking Included

Volts/Hz LinearV/Hz,userdefined,energyoptimizer&boostfunction

Frequency control range 0-500 Hz

Accel/decel: Independently adjustable accel. & decel. ramps

Time range 0.00 to 600.0 Seconds

Keypad speed control Yes

Sink/source inputs Source, 24 VDC logic

Electronic overload trip Electronic motor overload inverse 150% for 1 minute or 175% for 2 seconds

Communications Built-in Modbus-RTU (RS-485) communications

PI control Built-in

Protective features Under voltage Level depends on voltage class ($408)

Output short circuit Phase-to-phase on drive output

Over temperature Heat sink monitor

DC bus overvoltage DC bus level trip

Drive overload Exceed drive rating of 150% for one minute or 175% for 2 seconds

Over current Over-current/short-circuit protection

Output phase Trips on open output phase

Loss of reference Trips on loss of speed command signal

Communication error Detects a communication error (fault)

Agency certifications UL, cUL, CE, C-tick, gost

Service conditions Altitude 1,000 m (3,300 ft.), derate by 1% per 100M up to 2,000 on maximum

Ambient temperature -10°C (14°F) to 50°C (102°F)

Storage temperature: -40°C (-40°F) to 60°C (140°F)

Relative humidity 10% to 95%, non-condensing

0.5 thru 1.5 HP (1~115 V In/ 3~230V Out) 1 thru 20 HP (3~600 V In/Out)


ACS250 IP20 List prices

Type codeBraking chopper (included)

PN

HP

Output currentI2N

A

Weight (lbs)

Frame size List price

1-phase supply voltage 110 to 120 V, +/-10%, 3-phase output 200 to 240 V

ACS250-01U-02A3-1 - 0.5 2.3 2.2 E1 $408

ACS250-01U-04A3-1 - 1.0 4.3 2.2 E1 $450

ACS250-01U-05A8-1 X 1.5 5.8 3.75 E2 $552

3-phase supply voltage 500 to 600 V, +/-10%

ACS250-03U-02A1-6 X 1.0 2.1 4.0 P2 $602

ACS250-03U-03A1-6 X 2.0 3.1 4.0 P2 $782

ACS250-03U-04A1-6 X 3.0 4.1 4.0 P2 $869

ACS250-03U-06A5-6 X 5.0 6.5 4.0 P2 $1,043

ACS250-03U-09A0-6 X 7.5 9.0 4.0 P2 $1,459

ACS250-03U-12A0-6 X 10.0 12.0 7.7 P3 $1,751

ACS250-03U-17A0-6 X 15.0 17.0 7.7 P3 $2,291

ACS250-03U-22A0-6 X 20 22 7.7 P3 $2,917

IP20 drive ratings


ACS250 IP20 Frame options

ACS250 IP20 - 120 V ACS250 IP20 - 600 V


ACS250 IP20 options (these options will be shipped separately from drive shipping package)

Code Variant Description Field kitVoltage rating

120 V 600 V

N/ARCCS-01 copying tool

Copy stick, which is used to upload and download the parameters through RJ45 connectionParameters can only be copied between drives of the same product range and power rating (size)

RCCS-01 $234 $234

N/ARCRO-01 relay output card

The second relay output module can be used in applications where the analog output from the drive is converted to a relay output.

Max relay switching voltage: 250 VAC/220 VDCMax relay switching current: 1AMax input voltage: +/- 50 VDCEnvironmental: -10ºC … +50ºCConformity: IP00, UL94V-0

RCRO-01 $140 NA

N/ARCRP-01 external LED keypad

Remote keypad that can be added through RJ45 connection.

Signal interface: standard 6-way RJ45 connectorSupply input: 10V … 36 VDC, 30mARS485 signal: industry standard 2-wire +5V differentialEnvironmental: operational 0 … 50 °CStorage: -40°C … 60°CRelative humidity: < 95% (non condensing)Protection rating: IP54Max cable length: 20m (unscreened, total length)100m (screened, twisted pair, total length)

RCRP-01 $106 $106

N/ARCRJ-01RJ45 Y-cable splitter

The data cable splitter is a 3-way “Y” cable splitter suitable for a RS-485 network of drives. The option is compatible with standard CAT 5 or CAT 6 type cable and can be used for Modbus-RTU or an RS-485 remote keypad network.

RCRJ-01 $59 $59

N/A

RCNT-01RJ45 Y-cable splitter w/ term.

The data cable splitter with terminal block is a 3-way “Y” cable splitter with one terminal block suitable for an RS-485 network of drives. Two of the three connections are compatible with standard CAT 5 or CAT 6 type cable and the third is a terminal block that can be used to connect a PLC or network terminating resistor.

RCNT-01 $183 $183

N/AACS250democase

Powered by 115 VAC, the program case does includes an ACS250 drive and IO board with switches, speed potentiometer and LED. Ideal for demonstrating the programability of the ACS250. There is no motor included in this democase

ACS250-DEMOCASE

$2,000 NA

ACS250 IP20Options


Frame size

Dimensions and weightsDimensiondrawing

IP20 120 VHeight Width Depth Weight

in mm in mm in mm lb kgE1 6.81 173 3.23 82 4.84 123 2.20 1 3AXD10000274006E2 8.70 221 4.29 109 5.91 150 3.75 1.70 3AXD10000274008

Framesize


IP20 600 VHeight Width Depth Weightin mm in mm in mm lb kg

P2 8.70 221 4.41 112 7.28 185 4 1.80 3AXD10000274014

P3 10.28 261 5.16 131 8.07 205 7.70 3.50 3AXD10000274016

H = HeightW = WidthD = Depth


120 V

600 V

ACS250 IP20 Dimensions and weights

W

H

D

12

H

DW


Notes


Augers, mixers, pumps, fans and conveyors are commonly installed in harsh environments containing dust, moisture and chemicals. The IP66/NEMA 4X ACS250 was designed to thrive in these types of conditions. The drive’s design and ease ofsetupbenefitabroadrangeofindustriesthatrequiremachinemounted drives.

Hygienic protection

The drive was designed with materials that meet stringent hygiene standards, preventing the drive from trapping bacteria. The integrated keypad provides straightforward drive commissioning and maintenance in extreme environments. The drive’s sealed ABS enclosure and corrosion-resistant heat sink are ideal for wash-down applications.

Main features - Built-in macros and only the essential parameters make commissioning straightforward- Can be mounted directly on processing equipment installed in extreme environments - Conduit cable entry - Intuitive keypad control - Optional switch features; speed potentiometer, FWD-OFF-REV and disconnect switches- IP66/NEMA 4X dust and waterproof design - Designed for wash-down applications - Specially coated corrosion-resistant heat sink - No cooling fans to replace -Modbus-RTUfieldbusasstandard- Built-in brake chopper (except frame E1)- Safe torque off function (SIL2) which can be used as emergency stop or to prevent unexpected startup (600 V only)- Open loop vector speed and vector torque control mode (600 V only)

Applications - Variable torque, constant torque or constant horsepower applications in harsh environments or requiring on machine mounting

Capabilities

- NEMA 4X IP66 enclosure for indoor use- V/Hz control with peak overload capacity of 175%- Embedded Modbus-RTU- Intuitive integrated keypad- Designed to be easy to program for simple machine interface local control & disconnect

ACS250 IP66 Overview


ACS250 IP66Type code sheet

A 5SC 02

A 5SC 02

- -

- X

-

-

+

+

B

F

6

7

0

2

3

8

-Product code

1 - 250 HP, wall mount and floor standing

1...6

7...10

11...15

16...17

18...22

23...27

Product series

Phase

Nominal current

Supply voltage

NEMA 4X (IP66) enclosure protection class

Optional switch

Phase: -01 = single phase, -03 = three phase

EMC info (X): -U=noEMCfilter,-E=includesEMCfilter

1 = 115 V 2 = 230 V 4 = 460 V 6 = 600 V

B063 = NEMA 4X (IP66)

+

Frame size E1 Frame size E2 Frame size E3 Frame size P2 Frame size P3

115 V 02A3, 04A3 05A8

230 V 02A3, 04A3,

07A0

10A5 18A0

460 V 02A2, 04A1 05A8, 09A5 14A0, 18A0

600 V 02A1, 03A1, 04A1,

06A5, 09A0

12A0, 17A0


0.5 thru 1.5 HP (1~115 V In/ 3~230V Out) 0.5 thru 3 HP (1~230 V In/ 3~230V Out) 0.5 thru 5 HP (3~230 V In/Out) 1 thru 10 HP (3~460 V In/Out) 1 thru 15 HP (3~600 V In/Out)

ACS250 IP66Data sheet

Performance features Control modes 115-460 VAC: V/Hz

600 VAC: V/Hz and open loop vector

Operator interface module Integral drive mounted

Display lines 6-character LED display

Programmable preset speeds Four

Analog output: one One (0-10 VDC)

Auto restart Yes- Up to 5 attempts

Frequency avoidance One band

Fault history Last four faults

Digital Inputs: four Threeconfigurableinputs

Digital inputs type Pull-up

Drive specifications Analog inputs: two 0-10 VDC, 4 to 20mA

Relay output: one One built-in form C relay

Analog output / digital output 0-10 VDC: one analog usable for meter (freq., current, voltage) or digital output

Maximum load 5 HP @ 230 VAC, 10 HP @ 460 VAC, 15 HP @ 600 VAC

Overload capacity Drive output 150% for one minute and 175% for 2 seconds

Input voltage ranges 115 VAC (99-126); 230 VAC (198-264); 460 VAC (342-528); 600 VAC (450-660)

Rated input frequency 50-60 Hz (±5%)

Carrier frequency 4-32 kHz (8 kHz default)

Operating temperature -10° to 40°C

Snubber (dynamic braking) Built-in transistor (frames 2 and 3)

Dynamic braking external Up to 150% dynamic braking with appropriately sized resistor

