![Page 1: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/1.jpg)
Sequence Analysis '18 lecture 20
• MEME• Gibbs sampling• K-means• ROC• modular HMMs• Gene finding
![Page 2: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/2.jpg)
Why are there Motifs?Selective pressure for:structure -- protein motifs folding units
fibrous proteins coiled coils transmembrane helicesfunction -- protein motifs
active sitebinding motifssignal sequences
expression -- DNA motifs transcription regulation chromatin binding
![Page 3: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/3.jpg)
Zinc finger motif x x x x x x x x x x x x C H x \ / x x Zn x x / \ x C H x x x x x x x x x x
C-x(2,4)-C-x(3)-[LIVMFYWC]-x(8)-H-x(3,5)-H
two Cystines separated by 2 or 4 residues
Loop must be length 12. 4th position in loop must be hydrophobic
two Histidines separated by 3 or 5 residues
Example: selection for structure
![Page 4: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/4.jpg)
ER targeting sequence[KRHQSA]-[DENQ]-E-L
N-glycosylationN-{P}-[ST]-{P}
Tyrosine phosphorylation[RK]-x(2)-[DE]-x(3)-Y or [RK]-x(3)-[DE]-x(2)-Y
C-{DENQ}-[LIVM]-x
C-terminal prenylation
Example: selection for function
![Page 5: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/5.jpg)
What if you don’t know the pattern?
...and you also don't know where it is....?
�5
![Page 6: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/6.jpg)
MEMEmotif elucidation by
maximizing expectation
• T. L. Bailey & C. Elkan, "Fitting a mixture model by expectation maximization to
discover motifs in biopolymers", ISMB, 2:28--36, 1994
1.Calculate the motif model given the locations of the motif.
2.Calculate the locations of the motif given the motif model.
3.Repeat until converged.
![Page 7: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/7.jpg)
Initial guess of motif location
AGCTAGCTTCTCGTGA
TCTCGAGTGGCGCATG
TATTGCTCTCCGCAGC
From the motif locations, you make a profile model.
TMotif Model:L=4
1 2 3 4
C C G
initial guesses underlined
P1 = 2/3 T, 1/3 G
MEME
...and therefore of the motif
![Page 8: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/8.jpg)
Calculate the probability score for each position
AGCTAGCTTCTCGTGA
From the profile model and the sequence, get probability scores.
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16
P = P1(A)P2(G)P3(C)P4(T)=(0)(.33)(.67)(0.)=0.
MEME
TC CG
![Page 9: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/9.jpg)
Calculate the probability score for each position
AGCTAGCTTCTCGTGA
Slide the model along the sequence to get the next score.
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16
P = P1(G)P2(C)P3(T)P4(A)=(.33)(.67)(.33)(0.)=0.
MEME
TC CG
![Page 10: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/10.jpg)
Calculate the probability score for each position
AGCTAGCTTCTCGTGA
Slide the model along the sequence to get the next score.
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16
P = P1(C)P2(T)P3(A)P4(G)=(.0)(.0)(.0)(0.67)=0.
MEME
TC CG
![Page 11: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/11.jpg)
Calculate the probability score for each position
AGCTAGCTTCTCGTGA
Slide the model along the sequence to get the next score.
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16
P = P1(T)P2(C)P3(T)P4(C)=(.67)(.67)(.33)(0.33)=0.05
0.
0.1
MEME
TC CG
![Page 12: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/12.jpg)
Calculate the probability score for each position
AGCTAGCTTCTCGTGA
Slide the model along the sequence to get the next score.
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16
P = P1(G)P2(T)P3(G)P4(A)=(.33)(.0)(.0)(0.0)=0.
MEME
TC CG
![Page 13: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/13.jpg)
Calculate the probability score for each position
AGCTAGCTTCTCGTGA
Do every sequence.
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16
TCTCGAGTGGCGCATG
MEME
TC CG
![Page 14: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/14.jpg)
Calculate the probability score for each position
AGCTAGCTTCTCGTGA
Do every sequence.
