[xls]poa pipeline overview - unep dtu cdm/ji pipeline...

152

Upload: votruc

Post on 27-May-2018

217 views

Category:

Documents


0 download

TRANSCRIPT

The Pipeline was produced by Joergen Fenhann, UNEP DTU Partnership, 1st June 2018, [email protected], Phone (+45)40202789

CERs issuedLine ID Idval Ref. Title Region Sub-region Host country Other host countries PoA Boundary Coordinating Entity Policy Status PoA-Type CPA-Type Sub-type Techmeasure Methodology yrs. Slo-pe CPA Credit start 2012 ktCO2 2020 ktCO2 Validator First issuance Until Verifier Credit buyer Withdrawn credit buyer PoA/CPA Consultant Start comment Replacing Host LoA Reg. Request Review history Env Analysis EIA Required Local Stakeholder SD1 SD2 SD3 SD4 SD5 SD6 MW Public Funding Barrier Analysis Type CER2007 CER2008 CER2009 CER2010 CER2011 CER2012 CER2013 CER2014 CER2015 CER2016 CER2017 CER2018 CER2019 CER2020 CER2021 CER2022 CER2023 CER2024 CER2025 CER2026 CER2027 CER2028 CER2029 CER2030 CER2031 CER2032 CER2033 CER2034 CER2035 CER2036 CER2037 CER2038 CER2039 CER2040

1PoA0001 U99FBI1CTGOOD52D6YAYSQ19V8ODLM 2765 Installation of Solar Home Systems in Bangladesh Asia & Pacific Southern Asia Bangladesh Bangladesh Registered Solar Solar Solar PV AMS-I.A. 13 568.8 22-Jun-07 28 12.142 4,149.184 DNV 18.373 793.260 811.633 2 13-Jan-15 31-Dec-15 54.744 Grameen Shakti 4-Dec-07 23-May-12 26-Jun-12 17-Aug-12 26-Jun-12 PoA 30-Dec-99PoA 5 9 7 10 6 123.5

2CPA0001.01 2765-0001 Asia & Pacific Southern Asia Bangladesh Bangladesh Registered Solar Solar Solar PV AMS-I.A. 1 45.7 7 25 9.0 1-Jul-12 12.142 388.874 DNV 18.373 95.482 113.855 2 13-Jan-15 31-Dec-15 Grameen Shakti 4-Dec-07 26-Jun-12 30-Dec-99PoA 5 9 7 10 6 0 10.0 Yes Plist 22.857 45.713 45.713 45.713 45.713 45.713 45.713 22.857

3CPA0001.02 2765-0002 Asia & Pacific Southern Asia Bangladesh Bangladesh Registered Solar Solar Solar PV AMS-I.A. 1 47.8 7 25 9.0 1-Jul-13 0.000 358.617 DNV 78.249 78.249 1 7-Aug-15 31-Dec-15 Grameen Shakti 28-Jun-13 30-Dec-99 5 9 7 10 6 0 10.5 Yes Plist 23.886 47.772 47.772 47.772 47.772 47.772 47.772 23.886

4CPA0001.03 2765-0003 Asia & Pacific Southern Asia Bangladesh Bangladesh Registered Solar Solar Solar PV AMS-I.A. 1 39.1 7 25 9.0 1-Jul-13 0.000 293.585 DNV 71.425 71.425 1 7-Aug-15 31-Dec-15 Grameen Shakti 28-Jun-13 30-Dec-99 5 9 7 10 6 0 8.9 Yes Plist 19.555 39.109 39.109 39.109 39.109 39.109 39.109 19.555

5CPA0001.04 2765-0004 Asia & Pacific Southern Asia Bangladesh Bangladesh Registered Solar Solar Solar PV AMS-I.A. 1 35.3 7 25 9.0 1-Jul-13 0.000 265.194 DNV 56.627 56.627 1 7-Aug-15 31-Dec-15 Grameen Shakti 28-Jun-13 30-Dec-99 5 9 7 10 6 0 7.6 Yes Plist 17.664 35.327 35.327 35.327 35.327 35.327 35.327 17.664

6CPA0001.05 2765-0005 Asia & Pacific Southern Asia Bangladesh Bangladesh Registered Solar Solar Solar PV AMS-I.A. 1 45.9 7 25 9.0 1-Jul-13 0.000 344.504 DNV 75.930 75.930 1 7-Aug-15 31-Dec-15 Grameen Shakti 28-Jun-13 30-Dec-99 5 9 7 10 6 0 9.7 Yes Plist 22.946 45.892 45.892 45.892 45.892 45.892 45.892 22.946

7CPA0001.06 2765-0006 Asia & Pacific Southern Asia Bangladesh Bangladesh Registered Solar Solar Solar PV AMS-I.A. 1 47.6 7 25 9.0 1-Jul-13 0.000 357.574 DNV 78.406 78.406 1 7-Aug-15 31-Dec-15 Grameen Shakti 28-Jun-13 30-Dec-99 5 9 7 10 6 0 10.3 Yes Plist 23.817 47.633 47.633 47.633 47.633 47.633 47.633 23.817

8CPA0001.07 2765-0007 Asia & Pacific Southern Asia Bangladesh Bangladesh Registered Solar Solar Solar PV AMS-I.A. 1 36.7 7 25 9.0 1-Jul-13 0.000 275.591 DNV 59.029 59.029 1 7-Aug-15 31-Dec-15 Grameen Shakti 28-Jun-13 30-Dec-99 5 9 7 10 6 0 7.8 Yes Plist 18.356 36.712 36.712 36.712 36.712 36.712 36.712 18.356

9CPA0001.08 2765-0008 Asia & Pacific Southern Asia Bangladesh Bangladesh Registered Solar Solar Solar PV AMS-I.A. 1 34.7 7 25 9.0 1-Jul-13 0.000 260.630 DNV 72.071 72.071 1 7-Aug-15 31-Dec-15 Grameen Shakti 28-Jun-13 30-Dec-99 5 9 7 10 6 0 8.0 Yes Plist 17.360 34.719 34.719 34.719 34.719 34.719 34.719 17.360

10CPA0001.09 2765-0009 Asia & Pacific Southern Asia Bangladesh Bangladesh Registered Solar Solar Solar PV AMS-I.A. 1 41.5 7 25 0.0 1-Sep-13 0.000 304.302 DNV 51.489 51.489 1 7-Aug-15 31-Dec-15 Grameen Shakti 30-Aug-13 30-Dec-99PoA 5 9 7 10 6 0 8.9 Yes Plist 41.475 41.475 41.475 41.475 41.475 41.475 41.475

11CPA0001.10 2765-0010 Asia & Pacific Southern Asia Bangladesh Bangladesh Registered Solar Solar Solar PV AMS-I.A. 1 44.1 7 25 0.0 1-May-14 0.000 294.102 DNV 24.843 24.843 1 7-Aug-15 31-Dec-15 Grameen Shakti 30-Aug-13 30-Dec-99PoA 5 9 7 10 6 0 9.5 Yes Plist 44.067 44.067 44.067 44.067 44.067 44.067 44.067

12CPA0001.11 2765-0011 Asia & Pacific Southern Asia Bangladesh Bangladesh Registered Solar Solar Solar PV AMS-I.A. 1 46.7 7 25 0.0 1-Jan-15 0.000 280.082 DNV 13.770 13.770 1 7-Aug-15 31-Dec-15 Grameen Shakti 30-Aug-13 30-Dec-99PoA 5 9 7 10 6 0 10.1 Yes Plist 46.659 46.659 46.659 46.659 46.659 46.659 46.659

13CPA0001.12 2765-0012 Asia & Pacific Southern Asia Bangladesh Bangladesh Registered Solar Solar Solar PV AMS-I.A. 1 51.2 7 25 0.0 1-Sep-13 0.000 375.771 DNV 59.682 59.682 1 7-Aug-15 31-Dec-15 Grameen Shakti 30-Aug-13 30-Dec-99PoA 5 9 7 10 6 0 11.0 Yes Plist 51.216 51.216 51.216 51.216 51.216 51.216 51.216

14CPA0001.13 2765-0013 Asia & Pacific Southern Asia Bangladesh Bangladesh Registered Solar Solar Solar PV AMS-I.A. 1 52.5 7 25 0.0 1-May-14 0.000 350.357 DNV 56.257 56.257 1 7-Aug-15 31-Dec-15 Grameen Shakti 30-Aug-13 30-Dec-99PoA 5 9 7 10 6 0 11.3 Yes Plist 52.496 52.496 52.496 52.496 52.496 52.496 52.496

15PoA0002 XCH8BCVGVGQBLUE1OWYT4ID47EN3XA 2767 Latin America South America Brazil Sadia Registered Methane avoidance Methane avoidance Manure AMS-III.D. 1050 1,030.0 29-Oct-09 28 2,365.116 10,616.011 DNV 0.000 United K. (European Carbon Fund) Sadia 22-Feb-08 17-Apr-12 5-Aug-09 29-Oct-09 1 CPA 30-Dec-99PoA 3 1 6 8 5 9 0.0