DC injection braking Included

Volts/Hz LinearV/Hz,userdefined,energyoptimizer&boostfunction

Frequency control range 0-500 Hz

Accel/decel: Independently adjustable accel. & decel. ramps

Time range 0.00 to 600.0 seconds

Keypad speed control Yes

Sink/source inputs Source, 24 VDC logic

Electronic overload trip Electronic motor overload inverse 150% for 1 minute or 175% for 2 seconds

Communications Built-in Modbus-RTU (RS-485) communications

PI control Built-in

Protective features Under voltage Level depends on voltage class (120, 240, 480, or 575)

Output short circuit Phase-to-phase on drive output

Over temperature Heat sink monitor

DC bus overvoltage DC Bus level trip

Drive overload Exceed drive rating of 150% for one minute or 175% for 2 seconds

Over current Over-current/short-circuit protection

Output phase Trips on open output phase

Loss of reference Trips on loss of speed command signal

Communication error Detects a communication error (fault)

Agency certifications UL, cUL, CE, C-tick, Gost

Service conditions Altitude 1,000 m (3,300 ft.), derate by 1% per 100M up to 2,000m maximum

Ambient temperature -10°C (14°F) to 40°C (122°C)

Storage temperature: -40°C (-40°F) to 60°C (140°F)

Relative humidity 10% to 95%, non-condensing

Intermittent overload 150% overload capacity for up to 1 minute, 175% overload capacity for up to 2 seconds


ACS250 IP66List prices

Type codeBraking chopper (included)

PN

HP

Output currentI2N

A

Weight(lbs)

Frame size List priceOptional

switch (+F278)

1-phase supply voltage 110 to 120V, +/-10%, 3-phase output 200 to 240 V

ACS250-01U-02A3-1+B063 - 0.5 2.3 6.5 E1 $757 $936

ACS250-01U-04A3-1+B063 - 1.0 4.3 6.5 E1 $836 $1,010

ACS250-01U-05A8-1+B063 X 1.5 5.8 9.3 E2 $1,018 $1,151

1-phase supply voltage 200 to 240V, +/-10%, 3-phase output 200 to 240 V

ACS250-01U-02A3-2+B063 - 0.5 2.3 6.5 E1 $723 $832

ACS250-01U-04A3-2+B063 - 1.0 4.3 6.5 E1 $795 $893

ACS250-01U-07A0-2+B063 - 2.0 7.0 6.5 E1 $853 $1,004

ACS250-01U-10A5-2+B063 X 3.0 10.5 9.3 E2 $982 $1,122


ACS250-03U-02A3-2+B063 - 0.5 2.3 6.5 E1 $660 $780

ACS250-03U-04A3-2+B063 - 1 4.3 6.5 E1 $717 $813

ACS250-03U-07A0-2+B063 X 2.0 7.0 9.3 E2 $824 $974

ACS250-03U-10A5-2+B063 X 3.0 10.5 9.3 E2 $950 $1,122

ACS250-03U-18A0-2+B063 X 5.0 18.0 17.0 E3 $1,353 $1,500


ACS250-03U-02A2-4+B063 - 1.0 2.2 6.5 E1 $777 $896

ACS250-03U-04A1-4+B063 - 2.0 4.1 6.5 E1 $911 $1,040

ACS250-03U-05A8-4+B063 X 3.0 5.8 9.3 E2 $1,027 $1,175

ACS250-03U-09A5-4+B063 X 5.0 9.5 9.3 E2 $1,275 $1,411

ACS250-03U-14A0-4+B063 X 7.5 14.0 17.0 E3 $1,646 $1,765

ACS250-03U-18A0-4+B063 X 10.0 18.0 17.0 E3 $1,952 $2,118


ACS250-03U-02A1-6+B063 X 1.0 2.1 10.6 P2 $1,285 $1,462

ACS250-03U-03A1-6+B063 X 2.0 3.1 10.6 P2 $1,484 $1,649

ACS250-03U-04A1-6+B063 X 3.0 4.1 10.6 P2 $1,697 $1,849

ACS250-03U-06A5-6+B063 X 5.0 6.5 10.6 P2 $1,946 $2,082

ACS250-03U-09A0-6+B063 X 7.5 9.0 10.6 P2 $2,455 $2,559

ACS250-03U-12A0-6+B063 X 10.0 12.0 16.1 P3 $2,925 $3,096

ACS250-03U-17A0-6+B063 X 15.0 17.0 16.1 P3 $4,297 $4,424

IP66 drive ratings


ACS250 IP66Frame options

ACS250+B063+F278 ACS250+B063


ACS250 IP66 options (these options will be shipped separately from drive shipping package)

Code Variant Description Field kitVoltage rating

120 V 600 V

N/ARCCS-01 copying tool

Copy stick, which is used to upload and download the parameters through RJ45 connectionParameters can only be copied between drives of the sameproduct range and power rating (size)

RCCS-01 $234 $234

N/ARCRO-01 relay output card

The second relay output module can be used inapplications where the analog output from the drive isconverted to a relay output.

Max relay switching voltage: 250 VAC/220 VDCMax relay switching current: 1AMax input voltage: +/- 50 VDCEnvironmental: -10ºC … +50ºCConformity: IP00, UL94V-0

RCRO-01 $140 N/A

N/ARCRP-01 external LED keypad

Remote panel that can be added through RJ45 connection.

Signal interface: standard 6-way RJ45 connectorSupply input: 10V … 36 VDC, 30mARS485 signal: industry standard 2-wire +5V differentialEnvironmental: operational 0 … 50°CStorage: -40°C … 60°CRelative humidity: < 95% (non condensing)Protection rating: IP54Max cable length: 20m (unscreened, total length)100m (screened, twisted pair, total length)

RCRP-01 $106 $106

N/ARCRJ-01RJ45 Y-cable splitter

The data cable splitter is a 3-way “Y” cable splitter suitable for a RS-485 network of drives. The option is compatible with standard CAT 5 or CAT 6 type cable and can be used for Modbus-RTU or an RS-485 remote keypad network.

RCRJ-01 $59 $59

N/ARCNT-01RJ45 Y-cable splitter w/ term.

The data cable splitter with terminal block is a 3-way “Y” cable splitter with one terminal block suitable for an RS-485 network of drives. Two of the three connections are compatible with standard CAT 5 or CAT 6 type cable and the third is a terminal block that can be used to connect a PLC or network terminating resistor.

RCNT-01 $183 $183

ACS250 IP66 Options


ACS250 IP66 Dimensions and weights

Frame size


IP66 120, 240 & 480 VHeight Width Depth Weightin mm in mm in mm lb kg

E1 9.13 232 6.34 161 7.05 179 6.50 2.95 3AXD10000274009

E2 10.12 257 7.40 188 7.34 186 9.26 4.20 3AXD10000274011

E3 12.20 310 8.29 210 9.00 229 16.97 7.70 3AXD10000274012

Frame size


IP66 600 VHeight Width Depth Weightin mm in mm in mm lb kg

P2 10.12 257 7.40 188 9.41 239 10.60 4.80 3AXD10000274017P3 12.20 310 8.29 211 9.88 251 16.10 7.30 3AXD10000274018

W

H

D

120, 240 & 480 V

600 V



H

W D


Single-phase 100-120 V applications, stopping duty only

Type CR resistors (availale for the small HP drives as listed below)

DutyCycle=3sec on/27sec off DutyCycle=10sec on/50sec off

Drive type code HP CR part no. Ohms Watts List price CR part no. Ohms Watts List price

ACS250-01U-05A8-1 1.5 P14494-CR-06 50 100 $87 P14494-CR-18 50 200 $104



ACS250-01U-05A8-1 1.5 P14494-CR-24 50 300 $139 P14494-CR-32 50 400 $174

Standard enclosed resistor packages


Drive type code HP Resistor part no. Ohms Watts List price Resistor part no. Ohms Watts List price

ACS250-01U-05A8-1 1.5 P14494-24 45 300 $223 P14494-24 45 300 $223



ACS250-01U-05A8-1 1.5 P14494-24 45 300 $223 P14494-24 45 300 $223

Notes: To determine resistor type, dimensions and weights refer to Resistor Technical Data Tables