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16
TG G
C CT
GC
TCTCGAGTGGCGCATG
TATTGCTCTCCGCAGC
MEME
![Page 15: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/15.jpg)
Re-Calculate the motif model
AGCTAGCTTCTCGTGA TCTCGAGTGGCGCATG
TATTGCTCTCCGCAGC 1.0 TCTC 0.5 TCTC 0.5 GGCG0.1 GCTC0.3 TCTC0.6 TCCG
Probabilities are normalized to sum to one for each sequence, since we expect exactly one motif per sequence.
The new model is the profile built from the hits.
MEME
see next slide...
TC
![Page 16: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/16.jpg)
Recalculating the profile from the hits
1.0 TCTC 0.5 TCTC 0.5 GGCG0.1 GCTC0.3 TCTC0.6 TCCG
P1(T) = the probability of T in the first position = the sum of the scores for sequences with T in the first position, normalized.
P1(T) =1.0+0.5+0.3+0.61.0+0.5+0.5+0.1+0.3+0.6
= 0.8
0.80.2
MEME
TC
![Page 17: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/17.jpg)
Do it again: Re-Calculate the probability scores
AGCTAGCTTCTCGTGA TCTCGAGTGGCGCATG
TATTGCTCTCCGCAGC 1.0 TCTC 0.9 TCTC 0.1 GGCG0.1 GCTC0.6 TCTC0.3 TCCGThe new model is the profile built
from the hits.
using the refined model
MEME
TC
TC
![Page 18: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/18.jpg)
...and again, until converged.
AGCTAGCTTCTCGTGA TCTCGAGTGGCGCATG
TATTGCTCTCCGCAGC 1.0 TCTC 1.0 TCTC 0.0 GGCG0.0 GCTC0.95 TCTC0.05 TCCG
TG
G
CC
TG
C
MEME
TC
![Page 19: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/19.jpg)
EM converges on the conserved pattern if the initial guess was not too far off.
TG
G
CC
TG
C
If the true motif was not one of the initial guesses, or some combination of the initial guesses, then EM would never find the true motif.
A summary of the exercise:
MEME
AGCTAGCTTCTCGTGA
TCTCGAGTGGCGCATG
TATTGCTCTCCGCAGC
TCTCTC CG
![Page 20: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/20.jpg)
Pseudocounts, just in case
1.0 TCTC 0.5 TCTC 0.5 GGCG0.1 GCTC0.3 TCTC0.6 TCCG
No A is observed in the first position, but if we set P(A) = 0, then we “rule out” a motif with A in the first position. Instead, P1(A) = a small pseudocount value / sum of the weights.
This is especially important in the initial guesses, so that the true motif is not missed.
P1(T) = ε1.0+0.5+0.5+0.1+0.3+0.6
= 0.8
MEME
Pseudocounts may be decreased or removed (ε=0) in later stages.
TC CG
![Page 21: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/21.jpg)
Gibbs SamplingStochastic version of MEME.
GIBBS
Radius of convergence is wider than MEME. Doesn’t need to start with one correct guess.
![Page 22: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/22.jpg)
GIBBS samplingmotif elucidation by
maximizing expectation
• T. L. Bailey & C. Elkan, "Fitting a mixture model by expectation maximization to
discover motifs in biopolymers", ISMB, 2:28--36, 1994
1.Calculate the motif model given the locations of the motif.
2.Calculate the locations of the motif given the motif model.
3.Repeat until converged.
![Page 23: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/23.jpg)
AGCTAGCTTCTCGTGA
TCTCGAGTGGCGCATG
TATTGCTCTCCGCAGC
score
aligned position
Slide first sequence through the motif window, calculate score.
GIBBS
keep scoring window fixedmove sequence
Expectation stepStart from random alignment. Select window size and position. Slide one sequence through window. Calculate scores.