16CPA0002.01 2767-0001 BRA/SC – 8150354S01/ 3SP Latin America South America Brazil Santa Catarina Sadia Registered Methane avoidance Methane avoidance Manure Biodigesters with biogas combustion AMS-III.D. 1 0.1 7 21 0.0 29-Oct-09 0.416 1.465 DNV United K. (European Carbon Fund) Sadia 22-Feb-08 10-Jun-09 5-Aug-09 29-Oct-091 30-Dec-99 3 1 6 8 5 9 0 Yes 0.131 0.131 0.131 0.131 0.131 0.131 0.131 0.131 0.131 0.131 0.131 0.131 0.131 0.131 0.131 0.131 0.131 0.131 0.131 0.131 0.131 17CPA0002.02 2767-0002-0962BRA/SC – CPA Group 2 Latin America South America Brazil Many Sadia Registered Methane avoidance Manure AMS-III.D. 961 902.9 7 0.0 20-Aug-10 2,132.600 9,365.423 DNV Sadia 20-Aug-10 30-Dec-99 0.018CPA0002.03 2767-0963-1050BRA/SC - CPA Group 3 Latin America South America Brazil Many Sadia Registered Methane avoidance Manure AMS-III.D. 88 127.0 7 0.0 4-Mar-11 232.100 1,249.123 DNV Sadia 4-Mar-11 30-Dec-99 0.019PoA0003 EZZKC8Y2XVGW3IDGD2F1R3U5Q7GJ3P New Energies Commercial Solar Water Heating Programme in South Africa Africa Southern Africa South Africa South Africa At Validation Solar Solar Solar water heating AMS-I.C. 1 1.0 27-Mar-07 28 4.113 9.678 PwC 0.000 United K. (EcoSecurities) EcoSecurities 5-Jul-08 PoA 30-Dec-99PoA 5 8 9 10 0.0

20CPA0003.01 Africa Southern Africa South Africa Gauteng At Validation Solar Solar Solar water heating Solar Water Heaters AMS-I.C. 1 1.0 10 15 0.0 1-Oct-08 4.113 9.678 PwC United K. (EcoSecurities) EcoSecurities 5-Jul-08 30-Dec-99 5 8 9 10 0 0.930 No 0.968 0.968 0.968 0.968 0.968 0.968 0.968 0.968 0.968 0.968

21PoA0004 7VKAGAZ64KCANHRWZWCZMSU4AX1GGE 2535 Latin America North America Mexico Mexico Cool nrg Carbon Investments Registered EE households EE households Lighting AMS-II.C. 25 607.1 1-Jun-09 28 74.872 6,070.750 DNV 19.241 99.097 243.230 1 20-Dec-12 30-Nov-10 United K. (Cool nrg Carbon Investments) Cool nrg Carbon Investments 16-Jul-08 3-Jul-08 6-Apr-09 31-Jul-09 3 PoA 30-Dec-99PoA 4 8 9 5 7 0.0

22CPA0004.01 2535-0001 Latin America North America Mexico State of Puebla Cool nrg Carbon Investments Registered EE households EE households Lighting AMS-II.C. 1 24.3 10 10 -0.5 1-Dec-09 74.872 242.830 DNV 19.241 19.241 1 21-Dec-12 30-Nov-10 DNV United K. (Cool nrg Carbon Investments) Cool nrg Carbon Investments 16-Jul-08 31-Jul-093 30-Dec-99 4 8 9 5 7 1 China 0.514 No Financial;Other 3 27.665 27.386 26.827 26.827 26.268 25.709 25.150 22.914 19.561 15.369

23CPA0004.02 2535-0002 Latin America North America Mexico Mexico Cool nrg Carbon Investments Registered EE households EE households Lighting AMS-II.C. 1 24.3 10 10 -0.5 1-Sep-13 0.000 242.830 DNV 7.491 7.491 DNV Cool nrg Carbon Investments 22-May-13 30-Dec-99 4 8 9 5 7 1 China No Financial;Other 3 26.268 25.709 25.150 22.914 19.561 15.369

24CPA0004.03 2535-0003 Latin America North America Mexico Mexico Cool nrg Carbon Investments Registered EE households EE households Lighting AMS-II.C. 1 24.3 10 10 -0.5 1-Sep-13 0.000 242.830 DNV 7.491 7.491 DNV Cool nrg Carbon Investments 22-May-13 30-Dec-99 4 8 9 5 7 1 China No Financial;Other 3 26.268 25.709 25.150 22.914 19.561 15.369

25CPA0004.04 2535-0004 Latin America North America Mexico Mexico Cool nrg Carbon Investments Registered EE households EE households Lighting AMS-II.C. 1 24.3 10 10 -0.5 1-Sep-13 0.000 242.830 DNV 7.491 7.491 DNV Cool nrg Carbon Investments 22-May-13 30-Dec-99 4 8 9 5 7 1 China No Financial;Other 3 26.268 25.709 25.150 22.914 19.561 15.369

26CPA0004.05 2535-0005 Latin America North America Mexico Mexico Cool nrg Carbon Investments Registered EE households EE households Lighting AMS-II.C. 1 24.3 10 10 -0.5 1-Sep-13 0.000 242.830 DNV 7.491 7.491 DNV Cool nrg Carbon Investments 22-May-13 30-Dec-99 4 8 9 5 7 1 China No Financial;Other 3 26.268 25.709 25.150 22.914 19.561 15.369

27CPA0004.06 2535-0006 Latin America North America Mexico Mexico Cool nrg Carbon Investments Registered EE households EE households Lighting AMS-II.C. 1 24.3 10 10 -0.5 1-Sep-13 0.000 242.830 DNV 7.491 7.491 DNV Cool nrg Carbon Investments 22-May-13 30-Dec-99 4 8 9 5 7 1 China No Financial;Other 3 26.268 25.709 25.150 22.914 19.561 15.369

28CPA0004.07 2535-0007 Latin America North America Mexico Mexico Cool nrg Carbon Investments Registered EE households EE households Lighting AMS-II.C. 1 24.3 10 10 -0.5 1-Sep-13 0.000 242.830 DNV 8.806 8.806 DNV Cool nrg Carbon Investments 22-May-13 30-Dec-99 4 8 9 5 7 1 China No Financial;Other 3 26.268 25.709 25.150 22.914 19.561 15.369

29CPA0004.08 2535-0008 Latin America North America Mexico Mexico Cool nrg Carbon Investments Registered EE households EE households Lighting AMS-II.C. 1 24.3 10 10 -0.5 1-Sep-13 0.000 242.830 DNV 8.806 8.806 DNV Cool nrg Carbon Investments 22-May-13 30-Dec-99 4 8 9 5 7 1 China No Financial;Other 3 26.268 25.709 25.150 22.914 19.561 15.369

30CPA0004.09 2535-0009 Latin America North America Mexico Mexico Cool nrg Carbon Investments Registered EE households EE households Lighting AMS-II.C. 1 24.3 10 10 -0.5 1-Sep-13 0.000 242.830 DNV 8.806 8.806 DNV Cool nrg Carbon Investments 22-May-13 30-Dec-99 4 8 9 5 7 1 China No Financial;Other 3 26.268 25.709 25.150 22.914 19.561 15.369

31CPA0004.10 2535-0010 Latin America North America Mexico Mexico Cool nrg Carbon Investments Registered EE households EE households Lighting AMS-II.C. 1 24.3 10 10 -0.5 1-Sep-13 0.000 242.830 DNV 8.806 8.806 DNV Cool nrg Carbon Investments 22-May-13 30-Dec-99 4 8 9 5 7 1 China No Financial;Other 3 26.268 25.709 25.150 22.914 19.561 15.369

32CPA0004.11 2535-0011 Latin America North America Mexico Mexico Cool nrg Carbon Investments Registered EE households EE households Lighting AMS-II.C. 1 24.3 10 10 -0.5 1-Sep-13 0.000 242.830 DNV 8.806 8.806 DNV Cool nrg Carbon Investments 22-May-13 30-Dec-99 4 8 9 5 7 1 China No Financial;Other 3 26.268 25.709 25.150 22.914 19.561 15.369

33CPA0004.12 2535-0012 Latin America North America Mexico Mexico Cool nrg Carbon Investments Registered EE households EE households Lighting AMS-II.C. 1 24.3 10 10 -0.5 1-Sep-13 0.000 242.830 DNV 8.806 8.806 DNV Cool nrg Carbon Investments 22-May-13 30-Dec-99 4 8 9 5 7 1 China No Financial;Other 3 26.268 25.709 25.150 22.914 19.561 15.369

34CPA0004.13 2535-0013 Latin America North America Mexico Mexico Cool nrg Carbon Investments Registered EE households EE households Lighting AMS-II.C. 1 24.3 10 10 -0.5 1-Sep-13 0.000 242.830 DNV 8.806 8.806 DNV Cool nrg Carbon Investments 22-May-13 30-Dec-99 4 8 9 5 7 1 China No Financial;Other 3 26.268 25.709 25.150 22.914 19.561 15.369

35CPA0004.14 2535-0014 Latin America North America Mexico Mexico Cool nrg Carbon Investments Registered EE households EE households Lighting AMS-II.C. 1 24.3 10 10 -0.5 1-Sep-13 0.000 242.830 DNV 8.806 8.806 DNV Cool nrg Carbon Investments 22-May-13 30-Dec-99 4 8 9 5 7 1 China No Financial;Other 3 26.268 25.709 25.150 22.914 19.561 15.369

36CPA0004.15 2535-0015 Latin America North America Mexico Mexico Cool nrg Carbon Investments Registered EE households EE households Lighting AMS-II.C. 1 24.3 10 10 -0.5 1-Sep-13 0.000 242.830 DNV 8.806 8.806 DNV Cool nrg Carbon Investments 22-May-13 30-Dec-99 4 8 9 5 7 1 China No Financial;Other 3 26.268 25.709 25.150 22.914 19.561 15.369

