bioinformatics tools
DESCRIPTION
Bioinformatics Tools. Stuart M. Brown, Ph.D Dept of Cell Biology NYU School of Medicine. Stuart M. Brown, Ph.D Dept of Cell Biology NYU School of Medicine. Bioinformatics Tools. Overview. - PowerPoint PPT PresentationTRANSCRIPT
![Page 1: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/1.jpg)
Bioinformatics Tools
Stuart M. Brown, Ph.D
Dept of Cell Biology
NYU School of Medicine
![Page 2: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/2.jpg)
Bioinformatics ToolsStuart M. Brown, Ph.DDept of Cell Biology
NYU School of Medicine
![Page 3: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/3.jpg)
OverviewThis lecture will summarize a huge amount of bioinformatics material that is usually presented as a full 12 week course.
– Data management and analysis of sequences from the HGP
– A quick look at GenBank and ENTREZ.– Gene finding and translation– Similarity searching and alignment (BLAST)– Protein structure and function
![Page 4: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/4.jpg)
Data Management and Analysis
• The Human Genome Project has generated huge quantities of DNA sequence data.
• This data will lead to many medial advances.
• But a great deal of analysis and research will be needed.
![Page 5: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/5.jpg)
Access to the Data
•Organize the genome data & provide access for scientists
•Use the Internet
• The data is public, so anyone can access it.
![Page 6: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/6.jpg)
GenBank•All Genome Project data is stored in a database
called GenBank managed by the National Center for Biotechnology Information (NCBI)
•The NCBI is a branch of the National Library of Medicine, which is part of the NIH (National
Institutes of Health).
http://ncbi.nlm.nih.gov
![Page 7: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/7.jpg)
![Page 8: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/8.jpg)
GenBank Sections
In addition to DNA sequences of genes GenBank has a number of other sections including:
• Protein sequences (translated from DNA)
• Short RNA fragments (ESTs)
• Cancer Genome Anatomy Project (CGAP) gene expression profiles of normal, pre-cancer, and cancer cells from a wide variety of tissue types
• Single Nucleotide Polymorphisms (SNPs) which represent genetic variations in the human population
• Online Mendelian Inheritance in Man (OMIM) a database of human genetic disorders
![Page 9: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/9.jpg)
Finding Genes•GenBank contains approximately 13 billion bases in 12 million sequence records (as of August 2001).
•These billions of G, A, T, and C letters would be almost useless without descriptions of what genes they contain, the organisms they come from, etc.
•All of this information is contained in the "annotation" part of each sequence record.
![Page 10: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/10.jpg)
![Page 11: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/11.jpg)
Entrez is a Tool for Finding Sequences
• NCBI has created a Web-based tool called Entrez for finding sequences in GenBank.
• Each sequence in GenBank has a unique “accession number”.
• Entrez can also search for keywords such as gene names, protein names, and the names of orgainisms or biological functions
![Page 12: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/12.jpg)
![Page 13: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/13.jpg)
Entrez has links to Medline
• Entrez is much more than just a tool for finding sequences by keywords.
• It contains links to PubMed/Medline
• Entrez also contains all known protein sequences and 3-D protein structures.
![Page 14: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/14.jpg)
![Page 15: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/15.jpg)
Entrez is Internally Cross-linked
• DNA and protein sequences are linked to other similar sequences
• Medline citations are linked to other citations that contain similar keywords
• 3-D structures are linked to similar structures
![Page 16: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/16.jpg)
![Page 17: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/17.jpg)
• These relationships might include genes in a multi-gene family, related journal articles, or other proteins in the same biochemical pathway
• This potential for horizontal movement through the linked databases makes Entrez a dynamic tool.
• You can start with only a vague set of keywords or a sequence from the laboratory and rapidly access a set of relevant literature and related database sequences.
![Page 18: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/18.jpg)
Similarity Searching
• There are a variety of computer programs that are used for making comparisons between DNA sequences.
• The most popular is known as BLAST (Basic Local Alignment Search Tool)
• BLAST is free at the NCBI website
![Page 19: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/19.jpg)
![Page 20: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/20.jpg)
BLAST Searches GenBank
The NCBI BLAST web server lets you compare your query sequence to various sections of GenBank
– nr = non-redundant (main sections)
– month = new sequences from the past few weeks
– ESTs
– human, drososphila, yeast, or E.coli genomes
– proteins (by automatic translation)
• This is a VERY fast and powerful computer.
![Page 21: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/21.jpg)
BLAST is Complex
• Similarity searching relies on the concepts of alignment and distance between pairs of sequences.
• Distances can only be measured between aligned sequences (match vs. mismatch at each position).