ACS250 IP20 & IP66Braking resistors






ACS250-01U-05A8-1 1.5 P14494-CR-06 50 100 $87 P14494-CR-18 50 200 $104



ACS250-01U-05A8-1 1.5 P14494-CR-24 50 300 $139 P14494-CR-32 50 400 $174




ACS250-01U-05A8-1 1.5 P14494-24 45 300 $223 P14494-24 45 300 $223



ACS250-01U-05A8-1 1.5 P14494-24 45 300 $223 P14494-24 45 300 $223


ACS250 IP66Braking resistors





ACS250-01U-10A5-2 3 P14494-CR-12 50 150 $104 P14494-CR-24 50 300 $139



ACS250-01U-10A5-2 3 P14494-CR-32 50 400 $174




ACS250-01U-10A5-2 3 P14494-31 35 300 $223 P14494-31 35 300 $223



ACS250-01U-10A5-2 3 P14494-32 35 820 $337 P14494-32 35 820 $337



ACS250 IP66 Braking resistors

Three-phase 200-240 V applications, stopping duty only




ACS250-03U-07A0-2 2 P14494-CR-06 50 100 $87 P14494-CR-18 50 200 $122

ACS250-03U-10A5-2 3 P14494-CR-12 50 150 $104 P14494-CR-24 50 300 $139

ACS250-03U-18A0-2 5 P14494-CR-26 40 300 $139 P14494-CR-34 40 400 $174



ACS250-03U-07A0-2 2 P14494-CR-24 50 300 $140 P14494-CR-32 50 400 $174

ACS250-03U-10A5-2 3 P14494-CR-32 50 400 $174




ACS250-03U-07A0-2 2 P14494-31 35 300 $223 P14494-31 35 300 $223

ACS250-03U-10A5-2 3 P14494-31 35 300 $223 P14494-31 35 300 $223

ACS250-03U-18A0-2 5 P14494-31 35 300 $223 P14494-32 35 820 $337



ACS250-01U-07A0-2 2 P14494-31 35 300 $223 P14494-32 35 820 $337

ACS250-01U-10A5-2 3 P14494-32 35 820 $337 P14494-32 35 820 $337

ACS250-03U-18A0-2 5 P14494-32 35 820 $337 P14494-32 35 820 $337



ACS250 IP66 Braking resistors





ACS250-03U-07A0-2 2 P14494-CR-06 50 100 $87 P14494-CR-18 50 200 $122

ACS250-03U-10A5-2 3 P14494-CR-12 50 150 $104 P14494-CR-24 50 300 $139

ACS250-03U-18A0-2 5 P14494-CR-26 40 300 $139 P14494-CR-34 40 400 $174



ACS250-03U-07A0-2 2 P14494-CR-24 50 300 $140 P14494-CR-32 50 400 $174

ACS250-03U-10A5-2 3 P14494-CR-32 50 400 $174




ACS250-03U-07A0-2 2 P14494-31 35 300 $223 P14494-31 35 300 $223

ACS250-03U-10A5-2 3 P14494-31 35 300 $223 P14494-31 35 300 $223

ACS250-03U-18A0-2 5 P14494-31 35 300 $223 P14494-32 35 820 $337



ACS250-01U-07A0-2 2 P14494-31 35 300 $223 P14494-32 35 820 $337

ACS250-01U-10A5-2 3 P14494-32 35 820 $337 P14494-32 35 820 $337

ACS250-03U-18A0-2 5 P14494-32 35 820 $337 P14494-32 35 820 $337


ACS250 IP66Braking resistors





ACS250-03U-04A1-4 2 P14494-CR-03 150 100 $87 P14494-CR-15 150 200 $122

ACS250-03U-05A8-4 3 P14494-CR-11 100 150 $104 P14494-CR-22 100 300 $139

ACS250-03U-09A5-4 5 P14494-CR-22 100 300 $139 P14494-CR-30 100 400 $174

ACS250-03U-14A0-4 7.5 P14494-CR-32 50 400 $174



ACS250-03U-04A1-4 2 P14494-CR-21 150 300 $139 P14494-CR-29 150 400 $174

ACS250-03U-05A8-4 3 P14494-CR-30 100 400 $174




ACS250-03U-04A1-4 2 P14494-15 150 300 $223 P14494-15 150 300 $223

ACS250-03U-05A8-4 3 P14494-15 150 300 $223 P14494-15 150 300 $223

ACS250-03U-09A5-4 5 P14494-19 75 300 $223 P14494-20 75 600 $337

ACS250-03U-14A0-4 7.5 P14494-25 45 800 $337 P14494-25 45 800 $337

ACS250-03U-18A0-4 10 P14494-25 45 800 $337 P14494-26 45 1260 $433



ACS250-03U-04A1-4 2 P14494-15 150 300 $223 P14494-16 150 600 $337

ACS250-03U-05A8-4 3 P14494-16 150 600 $337 P14494-16 150 600 $337

ACS250-03U-09A5-4 5 P14494-20 75 600 $337 P14494-21 75 1000 $433

ACS250-03U-14A0-4 7.5 P14494-26 45 1260 $433 P14494-27 45 1920 $626



ACS250 IP20 & IP66Braking resistors





ACS250-03U-02A1-6 1.5 P14494-CR-02 200 100 $87 P14494-CR-13 250 200 $122

ACS250-03U-03A1-6 2 P14494-CR-08 250 150 $104 P14494-CR-19 250 300 $139

ACS250-03U-04A1-6 3 P14494-CR-22 100 300 $139 P14494-CR-30 100 400 $174

ACS250-03U-06A5-6 5 P14494-CR-22 100 300 $139



ACS250-03U-02A1-6 1.5 P14494-CR-19 250 300 $139 P14494-CR-27 250 400 $174

ACS250-03U-03A1-6 2 P14494-CR-19 250 300 $139 P14494-CR-27 250 400 $174

ACS250-03U-04A1-6 3 P14494-CR-27 250 400 $174




ACS250-03U-02A1-6 1.5 P14494-11 250 300 $223 P14494-11 250 300 $223

ACS250-03U-03A1-6 2 P14494-11 250 300 $223 P14494-11 250 300 $223

ACS250-03U-04A1-6 3 P14494-11 250 300 $223 P14494-11 250 300 $223

ACS250-03U-06A5-6 5 P14494-13 200 300 $223 P14494-14 200 600 $337



ACS250-03U-02A1-6 1.5 P14494-11 250 300 $223 P14494-11 250 300 $223

ACS250-03U-03A1-6 2 P14494-11 250 300 $223 P14494-11 250 300 $223

ACS250-03U-04A1-6 3 P14494-12 250 600 $337 P14494-12 250 600 $337

ACS250-03U-06A5-6 5 P14494-14 200 600 $337 P14494-18 150 1200 $529

ACS250-03U-09A0-6 7.5 ABB-48431-052 80 800 $337 P14494-63 80 1050 $433

ACS250-03U-12A0-6 10 P14494-62 63 800 $337 ABB-48431-140 63 1200 $433

ACS250-03U-17A0-6 15 ABB-41163 35 900 $433 P14494-34 35 1600 $529

ACS250-03U-22A0-6 20 P14494-33 35 1200 $433 ABB-44534 40 2010 $626







ACS250-03U-02A1-6 1.5 P14494-CR-02 200 100 $87 P14494-CR-13 250 200 $122

ACS250-03U-03A1-6 2 P14494-CR-08 250 150 $104 P14494-CR-19 250 300 $139

ACS250-03U-04A1-6 3 P14494-CR-22 100 300 $139 P14494-CR-30 100 400 $174

ACS250-03U-06A5-6 5 P14494-CR-22 100 300 $139



ACS250-03U-02A1-6 1.5 P14494-CR-19 250 300 $139 P14494-CR-27 250 400 $174

ACS250-03U-03A1-6 2 P14494-CR-19 250 300 $139 P14494-CR-27 250 400 $174

ACS250-03U-04A1-6 3 P14494-CR-27 250 400 $174




ACS250-03U-02A1-6 1.5 P14494-11 250 300 $223 P14494-11 250 300 $223

ACS250-03U-03A1-6 2 P14494-11 250 300 $223 P14494-11 250 300 $223

ACS250-03U-04A1-6 3 P14494-11 250 300 $223 P14494-11 250 300 $223

ACS250-03U-06A5-6 5 P14494-13 200 300 $223 P14494-14 200 600 $337



ACS250-03U-02A1-6 1.5 P14494-11 250 300 $223 P14494-11 250 300 $223

ACS250-03U-03A1-6 2 P14494-11 250 300 $223 P14494-11 250 300 $223

ACS250-03U-04A1-6 3 P14494-12 250 600 $337 P14494-12 250 600 $337

ACS250-03U-06A5-6 5 P14494-14 200 600 $337 P14494-18 150 1200 $529

ACS250-03U-09A0-6 7.5 ABB-48431-052 80 800 $337 P14494-63 80 1050 $433

ACS250-03U-12A0-6 10 P14494-62 63 800 $337 ABB-48431-140 63 1200 $433

ACS250-03U-17A0-6 15 ABB-41163 35 900 $433 P14494-34 35 1600 $529

ACS250-03U-22A0-6 20 P14494-33 35 1200 $433 ABB-44534 40 2010 $626


ACS250 IP20 & IP66Resistor technical data

Part number Ohms Watts Encl Dimensions W x D x H (inches)

Weight(lbs)

List price

P14494-11 250 300 GCE1 12W x 5D x 5H 7 $223

P14494-12 250 600 GCE2 12W x 7D x 5H 10 $337

P14494-13 200 300 GCE1 12W x 5D x 5H 7 $223

P14494-14 200 600 GCE2 12W x 7D x 5H 10 $337

P14494-15 150 300 GCE1 12W x 5D x 5H 7 $223

P14494-16 150 600 GCE2 12W x 7D x 5H 10 $337

P14494-18 150 1200 GCE4 12W x 13D x 5H 16 $529

P14494-19 75 300 GCE1 12W x 5D x 5H 7 $223

P14494-20 75 600 GCE2 12W x 7D x 5H 10 $337

P14494-21 75 1000 GCE3 12W x 10D x 5H 13 $433

P14494-25 45 800 GCE2 12W x 7D x 5H 10 $337

P14494-26 45 1260 GCE3 12W x 10D x 5H 13 $433

P14494-27 45 1920 GCE5 12W x 16D x 5H 18 $626

P14494-31 35 300 GCE1 12W x 5D x 5H 7 $223

P14494-32 35 820 GCE2 12W x 7D x 5H 10 $337

P14494-34 35 1600 GCE4 12W x 13D x 5H 16 $529

P14494-CR-02 200 100 CR100 6W x 1.5D x 0.75H 1 $87

P14494-CR-03 150 100 CR100 6W x 1.5D x 0.75H 1 $87

P14494-CR-06 50 100 CR100 6W x 1.5D x 0.75H 1 $87

P14494-CR-08 250 150 CR150 9W x 1.5D x 0.75H 1 $104

P14494-CR-11 100 150 CR150 9W x 1.5D x 0.75H 1 $104

P14494-CR-12 50 150 CR150 9W x 1.5D x 0.75H 1 $104

P14494-CR-13 250 200 CR200 6W x 3D x 1.5H 2 $122

P14494-CR-15 150 200 CR200 6W x 3D x 1.5H 2 $122

P14494-CR-18 50 200 CR200 6W x 3D x 1.5H 2 $122

P14494-CR-19 250 300 CR300 9W x 3D x 1.5H 3 $139

P14494-CR-21 150 300 CR300 9W x 3D x 1.5H 3 $139

P14494-CR-22 100 300 CR300 9W x 3D x 1.5H 3 $139

P14494-CR-24 50 300 CR300 9W x 3D x 1.5H 3 $139

P14494-CR-26 40 300 CR300 9W x 3D x 1.5H 3 $139

P14494-CR-27 250 400 CR400 12W x 3D x 1.5H 4 $174

P14494-CR-29 150 400 CR400 12W x 3D x 1.5H 4 $174

P14494-CR-30 100 400 CR400 12W x 3D x 1.5H 4 $174

P14494-CR-31 75 400 CR400 12W x 3D x 1.5H 4 $174

P14494-CR-32 50 400 CR400 12W x 3D x 1.5H 4 $174

P14494-CR-34 40 400 CR400 12W x 3D x 1.5H 4 $174

ABB-48431-052 80 800 GCE2 12W x 7D x 5H 10 337

P14494-63 80 1050 GCE3 12W x 10D x 5H 13 433

P14494-62 63 800 GCE2 12W x 7D x 5H 10 337

ABB-48431-140 63 1200 GCE3 12W x 10D x 5H 13 433

ABB-41163 35 900 GCE3 12W x 10D x 5H 13 433

P14494-34 35 1600 GCE4 12W x 13D x 5H 16 529

P14494-33 35 1200 GCE3 12W x 10D x 5H 13 433

ABB-44534 40 2010 GCE5 12W x 16D x 5H 18 626


ACS250Additional resources

QR codes Scan or click the QR code to the left to access the described resources

The ABB drives web portal. Access all ABB drive information from here.