37CPA0004.16 2535-0016 Latin America North America Mexico Mexico Cool nrg Carbon Investments Registered EE households EE households Lighting AMS-II.C. 1 24.3 10 10 -0.5 1-Sep-13 0.000 242.830 DNV 8.806 8.806 DNV Cool nrg Carbon Investments 22-May-13 30-Dec-99 4 8 9 5 7 1 China No Financial;Other 3 26.268 25.709 25.150 22.914 19.561 15.369

38CPA0004.17 2535-0017 Latin America North America Mexico Mexico Cool nrg Carbon Investments Registered EE households EE households Lighting AMS-II.C. 1 24.3 10 10 -0.5 1-Sep-13 0.000 242.830 DNV 12.191 12.191 DNV Cool nrg Carbon Investments 22-May-13 30-Dec-99 4 8 9 5 7 1 China No Financial;Other 3 26.268 25.709 25.150 22.914 19.561 15.369

39CPA0004.18 2535-0018 Latin America North America Mexico Mexico Cool nrg Carbon Investments Registered EE households EE households Lighting AMS-II.C. 1 24.3 10 10 -0.5 1-Sep-13 0.000 242.830 DNV 12.191 12.191 DNV Cool nrg Carbon Investments 22-May-13 30-Dec-99 4 8 9 5 7 1 China No Financial;Other 3 26.268 25.709 25.150 22.914 19.561 15.369

40CPA0004.19 2535-0019 Latin America North America Mexico Mexico Cool nrg Carbon Investments Registered EE households EE households Lighting AMS-II.C. 1 24.3 10 10 -0.5 1-Sep-13 0.000 242.830 DNV 12.191 12.191 DNV Cool nrg Carbon Investments 22-May-13 30-Dec-99 4 8 9 5 7 1 China No Financial;Other 3 26.268 25.709 25.150 22.914 19.561 15.369

41CPA0004.20 2535-0020 Latin America North America Mexico Mexico Cool nrg Carbon Investments Registered EE households EE households Lighting AMS-II.C. 1 24.3 10 10 -0.5 1-Sep-13 0.000 242.830 DNV 12.191 12.191 DNV Cool nrg Carbon Investments 22-May-13 30-Dec-99 4 8 9 5 7 1 China No Financial;Other 3 26.268 25.709 25.150 22.914 19.561 15.369

42CPA0004.21 2535-0021 Latin America North America Mexico Mexico Cool nrg Carbon Investments Registered EE households EE households Lighting AMS-II.C. 1 24.3 10 10 -0.5 1-Sep-13 0.000 242.830 DNV 12.191 12.191 DNV Cool nrg Carbon Investments 22-May-13 30-Dec-99 4 8 9 5 7 1 China No Financial;Other 3 26.268 25.709 25.150 22.914 19.561 15.369

43CPA0004.22 2535-0022 Latin America North America Mexico Mexico Cool nrg Carbon Investments Registered EE households EE households Lighting AMS-II.C. 1 24.3 10 10 -0.5 1-Sep-13 0.000 242.830 DNV 12.191 12.191 DNV Cool nrg Carbon Investments 22-May-13 30-Dec-99 4 8 9 5 7 1 China No Financial;Other 3 26.268 25.709 25.150 22.914 19.561 15.369

44CPA0004.23 2535-0023 Latin America North America Mexico Mexico Cool nrg Carbon Investments Registered EE households EE households Lighting AMS-II.C. 1 24.3 10 10 -0.5 1-Sep-13 0.000 242.830 DNV 12.191 12.191 DNV Cool nrg Carbon Investments 22-May-13 30-Dec-99 4 8 9 5 7 1 China No Financial;Other 3 26.268 25.709 25.150 22.914 19.561 15.369

45CPA0004.24 2535-0024 Latin America North America Mexico Mexico Cool nrg Carbon Investments Registered EE households EE households Lighting AMS-II.C. 1 24.3 10 10 -0.5 1-Sep-13 0.000 242.830 DNV 6.668 6.668 DNV Cool nrg Carbon Investments 22-May-13 30-Dec-99 4 8 9 5 7 1 China No Financial;Other 3 26.268 25.709 25.150 22.914 19.561 15.369

46CPA0004.25 2535-0025 Latin America North America Mexico Mexico Cool nrg Carbon Investments Registered EE households EE households Lighting AMS-II.C. 1 24.3 10 10 -0.5 1-Sep-13 0.000 242.830 DNV 6.469 6.469 DNV Cool nrg Carbon Investments 22-May-13 30-Dec-99 4 8 9 5 7 1 China No Financial;Other 3 26.268 25.709 25.150 22.914 19.561 15.369

47PoA0005 HP4RCRTEE2TQTH1BO7QXKW3JB1M9KC 2956 Uganda Municipal Waste Compost Programme Africa East Africa Uganda Uganda Registered Landfill gas Landfill gas Landfill composting AMS-III.F. 12 117.0 12-Apr-10 21 136.847 1,018.526 AENOR 16.549 0.000 16.549 1 7-Jan-15 30-Apr-12 0.322 WB-CF 24-Sep-08 5-Feb-08 11-Sep-09 12-Apr-10 3 CPA 31-Dec-99PoA 1 6 5 9 8 0.048CPA0005.01 2956-0001 Municipal waste composting Project for Jinja Municipality Africa East Africa Uganda Eastern Registered Landfill gas Landfill gas Landfill composting Aerobic composting facility AMS-III.F. 1 8.4 7 15 1.0 12-Apr-09 23.492 98.170 AENOR 7.944 7.944 1 7-Jan-15 30-Apr-12 WB-CF 24-Sep-08 12-Apr-103 30-Dec-99 1 6 5 9 8 0 Yes 2.043 5.010 7.312 9.127 10.583 11.768 12.747 49CPA0005.02 2956-0002 Africa East Africa Uganda Registered Landfill gas Landfill gas Landfill composting Aerobic composting facility AMS-III.F. 1 10.2 7 15 1.5 19-Apr-11 17.304 98.776 AENOR 0.892 0.892 1 7-Jan-15 30-Apr-12 WB-CF 19-Apr-103 30-Dec-99 1 6 5 9 8 0 Yes 5.258 7.571 9.361 10.770 11.894 12.805 13.553

50CPA0005.03 2956-0003 Africa East Africa Uganda Western Registered Landfill gas Landfill gas Landfill composting Aerobic composting facility AMS-III.F. 1 10.2 7 15 1.8 19-Apr-11 14.326 98.776 AENOR 1.416 1.416 1 7-Jan-15 30-Apr-12 WB-CF 19-Apr-11 30-Dec-99 1 6 5 9 8 0 Yes 2.235 5.239 7.501 9.232 10.581 11.652 12.515

51CPA0005.04 2956-0004 Africa East Africa Uganda Western Registered Landfill gas Landfill gas Landfill composting Aerobic composting facility AMS-III.F. 1 8.8 7 15 1.7 19-Apr-11 15.033 85.813 AENOR 0.894 0.894 1 7-Jan-15 30-Apr-12 WB-CF 19-Apr-11 30-Dec-99 1 6 5 9 8 0 Yes 2.535 5.692 8.006 9.729 11.035 12.041 12.831

52CPA0005.05 2956-0005 MUNICIPAL WASTE COMPOSTING PROJECT FOR LIRA MUNICIPALITY Africa East Africa Uganda Northern Registered Landfill gas Landfill gas Landfill composting Aerobic composting facility AMS-III.F. 1 9.6 7 15 1.3 19-Apr-11 16.352 93.338 AENOR 0.812 0.812 1 7-Jan-15 30-Apr-12 WB-CF 19-Apr-11 30-Dec-99 1 6 5 9 8 0 Yes 5.002 7.184 8.865 10.180 11.226 12.071 12.763

53CPA0005.06 2956-0006 Africa East Africa Uganda Eastern Registered Landfill gas Landfill gas Landfill composting Aerobic composting facility AMS-III.F. 1 9.8 7 15 1.4 19-Apr-11 16.649 95.037 AENOR 2.091 2.091 1 7-Jan-15 30-Apr-12 WB-CF 19-Apr-11 30-Dec-99 1 6 5 9 8 0 Yes 4.929 7.173 8.937 10.346 11.489 12.429 13.213

54CPA0005.07 2956-0007 Africa East Africa Uganda Central Registered Landfill gas Landfill gas Landfill composting Aerobic composting facility AMS-III.F. 1 10.2 7 15 1.5 19-Apr-11 17.401 99.329 AENOR 1.302 1.302 1 7-Jan-15 30-Apr-12 WB-CF 19-Apr-11 30-Dec-99 1 6 5 9 8 0 Yes 5.090 7.450 9.318 10.817 12.034 13.035 13.866

55CPA0005.08 2956-0008 MUNICIPAL WASTE COMPOSTING PROJECT FOR SOROTI Africa East Africa Uganda Eastern Registered Landfill gas Landfill gas Landfill composting Aerobic composting facility AMS-III.F. 1 9.6 7 15 1.4 19-Apr-11 16.290 92.989 AENOR 1.198 1.198 1 7-Jan-15 30-Apr-12 WB-CF 19-Apr-11 30-Dec-99 1 6 5 9 8 0 Yes 4.731 6.943 8.699 10.116 11.275 12.236 13.042