![Page 24: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/24.jpg)
Expectation step
AGCTAGCTTCTCGTGA
TCTCGAGTGGCGCATG
TATTGCTCTCCGCAGC
score
aligned position
GIBBS
![Page 25: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/25.jpg)
Example AGCTAGCTTCTCGTGA
TCTCGAGTGGCGCATG
TATTGCTCTCCGCAGC
score
aligned position
GIBBS
Select an aligned position at random from the score distribution.
Do next sequence, and so on, cycling through the sequences many times.
![Page 26: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/26.jpg)
Example AGCTAGCTTCTCGTGA
TCTCGAGTGGCGCATG
TATTGCTCTCCGCAGC
score
aligned position
GIBBS
Select an aligned position at random from the score distribution.
Do next sequence, and so on, cycling through the sequences many times.
![Page 27: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/27.jpg)
Convergence is when there are no more changes.
AGCTAGCTTCTCGTGA
TCTCGAGTGGCGCATG
TATTGCTCTCCGCAGC
GIBBS
Exactly one segment is aligned to the motif region at each step.
![Page 28: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/28.jpg)
Gibbs SamplingStochastic version of MEME.
(1) Choose initial (or random) guesses of motif locations.
(2) Calculate the motif model (w/ or w/o pseudocounts/noise) from the current motif positions.
(3) Slide one sequence against the model. Calculate probability score at each position.
(4) Randomly choose a motif position from the probability distribution.
(5) Repeat until converged.
GIBBS
Radius of convergence is wider than MEME. Doesn’t need to start with a correct guess.
![Page 29: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/29.jpg)
Transcription factor binding sitesExample:
We know that upstream of every gene that expresses in the presence of lysine, there must be a signal for a transcription factor (TF). But we don’t know which TF and we don’t know where it binds.
![Page 30: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/30.jpg)
Transcription factor binding site
NOTE: It’s palindromic in this case. Palindromy in TF footprints (binding sites) is due to the symmetry of the TFs, which are almost invariably dimeric.
Example: selection for expression
This is what we want to find
a pattern, motif, signature, footprint.
a geneupstream of a gene
![Page 31: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/31.jpg)
What is Expectation/Maximization ?
EM is any method that iterates between an “expectation” step and a “maximization” step. Starting with a statistical model and a set of data.
•Expectation Calculate the expected values for the parameters of the model, using the current model and the data.
•Maximization Replace the parameters of the model with their expected values.
MEME is an EM algorithm. Gibbs sampling is not.
![Page 32: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/32.jpg)
Finding recurrent sequences by Kmeans clustering
HDFPIEGGDSPMQTIFFWSNANAKLSHGY CPYDNIWMQTIFFNQSAAVYSVLHLIFLT IDMNPQGSIEMQTIFFGYAESA ELSPVVNFLEEMQTIFFISGFTQTANSD INWGSMQTIFFEEWQLMNVMDKIPS IFNESKKKGIAMQTIFFILSGR PPPMQTIFFVIVNYNESKHALWCSVD PWMWNLMQTIFFISQQVIEIPS MQTIFFVFSHDEQMKLKGLKGA
Short, recurrent sequence patterns may exist in different protein because they are required to initiate folding
Non
-hom
olog
pro
tein
s
recurrent sequence
Is is a recurrent structure?Bystroff C & Baker D. (1998). Prediction of local structure in proteins using a library of sequence-structure motifs. J Mol Biol 281, 565-77.
![Page 33: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/33.jpg)
Step 2: Cluster protein sequence profiles
Each dot represents a segment of a profile from a MSA from a BLAST search
Each circle represents a cluster of profiles (same length)
Step 1: Compile a database of sequence profiles from MSAs
![Page 34: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/34.jpg)
K-means clustering(1) Choose K.
(2) Randomly select K centers in the metric space.
(3) Get the distance from each center to each data point.
(4) Assign each data point to the nearest center.
(5) Calculate the new centers using the center-of-mass of the data points.
(6) Repeat from Step 3 until converged.
Final positions of the centers define K clusters of data points.