ABB drives website

FPO

http://www.abb.com/drives


ABB drive life cycle management model

Spare part, maintenance and repair services are available as long as materials can be obtained.

ABB cannot guarantee availability of life cycle services for technical reasons or within reasonable cost.

Limited life cycle services

Caution! A drive entering the limited or obsolete phase has limited repair options. This may result in unpredictable process downtime. To avoid this possibility, the drive should be kept in the active or classic phase.

Limited ObsoleteActive Classic

The drive, with complete life cycle services, is available for purchase.

The drive, with complete life cycle services, is available for plant extensions.

Complete life cycle services

To ensure the availability of complete life cycle services, a drive must be in the active or classic phase. A drive can be kept in the active or classic phase by upgrading, retrofitting or replacing.

Secure uptime throughout the drive life cycle

ABB follows a four-phase model for managing the life cycles of its drives. The life cycle phases are active, classic, limited and obsolete. Within each phase, every drive series has a defined set of services.

Examples of individual services are drive selection and dimensioning, installation and commissioning, preventive and corrective maintenance, remote monitoring and intelligent diagnostics, technical support, upgrade and retrofit, replacement and recycling plus training and learning.

In the active phase the drive is in serial production. The drive, with complete life cycle services, is available for purchase.

In the classic phase, the serial production of the drive has ended. The drive, with complete life cycle services, is available for plant extensions.

In the limited phase, the drive is no longer available. The life cycle services are limited. Spare parts as well as maintenance and repair services are available as long as materials can be obtained.

In the obsolete phase, the drive is not available. ABB cannot guarantee availability of services for technical reasons or within reasonable cost.

To ensure the availability of complete life cycle services, ABB recommends that a drive is kept in the active or classic phase by upgrading, retrofitting or replacing.

In the classic phase ABB carries out an annual review for each drive life cycle plan. Should any changes to the availability or duration of the services be necessary, ABB gives a life cycle announcement indicating eventual change of life cycle phase and/or any change in the duration of services.

In the limited phase, ABB issues a life cycle phase change announcement, half a year prior to shifting the product into the obsolete phase.

Maximizing return on investment

The four-phase life cycle management model provides customers with a transparent method for managing their investment in drives. In each phase, customers clearly see what life cycle services are available, and more importantly, what services are not available. Decisions on upgrading, retrofitting or replacing drives can be made with confidence.


AC (Alternating Current) – The commonly available electric power supplied by an AC generator and is distributed in single- orthree-phaseforms.ACcurrentchangesitsflow(current).

AC motor–AmotoroperatingonACcurrentthatflowsineitherdirection. There are two types: induction and synchronous.

Accelerating torque – An increase in torque (force) generated by a motor in order to achieve running speed.

Adjustable speed – The concept of varying the speed of a motor, either manually or automatically. The desired operating speed (set speed) is relatively constant regardless of load. Adjustable speed drive (electrical) – The adjustable speed drive is comprised of the motor, drive controller, and operator’s controls (either manual or automatic). See also Inverter.

Altitude – The atmospheric altitude (height above sea level) at which the motor or drive will be operating.

Ambient temperature – The temperature of the surrounding cooling medium, such as gas or liquid, which comes into contact with the heated parts of the motor or drive.

Ampere–Therateofflowofchargeinaconductorofonecoulomb per second.

Armature – The moving part of a magnetic circuit, such as the rotating part of a motor or generator.

Base frequency – The motor nameplate frequency rating.

Base speed – The manufacturer’s nameplate rating at which point the motor will develop rated horsepower at rated load and voltage. With DC drives, it is commonly the point where full armaturevoltageisappliedwithfull-ratedfieldexcitation.WithAC drives, it is commonly the point where 60 Hz is applied to the induction motor.

BAUD – A unit of signaling speed, equal to the number of discrete conditions or signal events per second. Where one bit is encoded on each signaling event, the number of baud is the same as the number of bits.

Braking – A method of stopping or reducing the time required to stop an AC or DC motor, accomplished in several ways:

DC-injection braking (AC drives) – A method which produces electromagnetic braking forces in the motor by removing two AC motors (stator) phases and injecting DC current. The result is a linear braking characteristic (ramp) that does not diminish with motor speed. Application is normally limited to 10 - 20% of rated motor speed due to increased heating in the rotor.Dynamic Braking (AC drives) - DB – A method which produces electromagnetic braking forces in the motor by

dissipating generated power into the DC bus through a resistive load. Braking force remains constant and is only limited by the thermal capacity of the resistors. The result is a linear braking characteristic (ramp) that does not diminish with motor speed.

Dynamic Braking (DC drives) - DB – A method which produces electromagnetic braking forces in the motor by dissipatinggeneratedpowerfromarmature/shuntfieldreaction into a resistive load. Braking force is determined by thefieldstrength,armaturevoltage,andthermalcapacityofthe resistors. The result is a logarithmic braking characteristic (curve) that diminishes with motor speed.

Regenerative Braking – The technique of slowing or stopping a drive by regeneration.

Braking torque – The torque required to bring a motor down to a standstill. The term is also used to describe the torque developed by a motor during dynamic braking conditions.

Breakaway torque – The torque required to start a machine from standstill. It is always greater than the torque needed to maintain motion.

Cascade drive system – Two or more drives connected to a master speed setting potentiometer.

Capacitor – A device which, when connected in an alternating-current circuit, causes the current to lead the voltage in time phase. The peak of the current wave is reached ahead of the peak of the voltage wave. CE – This designation shows that a product such as a drive or motor meets European Standards for safety and environmental protection. A CE mark is required for products used in most European countries.

Chassis – A hardware assembly that houses devices such as I/O modules, adapter modules, processor modules, and power supplies.

Configurable – Input parameter whose values can only be modifiedwhilethedriveisstopped(notrunningorjogging).

Current–Thetimerateofflowofelectricalcharge.Currentismeasured in amps (amperes).

Current feedback – A current signal used by the regulator to control the operating current of the drive. AC (Alternating Current) – A type of electrical current where the current repeatedly changes direction. It may be continuous or discontinuous and it may be constant or varying. DC bus –Adrive’spowerstructurethattransmitsrectifiedAClinepowerfromthebridgerectifiertotheoutputtransistors.

ACS250Glossary of terms



Decelerating torque – The torque (force) generated by the decrease in motor and load kinetic energy which the motor and loadrequirestoreachisfinal(slower)speedcondition. Default value – Parameter values that are stored in the drive’s read-only memory (ROM). Device – A module or product.

Diode – A solid-state, unidirectional conductor.. Drive controller – An electronic device that can control the speed, torque horsepower, and direction of an AC or DC motor. Also called Variable Speed Drive. Dynamic braking – See Braking. Efficiency – The ratio of mechanical output to electrical input. It represents the effectiveness with which the motor converts electrical energy to mechanical energy. EIA – Electronics Industries Association. An American agency that sets electrical / electronic standards. Electrostatic discharge (ESD) – A static-electricity discharge that may damage drive components. Follow appropriate precautions to guard against damage to drive components. EMF – Electromotive Force, another term for voltage or potential difference. In DC adjustable speed drives, voltage applied to the motor armature from a power supply is the emf and the voltage generated by the motor is the counter-emf or cemf. EMI – Electromagnetic Interference. Any electromagnetic disturbance that interrupts, obstructs, or otherwise impairs the performance of electronic equipment. Enclosure – The housing or frame of the drive. Fault – Any malfunction that interferes with normal system operation. Firmware – Logic stored in read-only memory.

Flash update–Theprocessofupdatingfirmwareinadevice. Flux–Themagneticfieldwhichisestablishedaroundanenergizedconductororpermanentmagnet.Thefieldisrepresentedbyfluxlinescreatingafluxpatternbetweenoppositepoles.Thedensityofthefluxlinesisameasureofthestrengthofthemagneticfield. Force – The tendency to change the motion of an object with an exertion of energy from a separate source. Force is measured in pound-feet, ounce-inches, Newton-meters, or gram-centimeters.

Frame – The supporting structure of the drive. The frame also determines mounting dimensions. Frequency – The rate at which alternating current makes a complete cycle of reversals. It is expressed in cycles per second. In the U.S., 60 cycles (Hz) is the standard while in other countries 50 Hz (cycles) is common. The frequency of the AC current will affect the speed of a motor. Frequency setpoint – The frequency value stored in memory (either by local or remote means) within a given frequency range of the drive’s output voltage. This sets the speed of the motor. Gain – The ratio of the magnitude of the output signal with respect to that of the input signal. Ground fault sense – A current transducer that detects an unequal or imbalanced current in the three-phase AC line or DC bus of the drive. The imbalance indicates an output ground fault condition. Hertz (Hz) – One cycle per second (as in 60 Hz which is 60 cycles per second). Horsepower – The measure of the rate of work. One horsepower is equivalent to lifting 33,000 pounds to a height of one foot in one minute. The horsepower (HP) of a motor is expressed as a function of torque (T, measured in lb-ft) and RPM (revolutions per minute). For motors, you can approximate horsepower using this formula: HP = T x (RPM/5250).