56CPA0005.09 2956-0009 Municipal Waste Composting Project for Mbarara Africa East Africa Uganda Western Registered Methane avoidance Landfill gas Landfill composting Aerobic composting facility AMS-III.F. 1 9.3 7 15 1.8 12-Dec-12 74.782 AENOR 1 7-Jan-15 30-Apr-12 WB-CF 12-Dec-12 30-Dec-99 1 6 5 9 8 0 Yes 2.747 6.073 8.478 10.243 11.557 12.552 13.317 57CPA0005.10 2956-0010 Municipal Waste composting Project for Arua Municipality Africa East Africa Uganda Arua Registered Methane avoidance Landfill gas Landfill composting Aerobic composting facility AMS-III.F. 1 10.3 7 15 2.1 20-Feb-15 60.505 AENOR WB-CF 18-Mar-15 30-Dec-99 1 6 5 9 8 0 Yes 2.783 6.316 9.056 11.217 12.950 14.361 15.526 58CPA0005.11 2956-0011 Municipal Waste composting Project for Masindi Municipality Africa East Africa Uganda Masindi Registered Methane avoidance Landfill gas Landfill composting Aerobic composting facility AMS-III.F. 1 10.3 7 15 2.1 20-Feb-15 60.505 AENOR WB-CF 18-Mar-15 30-Dec-99 1 6 5 9 8 0 Yes 2.783 6.316 9.056 11.217 12.950 14.361 15.526 59CPA0005.12 2956-0012 Municipal Waste composting Project for Hoima Municipality Africa East Africa Uganda Hoima Registered Methane avoidance Landfill gas Landfill composting Aerobic composting facility AMS-III.F. 1 10.3 7 15 2.1 20-Feb-15 60.505 AENOR WB-CF 18-Mar-15 30-Dec-99 1 6 5 9 8 0 Yes 2.783 6.316 9.056 11.217 12.950 14.361 15.526 60PoA0006 13CA6BEZZDGI9SHXI1ROZJ07GEBY8Q 5927 Africa West Africa Senegal Senegal Registered EE households EE households Lighting AMS-II.C. 1 4.2 1-Jan-09 28 0.000 41.730 AENOR 0.000 Italy (IBRD) WB-CF 3-Dec-08 28-Oct-09 10-Oct-12 10-Oct-12 PoA 30-Dec-99PoA 10 9 1 6 8 7 0.0 MSC Yes

61CPA0006.01 5927-0001 Africa West Africa Senegal Saint-Louis Registered EE households EE households Lighting AMS-II.C. 1 4.2 10 25 1.0 10-Oct-12 41.730 AENOR Italy (IBRD) WB-CF 3-Dec-08 10-Oct-12 30-Dec-99 10 9 1 6 8 7 0 0.800 5.0 No MSC Yes 0.607 3.033 4.044 4.125 4.208 4.292 4.378 4.465 4.555 4.646

62PoA0007 QLPECOPSXV6XH8YWC32E7APNLZWU6M 3562 Masca Small Hydro Programme Latin America Central America Honduras Honduras Hidromasca Registered Hydro Hydro Run of river AMS-I.D. 4 36.5 1-Sep-11 28 5.845 283.201 TÜV-SÜD 0.000 Netherlands (ORBEO) ORBEO 16-Dec-08 22-Jun-09 26-Mar-10 24-Jul-10 21-Aug-10 CPA 30-Dec-99CPA 5 10 9 12.263CPA0007.01 3562-0001 Matarras I Latin America Central America Honduras Atlántida Hidromasca Registered Hydro Hydro Run of river 1.15 MW run of river plant AMS-I.D. 1 4.4 7 30 0.0 1-Sep-11 5.845 41.048 TÜV-SÜD Netherlands (ORBEO) ORBEO 16-Dec-08 21-Aug-10 30-Dec-99 5 10 9 0 1.2 6983 0.629 No Other 3 1.465 4.395 4.395 4.395 4.395 4.395 4.395 2.930 64CPA0007.02 3562-0002 Mangungo I Hydroelectric Project Latin America Central America Honduras Atlántida Hidromasca Registered Hydro Hydro Run of river 1.5 MW run of river plant AMS-I.D. 1 5.3 7 30 0.0 16-May-13 0.000 40.782 TÜV-SÜD ORBEO 16-May-13 30-Dec-99 5 10 9 0 1.5 No Other 3 5.343 5.343 5.343 5.343 5.343 5.343 5.343 65CPA0007.03 3562-0003 Morjá Hydroelectric Project Latin America Central America Honduras El Paraiso Hidromasca Registered Hydro Hydro Run of river 8.6 MW run of river plant AMS-I.D. 1 22.8 7 30 0.0 1-Jul-13 0.000 170.984 TÜV-SÜD ORBEO 16-May-13 30-Dec-99 5 10 9 0 8.6 No Other 3 11.389 22.777 22.777 22.777 22.777 22.777 22.777 11.389 66CPA0007.04 3562-0004 Peña Blanca I Hydroelectric Project Latin America Central America Honduras Cortes Hidromasca Registered Hydro Hydro Run of river 0.908 MW run of river plant AMS-I.D. 1 4.0 7 30 0.0 16-May-13 0.000 30.386 TÜV-SÜD ORBEO 16-May-13 30-Dec-99 5 10 9 0 0.9 No Other 3 3.981 3.981 3.981 3.981 3.981 3.981 3.981 67PoA0008 OXEVYP45BDLBC0N23JPOLZ72NDRBMO 4659 Solar Water Heater Programme in Tunisia Africa North Africa Tunisia Tunisia Registered Solar Solar Solar water heating AMS-I.C. 8 41.8 23-Jan-07 28 15.719 417.630 TÜV-SÜD 90.148 29-Dec-17 31-Dec-14 TÜV-SÜD France (Solvay) EcoSecurities 30-Jan-09 1-Jan-11 13-Apr-11 13-Apr-11 PoA 30-Dec-99PoA 1 12 8 5 11 9 0.068CPA0008.01 4659-0001 Solar Water Heater Programme in Tunisia – CPA 1 Africa North Africa Tunisia Many Registered Solar Solar Solar water heating 14,690 solar water heaters (SWH) AMS-I.C. 1 7.2 10 15 0.0 13-Apr-11 4.606 72.420 TÜV-SÜD 10.276 12.524 22.800 29-Dec-17 31-Dec-14 TÜV-SÜD France (Solvay) EcoSecurities 30-Jan-09 13-Apr-11 30-Dec-99 1 12 8 5 11 9 0 0.550 No 7.242 7.242 7.242 7.242 7.242 7.242 7.242 7.242 7.242 7.242 69CPA0008.02 4659-0002 Solar Water Heater Programme in Tunisia – CPA 2 Africa North Africa Tunisia Many Registered Solar Solar Solar water heating 11,706 solar water heaters (SWH) AMS-I.C. 1 4.3 10 15 0.0 24-Aug-12 1.517 42.980 TÜV-SÜD 1.363 7.659 9.022 29-Dec-17 31-Dec-14 TÜV-SÜD EcoSecurities 24-Aug-12 30-Dec-99 1 12 8 5 11 9 0 0.550 No 1.531 4.298 4.298 4.298 4.298 4.298 4.298 4.298 4.298 4.298 2.767 70CPA0008.03 4659-0003 Solar Water Heater Programme in Tunisia – CPA 3 Africa North Africa Tunisia Many Registered Solar Solar Solar water heating 13,729 solar water heaters (SWH) AMS-I.C. 1 5.0 10 15 0.0 24-Aug-12 1.780 50.420 TÜV-SÜD 1.465 8.226 9.691 29-Dec-17 31-Dec-14 TÜV-SÜD EcoSecurities 24-Aug-12 30-Dec-99 1 12 8 5 11 9 0 0.542 No 1.796 5.042 5.042 5.042 5.042 5.042 5.042 5.042 5.042 5.042 3.246 71CPA0008.04 4659-0004 Solar Water Heater Programme in Tunisia – CPA 4 Africa North Africa Tunisia Many Registered Solar Solar Solar water heating 14,669 solar water heaters (SWH) AMS-I.C. 1 5.4 10 15 0.0 24-Aug-12 1.891 53.570 TÜV-SÜD 1.490 8.367 9.857 29-Dec-17 31-Dec-14 TÜV-SÜD EcoSecurities 24-Aug-12 30-Dec-99 1 12 8 5 11 9 0 0.542 No 1.908 5.357 5.357 5.357 5.357 5.357 5.357 5.357 5.357 5.357 3.449 72CPA0008.05 4659-0005 Solar Water Heater Programme in Tunisia – CPA 5 Africa North Africa Tunisia Many Registered Solar Solar Solar water heating 15,604 solar water heaters (SWH) AMS-I.C. 1 5.6 10 15 0.0 24-Aug-12 1.970 55.820 TÜV-SÜD 1.622 9.109 10.731 29-Dec-17 31-Dec-14 TÜV-SÜD EcoSecurities 24-Aug-12 30-Dec-99 1 12 8 5 11 9 0 0.542 No 1.988 5.582 5.582 5.582 5.582 5.582 5.582 5.582 5.582 5.582 3.594 73CPA0008.06 4659-0006 Solar Water Heater Programme in Tunisia – CPA 6 Africa North Africa Tunisia Many Registered Solar Solar Solar water heating 14,103 solar water heaters (SWH) AMS-I.C. 1 5.0 10 15 0.0 24-Aug-12 1.760 49.870 TÜV-SÜD 1.588 8.917 10.505 29-Dec-17 31-Dec-14 TÜV-SÜD EcoSecurities 24-Aug-12 30-Dec-99 1 12 8 5 11 9 0 0.542 No 1.776 4.987 4.987 4.987 4.987 4.987 4.987 4.987 4.987 4.987 3.211 74CPA0008.07 4659-0007 SOLAR WATER HEATER PROGRAMME IN TUNISIA – CPA7 Africa North Africa Tunisia Many Registered Solar Solar Solar water heating 12,553 solar water heaters (SWH) AMS-I.C. 1 4.4 10 15 0.0 15-Dec-12 2.195 43.900 TÜV-SÜD 0.181 7.814 7.995 29-Dec-17 31-Dec-14 TÜV-SÜD EcoSecurities 15-Dec-12 30-Dec-99 1 12 8 5 11 9 0 0.542 No 0.216 4.390 4.390 4.390 4.390 4.390 4.390 4.390 4.390 4.390 4.174 75CPA0008.08 4659-0008 Solar Water Heater Programme in Tunisia – CPA 8 Africa North Africa Tunisia Many Registered Solar Solar Solar & wind 14232 solar water heaters (SWH) AMS-I.C. 1 4.9 10 15 0.0 2-Jan-13 0.000 48.650 TÜV-SÜD 9.547 9.547 29-Dec-17 31-Dec-14 TÜV-SÜD EcoSecurities 2-Jan-13 30-Dec-99 1 12 8 5 11 9 0 0.542 no 4.865 4.865 4.865 4.865 4.865 4.865 4.865 4.865 4.865 4.865 76PoA0009 HE32EW4OAHP1Z5KCDI8J3I0WCS53M0 Asia & Pacific East Asia South Korea Dongsuh Foods Corporation Validation Terminated EE industry EE industry Food AMS-II.D. 1 2.7 28-May-08 28 9.275 26.500 DNV 0.000 Japan (PEAR Carbon Offset Initiative) Climate experts 18-Apr-09 2-Jan-13 CPA 30-Dec-99CPA 4 7 9 0.0