![Page 35: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/35.jpg)
Example: K=2
x x
![Page 36: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/36.jpg)
Example: K=2
x x
![Page 37: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/37.jpg)
Example: K=2
x x
x
x
![Page 38: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/38.jpg)
Example: K=2
x x
x
x
![Page 39: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/39.jpg)
Example: K=2
x x
x
x
x
x
![Page 40: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/40.jpg)
Example: K=2
x x
x
x
x
x
![Page 41: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/41.jpg)
Example: K=2
x x
x
x
x
xx
x
![Page 42: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/42.jpg)
Example: K=2
x x
x
x
x
xx
x
no change.Converged.
Final cluster centers
![Page 43: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/43.jpg)
K-means clustering
(1) Requires knowledge of K, the number of classes
(2) Requires the objects to exist in a “metric space”.
(3) Stochastic. Depends on the starting points.
![Page 44: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/44.jpg)
Distance/similarity metrics for profiles. We tried them all.
(1) Manhattan, or City-Block metric (a distance metric)
D( p, q) = P pij( ) − P qij( )amînoacidsi
∑positions
j
∑
(2) Entropy (a similarity metric) NOTE: not symmetrical!
S(p,q) = pij log qij( )amînoacidsi
∑positions
j
∑
(3) Correlation (a similarity metric)
S(p,q) =
pij − p( ) qij − q( )amînoacidsi
∑positions
j
∑
pij − p( )2 qij − q( )2amînoacidsi
∑positions
j
∑amînoacidsi
∑positions
j
∑=
pij − p( ) qij − q( )amînoacidsi
∑positions
j
∑
σ pσ q
D( p, q) = LLR pij( )LLR qij( )amînoacidsi
∑positions
j
∑(4) Dpq (similarity metric)
![Page 45: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/45.jpg)
Step 3: Refine using Supervised learning
training set
Search the database for the 400 nearest
neighbors
sequence profile
nearest neighbors
remove all cluster members that do not
conform with the paradigm
Supervised learning finds predictive correlations between two spaces (sequence space and structure space)
We want this profile to predict...
…as long as it is consistent with this
structure.
![Page 46: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/46.jpg)
diverging type-2 turn
Serine hairpin
Proline helix C-cap alpha-alpha corner glycine helix N-cap
Frayed helix
Type-I hairpin
Amino acids arranged from non-polar to polar
Backbone angles: ψ=green, φ=red
Results: I-sites library
![Page 47: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/47.jpg)
How do you compare two predictive models?
Accuracy = percent of the predictions that are correct, of the ones that were made.
Coverage = number of possible predictions that were actually predicted.
Confidence = a score to sort the predictions. A more confident prediction should be a more accurate one.
T
F
+ –
T+
T-
F-
F+
Selectivity = Accuracy = T+/(T+ + F+)
Sensitivity = Coverage = T+/(T+ + F-)
OK. But accuracy depends on coverage
OK. But coverage depends on accuracy
Does the confidence of a prediction match its accuracy?
![Page 48: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/48.jpg)
Receiver Operator Characteristic (ROC)
•A way to describe the whole set of scores with a single number.
•Each score has a T or F.
•Sort the scores.
•Starting from the highest scoring, draw a vector up for a true, to the right for a false.
•Calculate ROC = the normalized area under this curve.
•If all of the true scores are greater that the greatest false score, then ROC = 1.0.
• 0.≤ROC≤1.
Better way to compare two predictive models
![Page 49: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/49.jpg)
ROC score0.990 T0.978 F 0.972 T0.966 T0.951 T0.902 F 0.880 F 0.811 F 0.803 F 0.792 T0.766 F 0.751 F 0.723 F 0.696 F 0.688 T0.666 F 0.651 F 0.623 F 0.596 F 0.488 T
Sort the scores, for each score move up one if it is true, right one if it is false.