Host – 1. A central controlling computer in a network system.

2. Any device on a network system that provides a controlling function to another device on the network.

3. Any intelligent device for which another device is providing a communication interface to a network.

Host interface – The communication interface to the host computer. Inductance – The characteristic of an electric circuit by which varyingcurrentinitproducesavaryingmagneticfieldwhichcausesvoltages in the same circuit or in a nearby circuit. Inertia – A measure of a body’s resistance to changes in velocity, whether the body is at rest or moving at a constant velocity. The velocity can be either linear or rotational. Inertial load–Aload(suchasaflywheelorfan)thattendstocause the motor shaft to continue to rotate after power has been removed (stored kinetic energy). If this continued rotation cannot be tolerated, some mechanical or electrical braking means must be applied. This application might require a special motor due to the energy required to accelerate the inertia.



Ingress protection (IP) rating – The IP designation is a numeric rating used to specify the degree of environmental protection provided by an enclosurebasedonspecifictests.TheIPratingconsistsoftwonumbers, although a third number describing the degree of protection from mechanical impact can also be included but is commonly omitted. For example, IP 56. A higher number represents better protection.

First number–Thefirstnumberdescribesthedegreeof protection from solid objects and with respect to human access to hazardous parts.

0 - No protection. 1 - Protection against solid objects 50 mm in diameter or greater 2 - Protection against solid objects 12.5 mm in diameter or greater 3 - Protection against solid objects 2.5 mm in diameter or greater 4 - Protection against solid objects 1.0 mm in diameter or greater 5 - Dust protected (quantities of dust will not accumulate) - Dust tight

Second number – The second number describes the degree of protection from liquids. 0 - No protection. 1 - Protection against vertically falling drops of water 2 - Protection against vertically falling drops of water when enclosure is tilted up to 15 degrees 3 - Protection against spraying water when the enclosure is tilted up to 60 degrees on the vertical 4 - Protection against splashing water from all directions 5 - Protection against water jets from all directions 6 - Protection against powerful water jets or heavy seas 7 - Protection against the effects of temporary immersion in water 8 - Protection against the effects of continuous submersion in water Instantaneous electronic trip (IET) – A fault condition that occurs while the drive is running resulting in a motor coast-to-rest stop. The drive senses a condition that could result in equipment damage. Input parameter – A parameter whose value can be changed. Input power factor – The ratio of the input inverter AC effective power to the input AC apparent power. Inverter – 1 - An AC adjustable-frequency drive 2 - A particular section of an AC drive. This section uses the DC voltage from a previous circuit stage (intermediate DC circuit) to produce a pulse-width modulated or stepped AC current or voltage waveform that has characteristics similar to the desired sine-wave frequency. 3 - A circuit whose output signal is the inverse of its input. I/O – Input(s) and/or Output(s)

I/O block – An assembly containing a chassis, a power supply, an adapter, and I/O in a single integral package. I/O channel – A channel of a data transmission link between a processor scanner module and an I/O adapter module. I/O chassis – A chassis for I/O modules and either a processor to control the I/O modules, or an adapter to interface a scanner to the I/O modules. IR compensation – A way to compensate for the voltage drop across resistance of the AC or DC motor circuit and the resultant reduction in speed. This compensation also provides a way to improve the speed regulation characteristics of the motor, especially at low speeds. Drives that use a tachometer generator for speed feedback generally do not require an IR compensation circuit because the tachometer will inherently compensate for the loss in speed.

Jogging – 1 - In a numerical control system, an operator manually generating motion (continuous or incrementally) by closing a switch.

2 - An operator generating motion incrementally by closing a switch. Joule – 1. The work done by the force of 1 Newton acting

through a distance of 1 meter. 2. The energy required to transport 1 coulomb

between two points having a potential difference of 1 volt.

k – An abbreviation used as a multiple for bits, bytes, or words denoting size of a block of data or memory. 1 k = 1024. Kilowatt (kW) – Equals 1,000 watts and is used where larger units of power measurement are desired because the watt is a relatively small unit of power. Kinetic energy – The energy of motion of a moving body. Ladder diagram – An industry standard for representing relay control logic. LED – Light Emitting Diode. LEM – A hall-effect current transducer that senses drive output current and generates a signal for the control logic. Line dip – A short duration, low input voltage condition. Liquid crystal display (LCD)–Areflective,visualreadoutdeviceoftenused in digital watches and laptop computers. Load – The burden imposed on a motor by the driven machine. It is often stated as the torque required to overcome the resistance of the machine it drives. “Load” is sometimes synonymous with “required power.”



Load torque – The motor torque required to keep the load rotating at nearly constant speed. Local I/O – I/O connected to a processor across a backplane or a parallel link, thus limiting its distance from the processor. Logic diagram – A diagram that represents logic elements and their interconnections. Master – A device used to control secondary devices. Modulated LED control – A photoelectric control that operates on light pulses, rather than on constant light intensity. Module – A device that provides and interface between a product and a network. It is often referred to as a peripheral.

Module addressing – The method of identifying the I/O modules installed in chassis.

Motor – A device that converts electrical energy to mechanical energy to turn a shaft. MotorIdentification:• Frame designation (actual frame size in which the motor is built)

• Horsepower, speed, design and enclosure

Voltage, frequency and number of phases of power supply

• Class of insulation and time rating

• Application

Motor Nameplate – The plate on the outside of a motor that describes the motor, horsepower, voltage, revolutions per minute, efficiency,design,enclosure,etc. NEMA (National Electrical Manufacturer’s Association) – A non-profitorganizationorganizedandsupportedbymanufacturersof electric equipment and supplies. NEMA has set standards for: horsepower ratings, speeds, frame sizes and dimensions, standard voltages and frequencies with allowable variations, service factors, torque, starting current, and enclosures. Network – A series of stations (nodes) connected by some type of communication medium. A network may be made up of a single link or multiple links.

Node – The connection point at which media access is provided. Non-Retentive – Changes to the parameter value are not saved when power is removed.

Non-Volatile storage (NVS) – NVS is the permanent memory of a device. Devices such as the converter store parameters and other information in NVS so that they are not lost when the device loses power. NVS is sometimes called EEPROM. Output parameter – Provides output information. Value cannot be changed through the OIM.

Overcurrent–Acurrentgreaterthanaspecifiedmaximumcurrentvalue. Overload capacity – The ability of the drive to withstand currents beyondthesystem’scontinuousrating.Itisnormallyspecifiedasapercentageoffullloadcurrentforaspecified time period. Peripheral equipment – In a programmable controller system, units that communicate with the programmable controller, but are not part of the programmable controller. For example, a programmable device or printer. Phase – Indicates changing values of the recurring cycles of AC voltages and currents. The most common power supplies are either single- or three-phase (with 120 electrical degrees between three-phases). Potentiometer – A resistor with one or more adjustable sliding contacts that function as an adjustable voltage divider. Power – Work done per unit time. Measured in horsepower or watts: 1 HP = 33,000 ft-lb/min = 746 watts.

Power factor – A measurement of the time phase difference between the voltage and current in an AC circuit. Power factor is the ratio of real power (kW) to total KVA or the ratio of actual power (W) to apparent power (volt-amperes). Preset speed–Describesoneormorefixedspeedsatwhichadriveoperates. Program – A set of instructions used to control a machine or process. Programmable controller – A solid-state control system that has a user-programmable memory for storage of instructions to implement specificfunctionssuchasI/Ocontrol,logic,timing,counting,reportgeneration,communication,arithmetic,anddatafilemanipulation.Acontroller consists of a central processor, input/output interface, and memory. Programmable controller communications command (PCCC) – The protocol used by some controllers to communicate with devices on a network. Some software products also use PCCC to communicate. Pulse – A momentary, sharp change in voltage, current, or light from its quiescent condition. Pulse-width-modulation (PWM) – A technique used to eliminate or reduce unwanted harmonic frequencies when inverting DC voltage to sine wave AC. Queue – A logical structure that keeps track of items waiting for processing whenever the system is unable to process each item immediately. It controls the order in which the waiting items are ultimately processed.



Rated input voltage–ThespecifiedAClinevoltageconnectedtothedrive. Rated output current – The total maximum current delivered from a drive or to a motor under full load conditions. Rated output voltage – The total maximum output voltage while delivering rated current under full load conditions. Rectifier – A device that conducts current in only one direction, thereby transforming alternating current to direct current. Regeneration – 1. For DC drives, the characteristic of a motor to act as a generator when the counter emf is larger than the drive’s applied voltage.

2. For AC drives, the point at which rotor synchronous frequency is greater than the applied frequency.

Regenerative braking – See Braking. Regenerative control – A regenerative drive contains the inherent capabilityand/orpowersemiconductorstocontroltheflowofpowerto and from the motor.

Remote I/O – I/O connected to a processor across a serial link. With a serial link, remote I/O can be located long distance from the processor. Revolutions per minute (RPM) – The number of times per minute the shaft of the motor (machine) rotates. Service factor (SF) – When used on a motor nameplate, a number that indicates how much above the nameplate rating a motor can be loaded without causing serious degradation. For example, a 1.15 SF can produce 15% greater torque than a 1.0 SF rating of the same motor. Slave – In a communication link, a station that cannot initiate communication. Only a master can initiate communication. Speed range – The speed minimum and maximum at which a motor must operate under constant or variable torque load conditions. Stall – A motor state in which the motor remains motionless although the motor is generating torque. Stator – The part of an AC induction motor’s magnetic structure which does not rotate.