77CPA0009.01 Asia & Pacific East Asia South Korea Incheon Dongsuh Foods Corporation Validation Terminated EE industry EE industry Food AMS-II.D. 1 2.7 10 15 0.0 10-Jul-08 9.275 26.500 DNV Japan (PEAR Carbon Offset Initiative) Climate experts 18-Apr-09 30-Dec-99 4 7 9 0 0.528 32.5 No Investment 3 2.650 2.650 2.650 2.650 2.650 2.650 2.650 2.650 2.650 2.650

78PoA0010 SEXLGHW7439CT5MRTT4T7GU0J488UW Installing Solar Water Heating Systems in the South of Viet Nam Asia & Pacific Southeast Asia Vietnam Southern Viet Nam Energy Conservation Center Replaced At Validation Solar Solar Solar water heating AMS-I.C. 1-May-09 28 JQA Japan (Mitsubishi UFJ Securities) Mitsubishi UFJ Securities 4-Jun-09 15-Oct-11 PoA 30-Dec-99PoA 4 9 7 6 8 579CPA0010.01 Installing Solar Water Heating Systems in the South of Viet Nam - 01 Asia & Pacific Southeast Asia Vietnam Southern Viet Nam Energy Conservation Center Replaced At Validation Solar Solar Solar water heating Solar water heating (SWH) systems AMS-I.C. 1 2.5 7 15 0.0 1-Nov-09 7.626 28.401 JQA Japan (Mitsubishi UFJ Securities) Mitsubishi UFJ Securities 4-Jun-09 15-Oct-11 30-Dec-99 4 9 7 6 8 5 0 0.520 34.2 No 2.542 2.542 2.542 2.542 2.542 2.542 2.542 80PoA0011 F3GZXJYS764Z3DRH8K7NKLUMDAYF0G Hydraulic rams for irrigation and domestic water supply in Zhejiang, China Asia & Pacific East Asia China Zhejiang BORDA/atmosfair Germany Validation Terminated Agriculture Agriculture Irrigation AMS-I.B. 1 1.0 1-Jan-08 28 3.000 10.000 TÜV-Nord 0.000 Germany (Atmosfair) Atmosfair, BORDA, Zhejiang University 9-Jun-09 PoA 30-Dec-99PoA 1 8 4 9 0.0

81CPA0011.01 Asia & Pacific East Asia China BORDA/atmosfair Germany Validation Terminated Agriculture Agriculture Irrigation AMS-I.B. 1 1.0 10 20 0.0 1-Jan-09 3.000 10.000 TÜV-Nord Germany (Atmosfair) Atmosfair, BORDA, Zhejiang University 9-Jun-09 30-Dec-99 1 8 4 9 0 Yes 1.000 1.000 1.000 1.000 1.000 1.000 1.000 1.000 1.000 1.000

82PoA0012 WOW1YYO9VEFAM3D6H2GJ4BZ4AW9YJL 3223 CFL lighting scheme – “Bachat Lamp Yojana” Asia & Pacific Southern Asia India India Bureau of Energy Efficiency Registered EE households EE households Lighting AMS-II.J. 50 1,549.0 30-May-10 28 1,946.370 17,490.580 TÜV-SÜD 1520.248 1142.991 2663.239 2 25-Jul-14 31-Dec-15 KBS Netherlands (C-Quest Capital) Bureau of Energy Efficiency 22-Jul-09 5-Sep-09 14-Dec-09 30-Mar-10 29-Apr-10 PoA 30-Dec-99PoA SD Tool 4 8 7 0.083CPA0012.01 3223-0001 Asia & Pacific Southern Asia India Andhra Pradesh Bureau of Energy Efficiency Registered EE households EE households Lighting 548,300 CFLs AMS-II.J. 1 34.9 10 8 -3.0 30-May-10 90.335 348.920 TÜV-SÜD 42.097 83.974 126.071 1 29-Dec-14 31-Dec-15 Netherlands (C-Quest Capital) Bureau of Energy Efficiency 22-Jul-09 29-Apr-10 30-Dec-99 4 8 7 -1 0.856 51.6 No Investment;Other 4 45.451 42.349 39.248 36.147 33.046 29.944 26.843 20.095

84CPA0012.02 3223-0002 Asia & Pacific Southern Asia India Kerala Bureau of Energy Efficiency Registered EE households EE households Lighting 701,502 CFLs AMS-II.J. 1 27.1 4 5 -6.7 1-May-11 108.252 348.920 TÜV-SÜD 46.106 46.106 1 29-Dec-14 13-Dec-14 Bureau of Energy Efficiency 26-Apr-11 30-Dec-99 4 8 7 -1 0.903 42.5 No Investment;Other 4 34.579 30.005 25.432 14.548

85CPA0012.03 3223-0003 Asia & Pacific Southern Asia India Kerala Bureau of Energy Efficiency Registered EE households EE households Lighting 695,766 CFLs AMS-II.J. 1 25.7 4 5 -6.7 9-May-11 42.359 348.920 TÜV-SÜD 45.886 45.886 1 29-Dec-14 13-Dec-14 Bureau of Energy Efficiency 6-May-11 30-Dec-99 4 8 7 -1 0.903 42.2 No Investment;Other 4 34.197 29.661 25.124 13.893

86CPA0012.04 3223-0004 Asia & Pacific Southern Asia India Kerala Bureau of Energy Efficiency Registered EE households EE households Lighting 500,792 CFLs AMS-II.J. 1 18.8 4 5 -4.7 9-May-11 30.952 348.920 TÜV-SÜD 38.255 38.255 1 29-Dec-14 13-Dec-14 Bureau of Energy Efficiency 6-May-11 30-Dec-99 4 8 7 -1 0.903 30.4 No Investment;Other 4 24.748 21.483 18.218 10.724

87CPA0012.05 3223-0005 Asia & Pacific Southern Asia India Kerala Bureau of Energy Efficiency Registered EE households EE households Lighting 499,920 CFLs AMS-II.J. 1 18.8 4 5 -4.7 9-May-11 30.899 348.920 TÜV-SÜD 29.151 29.151 1 29-Dec-14 13-Dec-14 Bureau of Energy Efficiency 6-May-11 30-Dec-99 4 8 7 -1 0.903 30.3 No Investment;Other 4 24.705 21.446 18.186 10.705

88CPA0012.06 3223-0006 Asia & Pacific Southern Asia India Kerala Bureau of Energy Efficiency Registered EE households EE households Lighting 531,908 CFLs AMS-II.J. 1 19.7 4 5 -5.0 9-May-11 32.383 348.920 TÜV-SÜD 37.476 37.476 1 29-Dec-14 13-Dec-14 Bureau of Energy Efficiency 6-May-11 30-Dec-99 4 8 7 -1 0.903 32.2 No Investment;Other 4 26.143 22.675 19.207 10.621

89CPA0012.07 3223-0007 Asia & Pacific Southern Asia India Kerala Bureau of Energy Efficiency Registered EE households EE households Lighting 598,590 CFLs AMS-II.J. 1 22.1 4 5 -5.7 9-May-11 36.443 348.920 TÜV-SÜD 39.073 39.073 1 29-Dec-14 13-Dec-14 Bureau of Energy Efficiency 6-May-11 30-Dec-99 4 8 7 -1 0.903 36.3 No Investment;Other 4 29.421 25.518 21.615 11.953

90CPA0012.08 3223-0008 Asia & Pacific Southern Asia India Kerala Bureau of Energy Efficiency Registered EE households EE households Lighting 600,836 CFLs AMS-II.J. 1 23.6 4 5 -5.7 9-May-11 38.920 348.920 TÜV-SÜD 46.108 46.108 1 29-Dec-14 13-Dec-14 Bureau of Energy Efficiency 6-May-11 30-Dec-99 4 8 7 -1 0.903 36.4 No Investment;Other 4 30.357 30.357 22.523 13.274 3.180