The area under the curve, divided by the total, is the ROC score. 0 ≤ ROC ≤ 1.
number of falses
num
ber o
f tru
es
![Page 50: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/50.jpg)
In class exercise: calculate ROC score
0.811 T0.972 T0.766 T0.990 F 0.966 T0.951 F 0.803 F 0.792 F 0.503 F 0.978 T0.478 F
4 T39 F 44 T44 T40 T1 F 39 F 29 F 10 F 44 F 45 T
Which method is better?
Method A Method B
![Page 51: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/51.jpg)
I-sites word HMM
= HMMSTR! Hidden Markov Model for local protein STRucture
HMM of linked I-sites motifs. Each node is one amino acid.
Size of HMMSTR:282 nodes 317 transitions
(Bystroff et al., JMB 2000)
Motifs can be words in a word-HMM
![Page 52: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/52.jpg)
SplicingGene finding
![Page 53: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/53.jpg)
�53
HMMs can be modular
A C
G T
A C
G TNon-emitting connector state
![Page 54: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/54.jpg)
Gene Prediction: Computational Challenge
aatgcatgcggctatgctaatgcatgcggctatgctaagctgggatccgatgacaatgcatgcggctatgctaatgcatgcggctatgcaagctgggatccgatgactatgctaagctgggatccgatgacaatgcatgcggctatgctaatgaatggtcttgggatttaccttggaatgctaagctgggatccgatgacaatgcatgcggctatgctaatgaatggtcttgggatttaccttggaatatgctaatgcatgcggctatgctaagctgggatccgatgacaatgcatgcggctatgctaatgcatgcggctatgcaagctgggatccgatgactatgctaagctgcggctatgctaatgcatgcggctatgctaagctgggatccgatgacaatgcatgcggctatgctaatgcatgcggctatgcaagctgggatcctgcggctatgctaatgaatggtcttgggatttaccttggaatgctaagctgggatccgatgacaatgcatgcggctatgctaatgaatggtcttgggatttaccttggaatatgctaatgcatgcggctatgctaagctgggaatgcatgcggctatgctaagctgggatccgatgacaatgcatgcggctatgctaatgcatgcggctatgcaagctgggatccgatgactatgctaagctgcggctatgctaatgcatgcggctatgctaagctcatgcggctatgctaagctgggaatgcatgcggctatgctaagctgggatccgatgacaatgcatgcggctatgctaatgcatgcggctatgcaagctgggatccgatgactatgctaagctgcggctatgctaatgcatgcggctatgctaagctcggctatgctaatgaatggtcttgggatttaccttggaatgctaagctgggatccgatgacaatgcatgcggctatgctaatgaatggtcttgggatttaccttggaatatgctaatgcatgcggctatgctaagctgggaatgcatgcggctatgctaagctgggatccgatgacaatgcatgcggctatgctaatgcatgcggctatgcaagctgggatccgatgactatgctaagctgcggctatgctaatgcatgcggctatgctaagctcatgcgg
Gene!
Thanks to Pavel Pevzner (UCSD) and Chris Burge (MIT) for slides and images.
![Page 55: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/55.jpg)
• Statistical: coding segments (ORFs or exons) have typical sequences on either end and use different subwords than non-coding segments (introns or intergenic regions).
• Similarity-based: many human genes are similar to genes in mice, chicken, or even bacteria. Therefore, already known mouse, chicken, and bacterial genes may help to find human genes.
Two Approaches to Gene Prediction
![Page 56: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/56.jpg)
Gene Prediction and Motifs
• Upstream regions of genes often contain motifs that can be used for gene prediction
• Reading frame should be “long enough”.
-10
STOP
0 10-35
ATG
TATACT Pribnow Box
TTCCAA GGAGG Ribosomal binding site
Transcription start site
![Page 57: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/57.jpg)
Promoter Structure in Prokaryotes (E.Coli)
Transcription starts at offset 0.