• A similarity search is a process of testing the best alignment of a query sequence with every sequence in a database.
![Page 22: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/22.jpg)
Search with Protein not DNA
1) 4 DNA bases vs. 20 amino acids - less random similarity
2) Can have varying degrees of similarity between different AAs- # of mutations, chemical similarity,
PAM matrix
3) Protein databanks are much smaller than DNA databanks.
![Page 23: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/23.jpg)
BLAST has Automatic Translation
• BLASTX makes automatic translation (in all 6 reading frames) of your DNA query sequence to compare with protein databanks
• TBLASTN makes automatic translation of an entire DNA database to compare with your protein query sequence
• Only make a DNA-DNA search if you are working with a sequence that does not code for protein.
![Page 24: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/24.jpg)
• >gb|BE588357.1|BE588357 194087 BARC 5BOV Bos taurus cDNA 5'.• Length = 369
• Score = 272 bits (137), Expect = 4e-71• Identities = 258/297 (86%), Gaps = 1/297 (0%)• Strand = Plus / Plus•
• Query: 17 aggatccaacgtcgctccagctgctcttgacgactccacagataccccgaagccatggca 76• |||||||||||||||| | ||| | ||| || ||| | |||| ||||| ||||||||| • Sbjct: 1 aggatccaacgtcgctgcggctacccttaaccact-cgcagaccccccgcagccatggcc 59• • Query: 77 agcaagggcttgcaggacctgaagcaacaggtggaggggaccgcccaggaagccgtgtca 136• |||||||||||||||||||||||| | || ||||||||| | ||||||||||| ||| ||• Sbjct: 60 agcaagggcttgcaggacctgaagaagcaagtggagggggcggcccaggaagcggtgaca 119• • Query: 137 gcggccggagcggcagctcagcaagtggtggaccaggccacagaggcggggcagaaagcc 196• |||||||| | || | ||||||||||||||| ||||||||||| || ||||||||||||• Sbjct: 120 tcggccggaacagcggttcagcaagtggtggatcaggccacagaagcagggcagaaagcc 179• • Query: 197 atggaccagctggccaagaccacccaggaaaccatcgacaagactgctaaccaggcctct 256• ||||||||| | |||||||| |||||||||||||||||| ||||||||||||||||||||• Sbjct: 180 atggaccaggttgccaagactacccaggaaaccatcgaccagactgctaaccaggcctct 239• • Query: 257 gacaccttctctgggattgggaaaaaattcggcctcctgaaatgacagcagggagac 313• || || ||||| || ||||||||||| | |||||||||||||||||| ||||||||• Sbjct: 240 gagactttctcgggttttgggaaaaaacttggcctcctgaaatgacagaagggagac 296
![Page 25: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/25.jpg)
Understand the Statistics!
• BLAST produces an E-value for every match– This is the same as the P value in a statistical test
• A match is generally considered significant if the E-value < 0.05 (smaller numbers are more significant)
• Very low E-values (e-100) are homologs or identical genes
• Moderate E-values are related genes• Long regions of moderate similarity are
more important than short regions of high identity.
![Page 26: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/26.jpg)
BLAST is Approximate
• BLAST makes similarity searches very quickly because it takes shortcuts.– looks for short, nearly identical “words” (11 bases)
• It also makes errors – misses some important similarities– makes many incorrect matches
• easily fooled by repeats or skewed composition
![Page 27: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/27.jpg)
Bad Genome Annotation
• Gene finding is at best only 90% accurate.
• New sequences are automatically annotated with BLAST scores.
• Bad annotations propagate
• Its going to take us 10-20 years or more to sort this mess out!
![Page 28: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/28.jpg)
Protein Function• The ultimate goal of the HGP is to
identify all of the genes and determine their functions
• Genes function by being translated into proteins:
– structural– enzymes– regulatory– signalling
![Page 29: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/29.jpg)
Translation• Once we have found the DNA sequence of a gene,
we can decode the amino acid sequence of the corresponding protein .
• The “Genetic Code” is actually quite simple.
![Page 30: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/30.jpg)
Chemical Properties
Some chemical properties of a protein can be calculated from its amino acid sequence:
• molecular weight• charge/pH• hydrophobicity
![Page 31: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/31.jpg)
Patterns in Proteins
![Page 32: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/32.jpg)
Conserved Domains
• Proteins are built out of functional units know as domains (or motifs)
• These domains have conserved sequences Often much more similar than their respective proteins Exon splicing theory (W. Gilbert)
• Exons correspond to folding domains which in turn serve as functional units
• Unrelated proteins may share a single similar exon (i.e.. ATPase or DNA binding function)
![Page 33: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/33.jpg)
Simple Structures
Some motifs form structures that can be recognized as simple sequence patterns:
– transmembrane domains–coiled coils–helix-turn-helix–signal peptides
![Page 34: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/34.jpg)
Functional Motifs
• Other functional portions of proteins can be recognized by their sequence, even if their 3-D structure is not known.