91CPA0012.09 3223-0009 Asia & Pacific Southern Asia India Kerala Bureau of Energy Efficiency Registered EE households EE households Lighting 442,758 CFLs AMS-II.J. 1 17.4 4 5 2.5 9-May-11 28.681 348.920 TÜV-SÜD 31.993 31.993 1 29-Dec-14 13-Dec-14 Bureau of Energy Efficiency 6-May-11 30-Dec-99 4 8 7 -1 0.903 26.8 No Investment;Other 4 22.371 19.484 16.597 16.597 2.344

92CPA0012.10 3223-0010 Asia & Pacific Southern Asia India Kerala Bureau of Energy Efficiency Registered EE households EE households Lighting 552,260 CFLS AMS-II.J. 1 21.7 4 5 -5.2 9-May-11 35.774 348.920 TÜV-SÜD 41.444 41.444 1 29-Dec-14 13-Dec-14 Bureau of Energy Efficiency 6-May-11 30-Dec-99 4 8 7 -1 0.903 33.5 No Investment;Other 4 27.903 24.303 20.702 12.201 2.923

93CPA0012.11 3223-0011 Asia & Pacific Southern Asia India Kerala Bureau of Energy Efficiency Registered EE households EE households Lighting 708,540 CFLs AMS-II.J. 1 27.9 4 5 -6.7 9-May-11 45.899 348.920 TÜV-SÜD 51.992 51.992 1 29-Dec-14 13-Dec-14 Bureau of Energy Efficiency 6-May-11 30-Dec-99 4 8 7 -1 0.903 43.0 No Investment;Other 4 35.799 31.180 26.560 15.654 15.654

94CPA0012.12 3223-0012 Asia & Pacific Southern Asia India Kerala Bureau of Energy Efficiency Registered EE households EE households Lighting 788,320 CFLs AMS-II.J. 1 31.0 4 5 -7.5 9-May-11 51.065 348.920 TÜV-SÜD 61.935 61.935 1 29-Dec-14 13-Dec-14 Bureau of Energy Efficiency 6-May-11 30-Dec-99 4 8 7 -1 0.903 47.8 No Investment;Other 4 39.830 34.690 29.551 17.416 4.173

95CPA0012.13 3223-0013 Asia & Pacific Southern Asia India Kerala Bureau of Energy Efficiency Registered EE households EE households Lighting 631,216 CFLs AMS-II.J. 1 24.8 4 5 -6.0 9-May-11 40.888 348.920 TÜV-SÜD 42.247 42.247 1 29-Dec-14 13-Dec-14 Bureau of Energy Efficiency 6-May-11 30-Dec-99 4 8 7 -1 0.903 38.3 No Investment;Other 4 31.892 27.777 23.662 13.945 3.341

96CPA0012.14 3223-0014 Asia & Pacific Southern Asia India Kerala Bureau of Energy Efficiency Registered EE households EE households Lighting 477,668 CFLs AMS-II.J. 1 18.8 4 5 -4.5 9-May-11 30.942 348.920 TÜV-SÜD 36.809 36.809 1 29-Dec-14 13-Dec-14 Bureau of Energy Efficiency 6-May-11 30-Dec-99 4 8 7 -1 0.903 29.0 No Investment;Other 4 24.134 21.020 17.906 10.553 2.528

97CPA0012.15 3223-0015 Asia & Pacific Southern Asia India Kerala Bureau of Energy Efficiency Registered EE households EE households Lighting 812,378 CFLs AMS-II.J. 1 32.0 4 5 -7.7 9-May-11 52.625 348.920 TÜV-SÜD 62.915 62.915 1 29-Dec-14 13-Dec-14 Bureau of Energy Efficiency 6-May-11 30-Dec-99 4 8 7 -1 0.903 49.2 No Investment;Other 4 41.046 35.749 30.453 17.948 4.300

98CPA0012.16 3223-0016 Asia & Pacific Southern Asia India Kerala Bureau of Energy Efficiency Registered EE households EE households Lighting 675,534 CFLs AMS-II.J. 1 25.8 4 5 -6.0 9-May-11 42.420 348.920 TÜV-SÜD 42.313 42.313 1 29-Dec-14 13-Dec-14 Bureau of Energy Efficiency 6-May-11 30-Dec-99 4 8 7 -1 0.903 41.0 No Investment;Other 4 33.577 29.172 24.768 15.507

99CPA0012.17 3223-0017 Asia & Pacific Southern Asia India Kerala Bureau of Energy Efficiency Registered EE households EE households Lighting 453,620 CFLs AMS-II.J. 1 17.3 4 5 -4.0 9-May-11 28.485 348.920 TÜV-SÜD 28.896 28.896 1 29-Dec-14 13-Dec-14 Bureau of Energy Efficiency 6-May-11 30-Dec-99 4 8 7 -1 0.903 27.5 No Investment;Other 4 22.547 19.589 16.632 10.413

100CPA0012.18 3223-0018 Asia & Pacific Southern Asia India Kerala Bureau of Energy Efficiency Registered EE households EE households Lighting 581,460 CFLs AMS-II.J. 1 22.2 4 5 -5.2 9-May-11 36.512 348.920 TÜV-SÜD 38.534 38.534 1 29-Dec-14 13-Dec-14 Bureau of Energy Efficiency 6-May-11 30-Dec-99 4 8 7 -1 0.903 35.2 No Investment;Other 4 28.901 25.110 21.319 21.319

101CPA0012.19 3223-0019 Asia & Pacific Southern Asia India Kerala Bureau of Energy Efficiency Registered EE households EE households Lighting 726,656 CFLs AMS-II.J. 1 27.7 4 5 -6.5 9-May-11 45.630 348.920 TÜV-SÜD 45.901 45.901 1 29-Dec-14 13-Dec-14 Bureau of Energy Efficiency 6-May-11 30-Dec-99 4 8 7 -1 0.903 44.0 No Investment;Other 4 36.118 31.380 26.642 16.680

102CPA0012.20 3223-0020 Asia & Pacific Southern Asia India Kerala Bureau of Energy Efficiency Registered EE households EE households Lighting 784,704 CFLs AMS-II.J. 1 29.9 4 5 -7.0 9-May-11 49.275 348.920 TÜV-SÜD 47.546 47.546 1 29-Dec-14 13-Dec-14 Bureau of Energy Efficiency 6-May-11 30-Dec-99 4 8 7 -1 0.903 47.6 No Investment;Other 4 39.003 33.887 28.770 18.013

103CPA0012.21 3223-0021 Asia & Pacific Southern Asia India Kerala Bureau of Energy Efficiency Registered EE households EE households Lighting 849,592 CFLs AMS-II.J. 1 32.4 4 5 -7.6 9-May-11 53.350 348.920 TÜV-SÜD 52.465 52.465 1 29-Dec-14 13-Dec-14 Bureau of Energy Efficiency 6-May-11 30-Dec-99 4 8 7 -1 0.903 51.5 No Investment;Other 4 42.228 36.689 31.150 19.502

104CPA0012.22 3223-0022 Asia & Pacific Southern Asia India Karnataka Bureau of Energy Efficiency Registered EE households EE households Lighting 635,000 CFLs AMS-II.J. 1 39.8 8 8 -4.8 30-May-10 57.497 348.920 TÜV-SÜD 79.584 79.584 1 25-Jul-14 13-Dec-14 Bureau of Energy Efficiency 6-May-11 30-Dec-99 4 8 7 -1 0.903 57.5 No Investment;Other 4 51.869 48.329 44.790 41.251 37.712 34.173 30.634 22.933

105CPA0012.23 3223-0023 Asia & Pacific Southern Asia India Karnataka Bureau of Energy Efficiency Registered EE households EE households Lighting 620,000 CFLs AMS-II.J. 1 39.9 8 8 -4.1 30-May-10 57.590 348.920 TÜV-SÜD 64.958 64.958 1 25-Jul-14 13-Dec-14 Bureau of Energy Efficiency 6-May-11 30-Dec-99 4 8 7 -1 0.903 57.5 No Investment;Other 4 51.952 48.407 44.862 41.317 37.773 34.228 30.683 22.970

106CPA0012.24 3223-0024 Asia & Pacific Southern Asia India Karnataka Bureau of Energy Efficiency Registered EE households EE households Lighting 582,784 CFLs AMS-II.J. 1 37.5 8 8 -3.9 30-May-10 54.134 348.920 TÜV-SÜD 65.087 65.087 1 25-Jul-14 13-Dec-14 Bureau of Energy Efficiency 6-May-11 30-Dec-99 4 8 7 -1 0.903 54.1 No Investment;Other 4 48.834 45.501 42.169 38.837 35.505 32.173 28.841 21.591

107CPA0012.25 3223-0025 Asia & Pacific Southern Asia India Karnataka Bureau of Energy Efficiency Registered EE households EE households Lighting 620,000 CFLs AMS-II.J. 1 39.9 8 8 -4.1 30-May-10 57.590 348.920 TÜV-SÜD 60.622 60.622 1 25-Jul-14 13-Dec-14 Bureau of Energy Efficiency 6-May-11 30-Dec-99 4 8 7 -1 0.903 57.5 No Investment;Other 4 51.952 48.407 44.862 41.317 37.773 34.228 30.683 22.970

108CPA0012.26 3223-0026 Asia & Pacific Southern Asia India Karnataka Bureau of Energy Efficiency Registered EE households EE households Lighting 620,000 CFLs AMS-II.J. 1 39.9 8 8 -4.1 30-May-10 57.590 348.920 TÜV-SÜD 64.655 64.655 1 25-Jul-14 13-Dec-14 Bureau of Energy Efficiency 6-May-11 30-Dec-99 4 8 7 -1 0.903 57.5 No Investment;Other 4 51.952 48.407 44.862 41.317 37.773 34.228 30.683 22.970