Status – The condition at a particular time of any of numerous entities within a system. Status indicators – LEDs that are used to report the status of a device. Surge suppressor – Circuit protection that suppresses the peak value of any unusual input voltage to the drive. It is sometimes used to lighten the leading edge of voltage.

Tachometer – Normally used as a rotation sensing device. Tachometers are typically attached to the output shaft of a motor requiring close speed regulation. The tachometer feeds its signal to a control loop, which adjusts its input to the motor accordingly. Throughput – The rate at which equipment processes or transmits data. Top speed – The highest speed a drive can achieve. Top speed equalsbasespeedwhenthereisnofieldweakening. Torque – Turning force delivered by a motor or gearmotor shaft, usually expressed in pounds-feet or newton-meters:

lb-ft = HP x (5250/RPM) = Full Load Torque; Nm = P(kW) x (9550/RPM) = Full Load Torque;

Torque compensation – The increase of the volts/frequency ratio of the drive in the low frequency area to compensate for the reduced torque of the motor at low speeds. Reduced torque at low speeds is due to the resistance of the motor stator windings.

Transducer – A device that converts one energy form to another. When a transducer is actuated by signals from one system or medium, it can supply a related signal to the other system or medium.

Tunable–Inputparameterwhosevaluecanbemodifiedatanytime(when the drive is stopped, running, or jogging). U.L. (underwriter’s laboratory) – An independent testing organization, which examines and tests devices, systems and materialswithparticularreferencetolife,fireandcasualtyhazards.

Variable torque – A multi-speed motor used on loads with torque requirements, which vary with speed as with some centrifugal pumps and blowers. The horsepower varies as the square of the speed. Voltage–Theforcethatcausesacurrenttoflowinanelectricalcircuit. Analogous to pressure in hydraulics, voltage is often referred to as electrical pressure. The voltage of a motor is usually determined by the supply to which it is attached. NEMA requires that the motor be able to carry its rated horsepower at nameplate voltage plus or minus 10% although not necessarily at the rated temperature rise.

Voltage feedback – A voltage signal which the regulator uses to control the operation of the drive. Volts per hertz (V/Hz) – The ratio of output voltage (in volts) to output frequency (in hertz) in the output frequency range of the drive to achieve constant torque in the motor. Watt (W) – The amount of power required to maintain a current of one ampere at a pressure of one volt. One horsepower is equal to 756 watts. Word – A grouping or a number of bits in a sequence that is treated as a unit. Work – A force moving an object over a distance. Work = Force x Distance.


General terms and conditions of sale1. General. Thetermsandconditionscontainedherein,togetherwithanyadditionalordifferenttermscontainedinABB’sProposal,ifany,submittedtoPurchaser(whichProposalshallcontroloveranyconflictingterms), constitute the entire agreement (the “Agreement”) between the parties with respect to the order and supersede all prior communications and agreements regarding the order. Acceptance by ABB of the order, or Purchaser’s acceptance of ABB’s Proposal, is expressly limited to and conditioned upon Purchaser’s acceptance of these terms and conditions, payment for or acceptance of any performance by ABB being acceptance. These terms and conditions may not be changed or superseded by any different or additional terms and conditions proposed by Purchaser to which terms ABB hereby objects. Unless the context otherwise requires, the term “Equipment” as used herein means all of the equipment, parts, accessories sold, and all software and software documentation, if any, licensed to Purchaser by ABB (“Software”) under the order. Unless the context otherwise requires, the term “Services” as used herein means all labor, supervisory, technical and engineering, installation, repair, consulting or other services provided by ABB under the order. As used herein, the term “Purchaser” shall include the initial end use of the Equipment and/or services; provided, however, that Paragraph 13(a) shall apply exclusively to the initial end user.

2. Prices.(a)Unlessotherwisespecifiedinwriting,allProposalsexpirethirty(30)daysfromthedatethereof.(b) Unless otherwise stated herein, Services prices are based on normal business hours (8 a.m. to 5 p.m. Monday through Friday). Overtime and Saturday hours will be billed at one and one-half (1 1/2) times the hourly rate; and Sunday hours will be billed at two (2) times the hourly rate; holiday hours will be billed at three (3) times the hourly rate. If a Services rate sheet is attached hereto, the applicable Services rates shall be those set forth in the rate sheet. Rates are subject to change without notice.(c) The price does not include any federal, state or local property, license, privilege, sales, use, excise, gross receipts, or other like taxes which may now or hereafter be applicable. Purchaser agrees to pay or reimburse any such taxes which ABB or its suppliers are required to pay or collect. If Purchaser is exempt from the payment of any tax or holds a direct payment permit, Purchaser shall, upon order placement, provideABBacopy,acceptabletotherelevantgovernmentalauthoritiesofanysuchcertificateorpermit.(d) The price includes customs duties and other importation or exportation fees, if any, at the rates in effect on the date of ABB’s Proposal. Any change after that date in such duties, fees, or rates, shall increase the price by ABB’s additional cost.

3. Payment.(a)UnlessspecifiedtothecontraryinwritingbyABB,paymenttermsarenetcash,payablewithoutoffset,inUnitedStatesDollars,30daysfromdateofinvoicebywiretransfertothe account designated by ABB in the Proposal.(b)IfinthejudgmentofABBthefinancialconditionofPurchaseratanytimepriortodeliverydoesnotjustifythetermsofpaymentspecified,ABBmayrequirepaymentinadvance,paymentsecuritysatisfactorytoABB, or may terminate the order, whereupon ABB shall be entitled to receive reasonable cancellation charges. If delivery is delayed by Purchaser, payment shall be due on the date ABB is prepared to make delivery. Delays in delivery or nonconformities in any installments delivered shall not relieve Purchaser of its obligation to accept and pay for remaining installments.(c) Purchaser shall pay, in addition to the overdue payment, a late charge equal to the lesser of 1 1/2% per month or any part thereof or the highest applicable rate allowed by law on all such overdue amounts plus ABB’s attorneys’ fees and court costs incurred in connection with collection.

4. Changes.(a) Any changes requested by Purchaser affecting the ordered scope of work must be accepted by ABB and resulting adjustments to affected provisions, including price, schedule, and guarantees mutually agreed in writing prior to implementation of the change.(b)ABBmay,atitsexpense,makesuchchangesintheEquipmentorServicesasitdeemsnecessary,initssolediscretion,toconformtheEquipmentorServicestotheapplicablespecifications. IfPurchaserobjectstoanysuchchanges,ABBshallberelievedofitsobligationtoconformtotheapplicablespecificationstotheextentthatconformancemaybeaffectedbysuchobjection.

5. Delivery.(a) All Equipment manufactured, assembled or warehoused in the continental United States is delivered F.O.B. point of shipment. Equipment shipped from outside the continental United States is delivered F.O.B. United States port of entry. Purchaser shall be responsible for any and all demurrage or detention charges.(b) If the scheduled delivery of Equipment is delayed by Purchaser or by Force Majeure, ABB may move the Equipment to storage for the account of and at the risk of Purchaser whereupon it shall be deemed to be delivered.(c) Shipping and delivery dates are contingent upon Purchaser’s timely approvals and delivery by Purchaser of any documentation required for ABB’s performance hereunder.(d) Claims for shortages or other errors in delivery must be made in writing to ABB within ten days of delivery. Equipment may not be returned except with the prior written consent of and subject to termsspecifiedbyABB.ClaimsfordamageafterdeliveryshallbemadedirectlybyPurchaserwiththecommoncarrier.

6. Title & Risk of Loss. Except with respect to Software (for which title shall not pass, use being licensed) title to Equipment shall remain in ABB until fully paid for. Notwithstanding any agreement with respect to delivery terms or payment of transportation charges, risk of loss or damage shall pass to Purchaser upon delivery.

7. Inspection, Testing and Acceptance.(a) Any inspection by Purchaser of Equipment on ABB’s premises shall be scheduled in advance to be performed during normal working hours.(b)Iftheorderprovidesforfactoryacceptancetesting,ABBshallnotifyPurchaserwhenABBwillconductsuchtestingpriortoshipment.UnlessPurchaserstatesspecificobjectionsinwritingwithin ten (10) days after completion of factory acceptance testing, completion of the acceptance test constitutes Purchaser’s factory acceptance of the Equipment and its authorization for shipment.(c) If the order provides for site acceptance testing, testing will be performed by ABB personnel to verify that the Equipment has arrived at site complete, without physical damage, and in good operating condition.CompletionofsiteacceptancetestingconstitutesfullandfinalacceptanceoftheEquipment.If,throughnofaultofABB,acceptancetestingisnotcompletedwithinthirty(30)daysafterarrivalof the Equipment at the site, the site acceptance test shall be deemed completed and the Equipment shall be deemed accepted.