• There are many databases of protein motifs/domains: ProSite, Pfam, ProDom, etc.
![Page 35: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/35.jpg)
Tools for Finding Motifs
• Define a motif from a set of known proteins that share a similar sequence and function.
• A pattern is a list of amino acids that can occur at each position in the motif.
• A profile is a matrix that assigns a value to every amino acid at every position in the motif.
• A HMM is a more complex profile based on pairs of amino acids.
![Page 36: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/36.jpg)
![Page 37: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/37.jpg)
Protein 3-D Structure
![Page 38: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/38.jpg)
Structure = Function
• Proteins function by 3-D interactions with other molecules (i.e. physical chemistry).
• So for a protein, 3-D structure is function.
• But we can’t accurately determine 3-D structure from gene sequence.
![Page 39: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/39.jpg)
Structure Prediction
Predicting a protein’s 3-D structure from its amino acid sequence is incredibly complex.
– proteins are polypeptides (long chains of amino acids)
– can fold and rotate around bonds within each amino acid as well as the bonds between them
– it is not possible to evaluate every possible folding pattern for an amino acid sequence
![Page 40: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/40.jpg)
Secondary Structure• The local structure of the amino acids in a
protein can also be predicted to some extent.
• Each amino acid has a tendency to form either an alpha helix or a beta sheet
....,....1....,....2....,....3....,....4....,....5....,....6 AA |MMSGAPSATQPATAETQHIADQVRSQLEEKYNKKFPVFKAVSFKSQVVAGTNYFIKVHVG| PHD sec | HHHHHHHHHHHHHHHH EEEEEEEEEEEEE EEEEEEEE | Rel sec |999997899667599999999989997655877843368889999999233399999658| detail: prH sec |000000000221289999999989998762011111000000000000000000000000| prE sec |000000000000000000000000000010000023578889989888536699999720| prL sec |999898889777600000000010001126888865311110000000363300000278| subset: SUB sec |LLLLLLLLLLLLLHHHHHHHHHHHHHHHHLLLLL...EEEEEEEEEEE....EEEEEELL| ACCESSIBILITY 3st: P_3 acc |bbebbeeeeeebbeebbebbeebeeebeeeeeee eebebbebebbbbbb bbbbeb bb| 10st: PHD acc |007006778670077007007706760777777737707007060000005000060500| Rel acc |103021343252044604644672424555547615444425212186671016926120| subset: SUB acc |.......e..e..eeb.ebbeeb.e.beeeeeee.eebeb.e....bbbb...bb.b...|
![Page 41: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/41.jpg)
Threading
• Rather than computing a 3-D structure from scratch, it may be possible to find a similar structure.
• Must have ~25% aa sequence identity.
• Uses a process called threading to create a new structure based on a known structure.
• This still requires HUGE amounts of computer power.
![Page 42: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/42.jpg)
![Page 43: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/43.jpg)
Protein Data Base
• There is a database of all known protein structures called the PDB.
• These have been determined by X-ray crystalography and/or NMR.
• Anyone download and view these structures with a PDB viewer program.
![Page 44: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/44.jpg)
RasMol
RasMol is the simplest PDB viewer.
http://www.umass.edu/microbio/rasmol/
It can work together with a web browser to let you view the structure of any sequence found with Entrez that has a known 3-D structure.
![Page 45: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/45.jpg)
Gene Finding & Translation
• How can we find genes on chromosomes?
• Genome project data is just huge chunks of DNA.
• Does automatic annotation work?
![Page 46: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/46.jpg)
Raw Genome Data:
![Page 47: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/47.jpg)
Finding Genes is Not Easy
• Perhaps 1% of human DNA encodes functional genes.
• Genes are interspersed among long stretches of non-coding DNA.
• Repeats, pseudo-genes, and introns confound matters
![Page 48: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/48.jpg)
Pattern Finding ToolsIt is possible to use DNA sequence patterns to predict genes:
• Promoters • translational start and stop codes (ORFs)• intron splice sites• codon usage
![Page 49: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/49.jpg)
![Page 50: Bioinformatics Tools](https://reader035.vdocuments.us/reader035/viewer/2022062519/568152a2550346895dc0c72c/html5/thumbnails/50.jpg)
Similarity to Known Genes
• It is also possible to scan new DNA sequence for known genes
• Can look for annotated genes/proteins
• Or just for RNAs (ESTs)