109CPA0012.27 3223-0027 Asia & Pacific Southern Asia India Karnataka Bureau of Energy Efficiency Registered EE households EE households Lighting 625,000 CFLs AMS-II.J. 1 39.2 8 8 -4.1 30-May-10 56.592 348.920 TÜV-SÜD 63.218 63.218 1 25-Jul-14 13-Dec-14 Bureau of Energy Efficiency 6-May-11 30-Dec-99 4 8 7 -1 0.903 56.5 No Investment;Other 4 51.052 47.568 44.085 40.601 37.118 33.635 30.151 22.572

110CPA0012.28 3223-0028 Asia & Pacific Southern Asia India Karnataka Bureau of Energy Efficiency Registered EE households EE households Lighting 620,000 CFLs AMS-II.J. 1 39.9 8 8 -4.1 30-May-10 57.590 348.920 TÜV-SÜD 61.228 61.228 1 25-Jul-14 13-Dec-14 Bureau of Energy Efficiency 6-May-11 30-Dec-99 4 8 7 -1 0.903 57.5 No Investment;Other 4 51.952 48.407 44.862 41.317 37.773 34.228 30.683 22.970

111CPA0012.29 3223-0029 Asia & Pacific Southern Asia India Delhi Bureau of Energy Efficiency Registered EE households EE households Lighting 444,239 CFLs AMS-II.J. 1 33.2 8 8 -3.5 30-May-10 34.719 348.920 TÜV-SÜD 16.339 57.481 73.820 1 25-Jul-14 31-Dec-15 Bureau of Energy Efficiency 30-Aug-11 30-Dec-99 4 8 7 -1 0.903 48.0 No Investment;Other 4 43.395 40.434 37.473 34.512 31.551 28.590 24.988 18.707

112CPA0012.30 3223-0030 Asia & Pacific Southern Asia India Delhi Bureau of Energy Efficiency Registered EE households EE households Lighting 379,819 CFLs AMS-II.J. 1 28.5 8 8 -3.0 30-May-10 22.722 348.920 TÜV-SÜD 0.000 Bureau of Energy Efficiency 30-Aug-11 30-Dec-99 4 8 7 -1 0.903 41.1 No Investment;Other 4 37.102 34.571 32.039 29.507 26.976 24.444 24.444 24.444

113CPA0012.31 3223-0031 Asia & Pacific Southern Asia India Delhi Bureau of Energy Efficiency Registered EE households EE households Lighting 408,675 CFLs AMS-II.J. 1 30.6 8 8 -3.2 30-May-10 34.589 348.920 TÜV-SÜD 4.918 25.593 30.511 1 25-Jul-14 31-Dec-15 Bureau of Energy Efficiency 30-Aug-11 30-Dec-99 4 8 7 -1 0.903 44.2 No Investment;Other 4 39.921 37.197 34.473 31.749 29.025 26.301 23.577 17.650

114CPA0012.32 3223-0032 Asia & Pacific Southern Asia India Delhi Bureau of Energy Efficiency Registered EE households EE households Lighting 487,962 CFLs AMS-II.J. 1 35.4 8 8 -3.7 15-Mar-12 28.285 348.920 TÜV-SÜD 32.885 83.871 116.756 1 25-Jul-14 31-Dec-15 Bureau of Energy Efficiency 30-Aug-11 30-Dec-99 4 8 7 -1 0.903 51.1 No Investment;Other 4 46.186 43.034 39.883 36.732 33.580 30.429 27.277 20.420

115CPA0012.33 3223-0033 Asia & Pacific Southern Asia India Delhi Bureau of Energy Efficiency Registered EE households EE households Lighting 472,894 CFLs AMS-II.J. 1 35.5 10 8 -3.7 30-May-10 40.025 354.520 TÜV-SÜD 0.000 Bureau of Energy Efficiency 30-Aug-11 30-Dec-99 4 8 7 -1 0.903 51.1 No Investment;Other 4 46.194 46.194 39.890 39.890 33.586 30.434 27.282 20.424

116CPA0012.34 3223-0034 Asia & Pacific Southern Asia India Goa Bureau of Energy Efficiency Registered EE households EE households Lighting 530,700 CFLs AMS-II.J. 1 37.0 8 8 -3.8 30-May-10 43.440 354.520 TÜV-SÜD 0.000 1-Sep-11 30-Dec-99 4 8 7 -1 0.904 53.3 No Investment;Other 4 48.197 44.908 41.619 38.331 35.042 31.753 28.465 21.309

117CPA0012.35 3223-0035 Asia & Pacific Southern Asia India Goa Bureau of Energy Efficiency Registered EE households EE households Lighting 525,200 CFLs AMS-II.J. 1 37.1 8 8 -3.9 30-May-10 41.899 354.520 TÜV-SÜD 0.000 1-Sep-11 30-Dec-99 4 8 7 -1 0.904 53.5 No Investment;Other 4 48.364 45.064 41.764 38.464 35.164 31.864 28.564 21.384

118CPA0012.36 3223-0036 CFL lighting scheme – “Bachat Lamp Yojana” in Punjab, India Asia & Pacific Southern Asia India Punjab Bureau of Energy Efficiency Registered EE households EE households Lighting 512,59 CFLs AMS-II.J. 1 35.8 8 8 -3.7 30-May-10 26.894 354.520 TÜV-SÜD 24.156 72.337 96.493 1 25-Jul-14 31-Dec-15 Bureau of Energy Efficiency 30-Nov-11 30-Dec-99 4 8 7 -1 0.903 51.7 No Investment;Other 4 46.662 43.478 40.294 37.110 33.926 30.742 27.558 20.631

119CPA0012.37 3223-0037 CFL lighting scheme – “Bachat Lamp Yojana” in Punjab, India Asia & Pacific Southern Asia India Punjab Bureau of Energy Efficiency Registered EE households EE households Lighting 471,182 CFLs AMS-II.J. 1 32.9 8 8 -3.4 30-May-10 35.815 354.520 TÜV-SÜD 15.731 60.034 75.765 1 25-Jul-14 31-Dec-15 Bureau of Energy Efficiency 30-Nov-11 30-Dec-99 4 8 7 -1 0.903 47.5 No Investment;Other 4 42.892 39.965 37.039 34.112 31.185 28.259 25.332 18.964

120CPA0012.38 3223-0038 CFL lighting scheme – “Bachat Lamp Yojana” in Punjab, India Asia & Pacific Southern Asia India Punjab Bureau of Energy Efficiency Registered EE households EE households Lighting 548,786 CFLs AMS-II.J. 1 38.3 8 8 -4.0 30-May-10 35.080 354.520 TÜV-SÜD 5.861 82.815 88.676 1 25-Jul-14 31-Dec-15 Bureau of Energy Efficiency 30-Nov-11 30-Dec-99 4 8 7 -1 0.903 55.3 No Investment;Other 4 49.957 46.548 43.139 39.730 36.322 32.913 29.504 22.087

121CPA0012.39 3223-0039 CFL lighting scheme – “Bachat Lamp Yojana” in Punjab, India Asia & Pacific Southern Asia India Punjab Bureau of Energy Efficiency Registered EE households EE households Lighting 452,006 CFLs AMS-II.J. 1 31.6 8 8 -3.3 30-May-10 15.884 354.520 TÜV-SÜD 3.948 92.548 96.496 1 25-Jul-14 31-Dec-15 Bureau of Energy Efficiency 30-Nov-11 30-Dec-99 4 8 7 -1 0.903 45.6 No Investment;Other 4 41.146 38.339 35.531 32.724 29.916 27.108 24.301 18.192

122CPA0012.40 3223-0040 CFL lighting scheme – “Bachat Lamp Yojana” in Punjab, India Asia & Pacific Southern Asia India Punjab Bureau of Energy Efficiency Registered EE households EE households Lighting 530,762 CFLs AMS-II.J. 1 37.1 8 8 -3.9 30-May-10 27.958 354.520 TÜV-SÜD 0.000 13-Dec-14 Bureau of Energy Efficiency 30-Nov-11 30-Dec-99 4 8 7 -1 0.903 53.5 No Investment;Other 4 48.316 45.019 41.722 38.425 35.129 31.832 28.535 21.362

123CPA0012.41 3223-0041 CFL lighting scheme – “Bachat Lamp Yojana” in Punjab, India Asia & Pacific Southern Asia India Punjab Bureau of Energy Efficiency Registered EE households EE households Lighting 480,411 CFLs AMS-II.J. 1 33.6 8 8 -3.5 30-May-10 22.554 354.520 TÜV-SÜD 11.763 77.106 88.869 1 25-Jul-14 31-Dec-15 Bureau of Energy Efficiency 30-Nov-11 30-Dec-99 4 8 7 -1 0.903 48.4 No Investment;Other 4 43.732 40.748 37.764 34.780 31.796 28.812 25.828 19.335

124CPA0012.42 3223-0042 CFL lighting scheme – “Bachat Lamp Yojana” in Punjab, India Asia & Pacific Southern Asia India Punjab Bureau of Energy Efficiency Registered EE households EE households Lighting 473,604 CFLs AMS-II.J. 1 38.6 8 8 -3.4 30-May-10 24.948 354.520 TÜV-SÜD 0.000 13-Dec-14 Bureau of Energy Efficiency 30-Nov-11 30-Dec-99 4 8 7 -1 0.903 47.7 No Investment;Other 4 43.113 40.171 37.229 34.287 31.346 28.404 25.462 19.061