8. Warranties and Remedies.(a)EquipmentandServicesWarranty.ABBwarrantsthatEquipment(excludingSoftware,whichiswarrantedasspecifiedinparagraph(d)below)shallbedeliveredfreeofdefectsinmaterialandworkmanshipandthat Services shall be free of defects in workmanship. The Warranty Remedy Period for Equipment (excluding Software, Spare Parts and Refurbished or Repaired Parts) shall end twelve (12) months after installation or eighteen(18)monthsafterdateofshipment,whicheverfirstoccurs.TheWarrantyRemedyPeriodfornewsparepartsshallendtwelve(12)monthsafterdateofshipment.TheWarrantyRemedyPeriodforrefurbishedor repaired parts shall end ninety (90) days after date of shipment. The Warranty Remedy Period for Services shall end ninety (90) days after the date of completion of Services.(b)EquipmentandServicesRemedy.IfanonconformitytotheforegoingwarrantyisdiscoveredintheEquipmentorServicesduringtheapplicableWarrantyRemedyPeriod,asspecifiedabove,undernormalandproper use and provided the Equipment has been properly stored, installed, operated and maintained and written notice of such nonconformity is provided to ABB promptly after such discovery and within the applicable Warranty Remedy Period, ABB shall, at its option, either (i) repair or replace the nonconforming portion of the Equipment or re-perform the nonconforming Services or (ii) refund the portion of the price applicable to the nonconforming portion of Equipment or Services. If any portion of the Equipment or Services so repaired, replaced or re-performed fails to conform to the foregoing warranty, and written notice of such nonconformity is provided to ABB promptly after discovery and within the original Warranty Remedy Period applicable to such Equipment or Services or 30 days from completion of such repair, replacement or re-performance, whichever is later, ABB will repair or replace such nonconforming Equipment or re-perform the nonconforming Services. The original Warranty Remedy Period shall not otherwise be extended.(c) Exceptions. ABB shall not be responsible for providing working access to the nonconforming Equipment, including disassembly and re-assembly of non-ABB supplied equipment, or for providing transportation to or from any repair facility, all of which shall be at Purchaser’s risk and expense. ABB shall have no obligation hereunder with respect to any Equipment which (i) has been improperly repaired or altered; (ii) has been subjectedtomisuse,negligenceoraccident;(iii)hasbeenusedinamannercontrarytoABB’sinstructions;(iv)iscomprisedofmaterialsprovidedbyoradesignspecifiedbyPurchaser;or(v)hasfailedasaresultofordinary wear and tear. Equipment supplied by ABB but manufactured by others is warranted only to the extent of the manufacturer’s warranty, and only the remedies, if any, provided by the manufacturer will be allowed.(d)SoftwareWarrantyandRemedies.ABBwarrantsthat,exceptasspecifiedbelow,theSoftwarewill,whenproperlyinstalled,executeinaccordancewithABB’spublishedspecification.Ifanonconformitytotheforegoing warranty is discovered during the period ending one (1) year after the date of shipment and written notice of such nonconformity is provided to ABB promptly after such discovery and within that period, including a description of the nonconformity and complete information about the manner of its discovery, ABB shall correct the nonconformity by, at its option, either (i) modifying or making available to the Purchaser instructions for modifying the Software; or (ii) making available at ABB’s facility necessary corrected or replacement programs. ABB shall have no obligation with respect to any nonconformities resulting from (i)unauthorizedmodificationoftheSoftwareor(ii)Purchaser-suppliedsoftwareorinterfacing.ABBdoesnotwarrantthatthefunctionscontainedinthesoftwarewilloperateincombinationswhichmaybeselectedforuse by the Purchaser, or that the software products are free from errors in the nature of what is commonly categorized by the computer industry as “bugs”.(e) THE FOREGOING WARRANTIES ARE EXCLUSIVE AND IN LIEU OF ALL OTHER WARRANTIES OF QUALITY AND PERFORMANCE, WHETHER WRITTEN, ORAL OR IMPLIED, AND ALL OTHER WARRANTIES INCLUDING ANY IMPLIED WARRANTIES OF MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE OR USAGE OF TRADE ARE HEREBY DISCLAIMED. THE REMEDIES STATED HEREIN CONSTITUTE PURCHASER’S EXCLUSIVE REMEDIES AND ABB’s ENTIRE LIABILITY FOR ANY BREACH OF WARRANTY.

9. Patent Indemnity.(a)ABBshalldefendatitsownexpenseanyactionbroughtagainstPurchaserallegingthattheEquipmentortheuseoftheEquipmenttopracticeanyprocessforwhichsuchEquipmentisspecifiedbyABB (a“Process”)directlyinfringesanyclaimofapatentoftheUnitedStatesofAmericaandtopayalldamagesandcostsfinallyawardedinanysuchaction,providedthatPurchaserhasgivenABBpromptwrittennoticeof such action, all necessary assistance in the defense thereof and the right to control all aspects of the defense thereof including the right to settle or otherwise terminate such action in behalf of Purchaser.(b)ABBshallhavenoobligationhereunderandthisprovisionshallnotapplyto:(i)anyotherequipmentorprocesses,includingEquipmentorProcesseswhichhavebeenmodifiedorcombinedwithotherequipmentor process not supplied by ABB; (ii) any Equipment or Process supplied according to a design, other than an ABB design, required by Purchaser; (iii) any products manufactured by the Equipment or Process; (iv) any patent issued after the date hereof; or (v) any action settled or otherwise terminated without the prior written consent of ABB.(c)If,inanysuchaction,theEquipmentisheldtoconstituteaninfringement,orthepracticeofanyProcessusingtheEquipmentisfinallyenjoined,ABBshall,atitsoptionanditsownexpense,procureforPurchaserthe right to continue using said Equipment; or modify or replace it with non-infringing equipment or, with Purchaser’s assistance, modify the Process so that it becomes non-infringing; or remove it and refund the portion of the price allocable to the infringing Equipment. THE FOREGOING PARAGRAPHS STATE THE ENTIRE LIABILITY OF ABB AND EQUIPMENT MANUFACTURER FOR ANY PATENT INFRINGEMENT.(d)TotheextentthatsaidEquipmentoranypartthereofismodifiedbyPurchaser,orcombinedbyPurchaserwithequipmentorprocessesnotfurnishedhereunder(excepttotheextentthatABBisacontributoryinfringer)orsaidEquipmentoranypartthereofisusedbyPurchasertoperformaprocessnotfurnishedhereunderbyABBortoproduceanarticle,andbyreasonofsaidmodification,combination,performanceor production, an action is brought against ABB, Purchaser shall defend and indemnify ABB in the same manner and to the same extent that ABB would be obligated to indemnify Purchaser under this “Patent Indemnity” provision.


General terms and conditions of sale 10. Limitation of Liability.(a) In no event shall ABB, its suppliers or subcontractors be liable for special, indirect, incidental or consequential damages, whether in contract, warranty, tort, negligence, strict liability or otherwise, including, butnotlimitedto,lossofprofitsorrevenue,lossofuseoftheEquipmentoranyassociatedequipment,costofcapital,costofsubstituteequipment,facilitiesorservices,downtimecosts,delays,andclaimsof customers of the Purchaser or other third parties for any damages. ABB’s liability for any claim whether in contract, warranty, tort, negligence, strict liability, or otherwise for any loss or damage arising out of, connected with, or resulting from this Agreement or the performance or breach thereof, or from the design, manufacture, sale, delivery, resale, repair, replacement, installation, technical direction of installation, inspection, operation or use of any equipment covered by or furnished under this Agreement, or from any services rendered in connection therewith, shall in no case (except as provided in the section entitled “Patent Indemnity”) exceed one-half (1/2) of the purchase price allocable to the equipment or part thereof or Services which gives rise to the claim.(b) All causes of action against ABB arising out of or relating to this Agreement or the performance or breach hereof shall expire unless brought within one year of the time of accrual thereof.(c)Innoevent,regardlessofcause,shallABBbeliableforpenaltiesorpenaltyclausesofanydescriptionorforindemnificationofPurchaserorothersforcosts,damages,orexpensesarisingoutoforrelatedto the Equipment and/Services. 11. Laws and Regulations. ABB does not assume any responsibility for compliance with federal, state or local laws and regulations, except as expressly set forth herein, and compliance with any laws and regulations relating to the operation or use of the Equipment or Software is the sole responsibility of the Purchaser. All laws and regulations referenced herein shall be those in effectasoftheProposaldate.Intheeventofanysubsequentrevisionsorchangesthereto,ABBassumesnoresponsibilityforcompliancetherewith.IfPurchaserdesiresamodificationasaresultofanysuchchange or revision, it shall be treated as a change per Article 4. Nothing contained herein shall be construed as imposing responsibility or liability upon ABB for obtaining any permits, licenses or approvals from any agency required in connection with the supply, erection or operation of the Equipment. This Agreement shall be governed by the laws of the State of New York, but excluding the provisions of the United NationsConventiononContractsfortheInternationalSaleofGoodsandexcludingNewYorklawwithrespecttoconflictsoflaw.PurchaseragreesthatallcausesofactionagainstABBunderthisAgreementshall be brought in the State Courts of the State of New York, or the U.S. District Court for the Southern District of New York. If any provision hereof, partly or completely, shall be held invalid or unenforceable, such invalidity or unenforceability shall not affect any other provision or portion hereof and these terms shall be construed as if such invalid or unenforceable provision or portion thereof had never existed.

12. OSHA. ABB warrants that the Equipment will comply with the relevant standards of the Occupational Safety and Health Act of 1970 (“OSHA”) and the regulations promulgated thereunder as of the date of the Proposal. Upon prompt written notice from the Purchaser of a breach of this warranty, ABB will replace the affected part or modify it so that it conforms to such standard or regulation. ABB’s obligation shall be limitedtosuchreplacementormodification.InnoeventshallABBberesponsibleforliabilityarisingoutoftheviolationofanyOSHAstandardsrelatingtoorcausedbyPurchaser’sdesign,location,operation,or maintenance of the Equipment, its use in association with other equipment of Purchaser, or the alteration of the Equipment by any party other than ABB.

13. Software License. (a) ABB owns all rights in or has the right to sublicense all of the Software, if any, to be delivered to Purchaser under this Agreement. As part of the sale made hereunder Purchaser hereby obtains a limited licensetousetheSoftware,subjecttothefollowing:(i)TheSoftwaremaybeusedonlyinconjunctionwithequipmentspecifiedbyABB;(ii)TheSoftwareshallbekeptstrictlyconfidential;(iii)TheSoftwareshallnotbecopied,reverseengineered,ormodified;(iv)ThePurchaser’srighttousetheSoftwareshallterminateimmediatelywhenthespecifiedequipmentisnolongerusedbythePurchaserorwhenotherwiseterminated, e.g. for breach, hereunder; and (v) the rights to use the Software are non-exclusive and non-transferable, except with ABB’s prior written consent.(b) Nothing in this Agreement shall be deemed to convey to Purchaser any title to or ownership in the Software or the intellectual property contained therein in whole or in part, nor to designate the Software a “work made for hire” under the Copyright Act, nor to confer upon any person who is not a named party to this Agreement any right or remedy under or by reason of this Agreement. In the event of termina-tion of this License, Purchaser shall immediately cease using the Software and, without retaining any copies, notes or excerpts thereof, return to ABB the Software and all copies thereof and shall remove all machine readable Software from all of Purchaser’s storage media.