• Pribnow Box (-10)
• Gilbert Box (-30)
• Ribosomal Binding Site (+10)
![Page 58: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/58.jpg)
Ribosomal Binding Site
![Page 59: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/59.jpg)
An Introduction to Bioinformatics Algorithms www.bioalgorithms.info
Central Dogma of biology
Protein
RNA
DNA
transcription
translation
CCTGAGCCAACTATTGATGAA
PEPTIDE
CCUGAGCCAACUAUUGAUGAA
![Page 60: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/60.jpg)
An Introduction to Bioinformatics Algorithms www.bioalgorithms.info
• In 1977, Phillip Sharp and Richard Roberts experimented with mRNA of hexon, a viral protein.
– Map hexon mRNA in viral genome by hybridization to adenovirus DNA and electron microscopy
– mRNA-DNA hybrids formed three curious loop structures instead of contiguous duplex segments
Discovery of Split Genes
![Page 61: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/61.jpg)
An Introduction to Bioinformatics Algorithms www.bioalgorithms.info
Expanded Central Dogma exon1 exon2 exon3
intron1 intron2
transcription
translation
splicing
exon = coding intron = non-coding
replication
folding
![Page 62: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/62.jpg)
An Introduction to Bioinformatics Algorithms www.bioalgorithms.info
Splicing mechanism
(http://genes.mit.edu/chris/)
exon1 exon2GU AGA
“branchpoint”5’ splice site3’ splice site
“the donor”“the acceptor”
Spliceosome: Def: A ribonucleoprotein complex, containing RNA and small nuclear ribonucleoproteins (snRNPs) that is assembled during the splicing of messenger RNA primary transcript to excise an intron.
![Page 63: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/63.jpg)
Splicing mechanism
exon1 exon2GU AGA
exon1exon2GU
AGA
exon1 exon2GUAGA
3’-OH
(1)
(2)
(3)
pre-mRNA
lariat loop forms
exon 1 cleaved from lariat.
Spliceosome (not shown) forms.
sans spliceosome
![Page 64: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/64.jpg)
Splicing mechanism
exon1
exon2GUAGA
3’-OH
exon1 exon2GU
AGA
goes to ribosomegets degraded
the “lariat”
Spliceosome (not shown) disassociates.
(4)
(5)
exon 1,2 positioned to ligate
+ ligated exonsliberated lariat
![Page 65: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/65.jpg)
Splicing mechanism on the web
http://neuromuscular.wustl.edu/pathol/diagrams/splicefunct.html
http://neuromuscular.wustl.edu/pathol/diagrams/splicemech.html
Much thanks to T. Wilson, UCSC!
google: wustl neuromuscular splicefunct
google: wustl neuromuscular splicemech
![Page 66: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/66.jpg)
�66
Evolutionary models for introns
Penny, David, Marc P. Hoeppner, Anthony M. Poole, and Daniel C. Jeffares. "An overview of the introns-first theory." Journal of molecular evolution 69, no. 5 (2009): 527-540.
![Page 67: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/67.jpg)
How to find splice points, using BLAST.
(1) Translate the DNA in all 6 frames.
(2) Search the database of protein sequences using the translations (blastx).
(3) Using the complete protein sequence, align it to the translation and find the regions of (near) perfect identity. These will abruptly end at the intron start site.
(4) Find the 5’-GT or 3’-AG signal at the point where the identity matches abruptly end.
(5) If your translation has an insertion with nearly perfect matches on either side, you have an alternative splicing.
![Page 68: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/68.jpg)
In Class exercise: find the alternative spliced variants
Go to NCBI, search nucleotides for AKAP9 (you should get the sequence with accession number NM_005751.4, GI:197245395)
Select “BLAST sequence”
Select blastx (not tblastx)
Select the nr/nt database. Organism: homo sapiens
Submit.
While waiting, do exercise on the next page....