14. Inventions and Information. UnlessotherwiseagreedinwritingbyABBandPurchaser,allright,titleandinterestinanyinventions,developments,improvementsormodificationsoforforEquipmentandServicesshallremainwithABB.Any design, manufacturing drawings or other information submitted to the Purchaser remains the exclusive property of ABB. Purchaser shall not, without ABB’s prior written consent, copy or disclose such information to a third party. Such information shall be used solely for the operation or maintenance of the Equipment and not for any other purpose, including the duplication thereof in whole or in part.

15. Force Majeure. ABB shall neither be liable for loss, damage, detention or delay nor be deemed to be in default for failure to perform when prevented from doing so by causes beyond its reasonable control including but not limitedtoactsofwar(declaredorundeclared),ActsofGod,fire,strike,labordifficulties,actsoromissionsofanygovernmentalauthorityorofPurchaser,compliancewithgovernmentregulations,insurrectionor riot, embargo, delays or shortages in transportation or inability to obtain necessary labor, materials, or manufacturing facilities from usual sources or from defects or delays in the performance of its suppliers or subcontractors due to any of the foregoing enumerated causes. In the event of delay due to any such cause, the date of delivery will be extended by period equal to the delay plus a reasonable time to resume production, and the price will be adjusted to compensate ABB for such delay.

16. Cancellation. AnyordermaybecancelledbyPurchaseronlyuponpriorwrittennoticeandpaymentofterminationcharges,includingbutnotlimitedto,allcostsidentifiedtotheorderincurredpriortotheeffectivedateofnoticeofterminationandallexpensesincurredbyABBattributabletothetermination,plusafixedsumoften(10)percentofthefinaltotalpricetocompensatefordisruptioninscheduling,plannedproductionand other indirect costs.

17. Termination. NoterminationbyPurchaserfordefaultshallbeeffectiveunless,withinfifteen(15)daysafterreceiptbyABBofPurchaser’swrittennoticespecifyingsuchdefault,ABBshallhavefailedtoinitiateandpursuewithduediligencecorrectionofsuchspecifieddefault.

18. Export Control.(a) Purchaser represents and warrants that the Equipment and Services provided hereunder and the “direct product” thereof are intended for civil use only and will not be used, directly or indirectly, for the production of chemical or biological weapons or of precursor chemicals for such weapons, or for any direct or indirect nuclear end use. Purchaser agrees not to disclose, use, export or re-export, directly orindirectly,anyinformationprovidedbyABBorthe“directproduct”thereofasdefinedintheExportControlRegulationsoftheUnitedStatesDepartmentofCommerce,exceptincompliancewithsuchRegulations.(b)Ifapplicable,ABBshallfileforaU.S.exportlicense,butonlyafterappropriatedocumentationforthelicenseapplicationhasbeenprovidedbyPurchaser.Purchasershallfurnishsuchdocumentationwithina reasonable time after order acceptance. Any delay in obtaining such license shall suspend performance of this Agreement by ABB. If an export license is not granted or, if once granted, is thereafter revoked ormodifiedbytheappropriateauthorities,thisAgreementmaybecanceledbyABBwithoutliabilityfordamagesofanykindresultingfromsuchcancellation.AtABB’srequest,PurchasershallprovidetoABBa Letter of Assurance and End-User Statement in a form reasonably satisfactory to ABB.

19. Assignment. Any assignment of this Agreement or of any rights or obligations under the Agreement without prior written consent of ABB shall be void.

20. Nuclear Insurance – Indemnity. For applications in nuclear projects, the Purchaser and/or its end user customer shall have complete insurance protection against liability and property damage resulting from a nuclear incident to and shall indemnify ABB, its subcontractors, suppliers and vendors against all claims resulting from a nuclear incident.

21. Resale. If Purchaser resells any of the Equipment, the sale terms shall limit ABB’s liability to the buyer to the same extent that ABB’s liability to Purchaser is limited hereunder.

22. Entire Agreement. This Agreement constitutes the entire agreement between ABB and Purchaser. There are no agreements, understandings, restrictions, warranties, or representations between ABB and Purchaser other than those set forth herein or herein provided.


US district sales offices ©Copyright2013Allspecificationsandpricingsubjecttochangewithoutnotice.

ARIZONA PHOENIX 4211 S. 43RD PLACE PHOENIX, AZ 85040 PHONE: 602-470-0407 FAX: 602-470-0464

ARKANSAS CLARKSVILLE 706 WEST MAIN STREET CLARKSVILLE, AR 72830 PHONE: 479-754-9108 FAX: 479-754-9205

CALIFORNIA LOS ANGELES 6480 FLOTILLA STREET COMMERCE, CA 90040 PHONE: 323-724-6771 FAX: 323-721-5859

HAYWARD 21056 FORBES STREET HAYWARD, CA 94545 PHONE: 510-785-9900 FAX: 510-785-9910

COLORADO DENVER 3855 FOREST STREET DENVER, CO 80207 PHONE: 303-623-0127 FAX: 303-595-3772

CONNECTICUT WALLINGFORD 65 SOUTH TURNPIKE ROAD WALLINGFORD, CT 06492 PHONE: 203-269-1354 FAX: 203-269-5465

FLORIDA TAMPA / PUERTO RICO / VIRGIN ISLANDS 3906 EAST 11TH AVENUE TAMPA, FL 33605 PHONE: 813-248-5078 FAX: 813-241-9514

GEORGIA ATLANTA 62 TECHNOLOGY DRIVE ALPHARETTA, GA 30005 PHONE: 770-772-7000 FAX: 770-772-7200

ILLINOIS CHICAGO 340 REMINGTON BOULEVARD BOLINGBROOK, IL 60440 PHONE: 630-296-1400 FAX: 630-226-9420

INDIANA INDIANAPOLIS 5525 W. MINNESOTA STREET INDIANAPOLIS, IN 46241 PHONE: 317-246-5100 FAX: 317-246-5110

IOWA DES MOINES 1943 HULL AVENUE DES MOINES, IA 50313 PHONE: 515-263-6929 FAX: 515-263-6515

MARYLAND BALTIMORE 7071A DORSEY RUN ROAD ELKRIDGE, MD 20175 PHONE: 410-579-2135 FAX: 410-579-2677MASSACHUSETTS BOSTON 6 PULLMAN STREET WORCESTER, MA 01606 PHONE: 508-854-0708 FAX: 508-854-0291

MICHIGAN DETROIT 5993 PROGRESS DRIVE STERLING HEIGHTS, MI 48312 PHONE: 586-978-9800 FAX: 586-978-9969

MINNESOTA MINNEAPOLIS 21080 134TH AVE NORTH ROGERS, MN 55374 PHONE: 763-426-3633 FAX: 763-428-4551

MISSOURI ST. LOUIS 13678 LAKEFRONT DRIVE EARTH CITY, MO 63045 PHONE: 314-373-3032 FAX: 314-373-3038

KANSAS CITY 9810 INDUSTRIAL BLVD. LENEXA, KS 66215 PHONE: 816-587-0272 FAX: 816-587-3735

NEW YORK AUBURN ONE ELLIS DRIVE AUBURN, NY 13021 PHONE: 315-255-3403 FAX: 315-253-9923

NORTH CAROLINA GREENSBORO 1220 ROTHERWOOD ROAD GREENSBORO, NC 27406 PHONE: 336-272-6104 FAX: 336-273-6628

OHIO CINCINNATI 2929 CRESCENTVILLE ROAD WEST CHESTER, OH 45069 PHONE: 513-771-2600 FAX: 513-772-2219

OHIO (continued) CLEVELAND 8929 FREEWAY DRIVE MACEDONIA, OH 44056 PHONE: 330-468-4777 FAX: 330-468-4778

OKLAHOMA TULSA 5555 E. 71ST STREET SUITE 9100 TULSA, OK 74136 PHONE: 918-366-9320 FAX: 918-366-9338

OREGON PORTLAND 12651 SE CAPPS ROAD CLACKAMAS, OR 97015 PHONE: 503-691-9010 FAX: 503-691-9012

PENNSYLVANIA PHILADELPHIA 1035 THOMAS BUSCH MEMORIAL HIGHWAY PENNSAUKEN, NJ 06110 PHONE: 856-661-1442 FAX: 856-663-6363

PITTSBURGH 159 PROMINENCE DRIVE NEW KENSINGTON, PA 15068 PHONE: 724-889-0092 FAX: 724-889-0094

TENNESSEE MEMPHIS 4000 WINCHESTER ROAD MEMPHIS, TN 38118 PHONE: 901-365-2020 FAX: 901-365-3914

TEXAS DALLAS 2920 114TH STREET SUITE 100 GRAND PRAIRIE, TX 75050 PHONE: 214-634-7271 FAX: 214-634-8874

HOUSTON 10355 W. UTILE YORK ROAD SUITE 300 HOUSTON, TX 77041 PHONE: 281-977-6500 FAX: 281-977-6510 UTAH SALT LAKE CITY 2230 SOUTH MAIN STREET SALT LAKE CITY, UT 84115 PHONE: 801-832-0127 FAX: 801-832-8911

WISCONSIN MILWAUKEE 1960 SOUTH CALHOUN ROAD NEW BERLIN, Wl 53151 PHONE: 262-784-5940 FAX: 262-784-1215

ABB Inc. Automation Technologies Drives & Motors16250 West Glendale DriveNew Berlin, WI 53151USATelephone +1 262 785-3200 +1 800 752-0696, opt 1E-mail [email protected] +1 262 780-5135Website www.abb.com/drives

Contact us

©Copyright2013Allspecificationsandpricingsubjecttochangewithoutnotice.

AC

S25

0-P

NP

L01U

-EN

RE

V A

Effe

ctiv

e 10

/01/

2013

drives and controls abb micro drives acs250 price list … · abb micro drives acs250 price list....

Documents