![Page 69: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/69.jpg)
A sure sign of alternative splicing in blastx output:
Score = 160 bits (404), Expect = 8e-37 Identities = 85/116 (73%), Positives = 86/116 (74%) Frame = +2
Query: 76820 RSHENGFMEDLDKTWVRYQECDSRSNAPATLTFENMAGAFSFIHSRVGSPWXXXXXXXXX 76999 +SHENGFMEDLDKTWVRYQECDSRSNAPATLTFENMA Sbjct: 778 KSHENGFMEDLDKTWVRYQECDSRSNAPATLTFENMA----------------------- 814
Query: 77000 XXXXRHTGVFMLVAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQ 77167 GVFMLVAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQSbjct: 815 -------GVFMLVAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQ 863
Identical up to the insertion. Identical after the insertion. These must be the same gene.
![Page 70: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/70.jpg)
HMM for pre-mRNA
3'UTR
AUG
exon
intron (0|1|2)
stop (UAA|UAG|UGA)
5'UTR
5’ splice site (GU...)3’ splice site (...AG)
XXXXXXATG...XXXGUX...XXAGXX...XXGUX...XXAGXX...XXTAAXXX
exon intron exon intron ...
![Page 71: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/71.jpg)
Intron model for mammals
acceptor motif (contains AG)
donor motif(contains GU)
poly-pyrimidine region
branch site
from: Blencowe, BJ. “Exonic splicing enhancers: mechanism of ction, diversity and role in human genetic diseases. TIBS 25:106 (2000)
![Page 72: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/72.jpg)
�72
Introns and exons have length distriutions
From Chris Burge's thesis, Stanford 1997
![Page 73: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/73.jpg)
�73
Exons/ORF have 3-base repeats(Tiwari, 1997)Performed a Fourier transformation on DNA sequences; found periodicity of 3 in ORFs and exons, but no periodicity in intergenetic regions anad introns.
Tiwari, S., Ramachandran, S., Bhattacharya, A., Bhattacharya, S., & Ramaswamy, R. (1997). Prediction of probable genes by Fourier analysis of genomic sequences. Bioinformatics, 13(3), 263-270.
0100100100100100100100100000100100010010010011001001001001CATGAGCATGATTACGACCATCATGTCCATGATCGATGACGATTAACTACTAGGATCA
UA=
S(f) = Σ Σ Uα exp( 2πi f j)α jFourier transform of the sequence in binary form, summed over all 4 binary sequences
codingnot coding
![Page 74: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/74.jpg)
�74
3-base repeats are an intrinsic property of the genetic code!
(Tiwari, 1997)Fourier transformation of (a) a eukaryotic gene showing periodicity of 3, (b) same gene after accounting for codon bias, (c) same protein sequence, using randomly selected codons.
Periodicity of 3 persists. So it is a property of the genetic code!
![Page 75: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/75.jpg)
HMM module for introns is made to reproduce length distributions
Stanke M, Steinkamp R, Waack S, Morgenstern B. “AUGUSTUS: a web server for gene finding in eukaryotes. “ Nucleic Acids Res. 2004 Jul 1;32:W309-12.
donor sitesequence model
acceptor site sequence model
fixed length + variable length intron sub-model
short variable length intron sub-model, including branch point
DSS ASS
Ifixed Igeo
Ishortp
1-p q
1-q
1
1
![Page 76: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/76.jpg)
A genefinding HMM: Genescan
initial exon model
intron models
internal exon model
terminal exon model
single exon modelIntergentic Regions
Mirrored models for reverse complement strand
middle exon model
![Page 77: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/77.jpg)
GENESCAN -- forward strand part
internal exon 0-frame exon 1-frame exon 2-frame
donor splice site
acceptor splice site
non-emitting state
non-emitting state
initial exon 0-frame
terminal exon
intron (short)
intron (long)
![Page 78: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/78.jpg)
�78
Summary of gene finding HMMs of the GeneScan type.
» Periodicity is seen in exons/ORFs» Length distributions are seen in introns,
exons.» Various motifs are found in introns» Upstream (promotor) and downstream
(poly-A signal) bracket genes.» ALL OF THIS DATA CAN BE CODED INTO
A HMM.
![Page 79: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/79.jpg)
TwinScan• Aligns two sequences and marks each base as
gap ( - ), mismatch (:), match (|), resulting in a new alphabet of 12 letters: Σ {A-, A:, A |, C-, C:, C |, G-, G:, G |, T-, T:, T|}.
• Run Viterbi algorithm using emissions ek(b) where b ∊ {A-, A:, A|, …, T|}.
http://www.standford.edu/class/cs262/Spring2003/Notes/ln10.pdf
Using statistics and homology at the same time
![Page 80: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/80.jpg)
TwinScan
more gaps, mismatches
fewer gaps, mismatches
E IbE={A-, A:, A|,
C-, C:, C|, G-, G:, G|, T-, T:, T|}
bI={A-,A:, A|, C-,C:, C|,
G-,G:, G|, T-,T:, T|}
Exon (E) state emits matches (N|), Intron state (I) emits mismatches (N:) and gaps (N-). Gamma values (forward backward values) predict introns, exons. May be combined with motif models for intron, codon models.
exon intron
exonE
intronI
exonE
exonE
exonE
intronI
intronI
![Page 81: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/81.jpg)
Splicing factsExons average 145 nucleotides in length
Contain regulatory elements :ESEs: Exonic splicing enhancersESSs: Exonic splicing silencers
Introns average more than 10x longer than exonsContain regulatory elements(bind regulatory complexes)
ISEs: Intronic splicing enhancersISSs: Intronic splicing silencers
Splice sites5' splice site
Sequence: AGguragu (r = purine)U1 snRNP: Binds to 5' splice site
3' splice siteSequence: yyyyyyy nagG (y= pyrimidine)
Branch siteSequence: ynyuray (r = purine)U2 snRNP: Binds to branch site via RNA:RNA
interactions between snRNA and pre-mRNA
![Page 82: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/82.jpg)
Alternative splicing factsAlternative splicing
Definition: Joining of different 5' and 3' splice sites~80% of alternative splicing results in changes in the encoded proteinUp to 59% of human genes express more than one mRNA by
alternative splicingFunctional effects: Generates several forms of mRNA from single geneAllows functionally diverse protein isoforms to be expressed according to
different regulatory programsStructural effects:
Insert or remove amino acidsShift reading frameIntroduce termination codonGene expression effectsRemoves or inserts regulatory elements controlling translation, mRNA
stability, or localizationRegulation
Splicing pathways modulated according to: Cell typeDevelopmental stageGender External stimuli
![Page 83: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/83.jpg)
�83
Review
1. What information is used to find genes in prokaryotes?2. How were introns discovered?3. What is the better way to find genes: by homology, or by
statistical models?4. Where is the ribosome binding site relative to the
transcription start site?5. Where is the Pribnow Box? Gilbert box? 6. How can HMMs be linked together to make a larger model?7. What happens to the intron once it is removed?8. What is alternative splicing?9. What do DNA alignments tell you about introns/exons?10.What is a splicing enhancer? silencer?
![Page 84: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/84.jpg)
Review
Why are there motifs in proteins?
What does MEME do?
How is Gibbs sampling different from MEME?
What kind of data can be clustered using K-means?
What is supervised learning? How is it different from machine learning?
What kind of data goes into a ROC score?
![Page 85: MEME • Gibbs sampling • ROC • modular HMMs • Gene findingStochastic version of MEME. (1) Choose initial (or random) guesses of motif locations. (2) Calculate the motif model](https://reader036.vdocuments.us/reader036/viewer/2022062607/604390a99d38944d370e288f/html5/thumbnails/85.jpg)
�85
How to find motifs, signatures, footprints
MEME -- deterministic EM algorithm for motif finding, needs initial guess.
Gibbs sampling -- stochastic EM algorithm for motif finding, doesn’t need initial guess.
K-means -- unsupervised learning of recurrent patterns, requires a metric space (distance or similarity).
Supervised learning -- EM. Expectation in one "space", maximization in the other.
Method for comparing prediction methodsROC
Aligning (or not) low complexity sequencesmaskingnull models for repeatsword HMMs
Review