125CPA0012.43 3223-0043 Asia & Pacific Southern Asia India Andhra Pradesh Bureau of Energy Efficiency Registered EE households EE households Lighting 371,667 CFLs AMS-II.J. 1 31.3 8 8 -2.8 30-May-10 11.212 354.520 TÜV-SÜD 6.939 39.855 46.794 1 25-Jul-14 31-Dec-15 Bureau of Energy Efficiency 22-Feb-12 30-Dec-99 4 8 7 -1 0.865 40.3 No Investment;Other 4 34.869 32.490 30.110 27.731 25.352 22.973 20.593 15.416

126CPA0012.44 3223-0044 Asia & Pacific Southern Asia India Andhra Pradesh Bureau of Energy Efficiency Registered EE households EE households Lighting 434,765 CFLs AMS-II.J. 1 26.8 8 8 3.3 30-May-10 11.212 354.520 TÜV-SÜD 13.152 46.245 59.397 1 25-Jul-14 31-Dec-15 Bureau of Energy Efficiency 22-Feb-12 30-Dec-99 4 8 7 -1 0.865 47.1 No Investment;Other 4 40.789 38.005 35.222 32.439 29.656 26.873 24.089 18.034

127CPA0012.45 3223-0045 Asia & Pacific Southern Asia India Andhra Pradesh Bureau of Energy Efficiency Registered EE households EE households Lighting 536,722 CFLs AMS-II.J. 1 38.6 8 8 -4.0 30-May-10 9.018 354.520 TÜV-SÜD 6.118 67.997 74.115 1 25-Jul-14 31-Dec-15 Bureau of Energy Efficiency 22-Feb-12 30-Dec-99 4 8 7 -1 0.865 58.2 No Investment;Other 4 50.354 46.918 43.482 40.046 36.611 33.175 29.739 22.263

128CPA0012.46 3223-0046 Asia & Pacific Southern Asia India Andhra Pradesh Bureau of Energy Efficiency Registered EE households EE households Lighting 473,082 11 and 18 W CFLs AMS-II.J. 1 34.1 10 8 -3.4 30-May-10 23.760 340.620 TÜV-SÜD 81.270 81.270 1-Jan-13 31-Dec-15 Bureau of Energy Efficiency 29-Mar-12 30-Dec-99 4 8 7 -1 0.865 51.3 No Investment;Other 4 44.383 41.355 38.326 35.298 32.270 29.241 26.213 19.623

129CPA0012.47 3223-0047 Asia & Pacific Southern Asia India Andhra Pradesh Bureau of Energy Efficiency Registered EE households EE households Lighting 423,190 11 and 18 W CFLs AMS-II.J. 1 30.5 10 8 -3.1 30-May-10 29.332 304.700 TÜV-SÜD 60.520 60.520 1-Jan-13 31-Dec-15 Bureau of Energy Efficiency 29-Mar-12 30-Dec-99 4 8 7 -1 0.865 45.9 No Investment;Other 4 39.703 36.993 34.284 31.575 28.866 26.157 23.448 17.554

130CPA0012.48 3223-0048 Asia & Pacific Southern Asia India Andhra Pradesh Bureau of Energy Efficiency Registered EE households EE households Lighting 500,885 11 and 18 W CFLs AMS-II.J. 1 36.1 10 8 -3.7 30-May-10 25.853 360.640 TÜV-SÜD 0.695 73.246 73.941 1 25-Jul-14 31-Dec-15 Bureau of Energy Efficiency 29-Mar-12 30-Dec-99 4 8 7 -1 0.865 54.3 No Investment;Other 4 46.992 43.785 40.579 37.372 34.166 30.960 27.753 20.776

131CPA0012.49 3223-0049 Asia & Pacific Southern Asia India Andhra Pradesh Bureau of Energy Efficiency Registered EE households EE households Lighting 546,854 11 and 18 W CFLs AMS-II.J. 1 39.4 10 8 -4.0 30-May-10 23.127 393.740 TÜV-SÜD 79.708 79.708 1-Jan-13 31-Dec-15 Bureau of Energy Efficiency 29-Mar-12 30-Dec-99 4 8 7 -1 0.865 59.3 No Investment;Other 4 51.305 47.804 44.303 40.802 37.302 33.801 30.300 22.683

132CPA0012.50 3223-0050 Asia & Pacific Southern Asia India Andhra Pradesh Bureau of Energy Efficiency Registered EE households EE households Lighting 439,827 11 and 18 W CFLs AMS-II.J. 1 31.7 10 8 -3.3 28-Mar-12 27.373 316.680 TÜV-SÜD 9.249 58.391 67.640 1 25-Jul-14 31-Dec-15 Bureau of Energy Efficiency 29-Mar-12 30-Dec-99 4 8 7 -1 0.865 47.7 No Investment;Other 4 51.305 47.804 44.303 40.802 37.302 33.801 30.300 22.683

133PoA0013 5BN3CWHSVU6CIQABEG7QS0UT1LYH8Y 4041 Promotion of Biomass Based Heat Generation Systems in India Asia & Pacific Southern Asia India India Registered Biomass energy Biomass energy Agricultural residues: other kinds AMS-I.C. 32 471.8 1-Dec-10 28 147.544 4,717.560 TÜV-Nord 9.591 0.000 9.591 1 22-Apr-13 31-Aug-12 United K. (RWE), Germany Asia Carbon 13-Aug-09 5-May-09 25-Oct-10 15-Dec-10 12-Jan-11 CPA 30-Dec-99CPA 5 8 9 4 0.0134CPA0013.01 4041-0001 Asia & Pacific Southern Asia India Maharashtra Registered Biomass energy Biomass energy Biomass briquettes Biomass boiler using biomass briquettes AMS-I.C. 1 5.2 10 25 0.0 12-Jan-11 10.249 52.030 TÜV-Nord 0.912 0.912 1 22-Apr-13 31-Aug-12 Deloitte-TECO United K. (RWE), Germany Asia Carbon 13-Aug-09 12-Jan-11 30-Dec-99 5 8 9 4 0 Thermax India 0.800 No Investment 2 5.203 5.203 5.203 5.203 5.203 5.203 5.203 5.203 5.203 5.203

135CPA0013.02 4041-0002 Asia & Pacific Southern Asia India Maharashtra Registered Biomass energy Biomass energy Agricultural residues: rice husk Biomass boiler using rice husk AMS-I.C. 1 12.5 10 25 0.0 31-Mar-12 10.475 125.360 TÜV-Nord 2.624 2.624 1 22-Apr-13 31-Aug-12 Deloitte-TECO Asia Carbon 23-Mar-12 30-Dec-99 5 8 9 4 0 Thermax India 0.800 No Investment 2 12.536 12.536 12.536 12.536 12.536 12.536 12.536 12.536 12.536 12.536

136CPA0013.03 4041-0003 Asia & Pacific Southern Asia India Andhra Pradesh Registered Biomass energy Biomass energy Agricultural residues: rice husk Biomass boiler using rice husk AMS-I.C. 1 11.0 10 25 0.0 31-Mar-12 9.210 110.220 TÜV-Nord Deloitte-TECO Asia Carbon 23-Mar-12 30-Dec-99 5 8 9 4 0 Thermax India 0.860 No Investment 2 11.022 11.022 11.022 11.022 11.022 11.022 11.022 11.022 11.022 11.022

137CPA0013.04 4041-0004 Asia & Pacific Southern Asia India Maharashtra Registered Biomass energy Biomass energy Agricultural residues: rice husk Biomass boiler using rice husk AMS-I.C. 1 14.0 10 25 0.0 1-May-12 9.334 139.620 TÜV-Nord 0.467 0.467 1 22-Apr-13 31-Aug-12 Deloitte-TECO Asia Carbon 23-Mar-12 30-Dec-99 5 8 9 4 0 Thermax India 0.800 No Investment 2 13.962 13.962 13.962 13.962 13.962 13.962 13.962 13.962 13.962 13.962

138CPA0013.05 4041-0005 Asia & Pacific Southern Asia India Gujarat Registered Biomass energy Biomass energy Biomass briquettes Biomass boiler using biomass briquettes AMS-I.C. 1 3.6 10 25 0.0 1-May-12 2.378 35.570 TÜV-Nord 1.202 1.202 1 22-Apr-13 31-Aug-12 Deloitte-TECO Asia Carbon 23-Mar-12 30-Dec-99 5 8 9 4 0 Thermax India 0.800 No Investment 2 3.557 3.557 3.557 3.557 3.557 3.557 3.557 3.557 3.557 3.557

139CPA0013.06 4041-0006 Asia & Pacific Southern Asia India Andhra Pradesh Registered Biomass energy Biomass energy Agricultural residues: rice husk Biomass boiler using rice husk AMS-I.C. 1 3.9 10 25 0.0 1-May-12 2.618 39.170 TÜV-Nord 0.398 0.398 1 22-Apr-13 31-Aug-12 Deloitte-TECO Asia Carbon 23-Mar-12 30-Dec-99 5 8 9 4 0 Thermax India 0.860 No Investment 2 3.917 3.917 3.917 3.917 3.917 3.917 3.917 3.917 3.917 3.917

140CPA0013.07 4041-0007 Asia & Pacific Southern Asia India Uttar Pradesh Registered Biomass energy Biomass energy Agricultural residues: rice husk Biomass boiler using rice husk AMS-I.C. 1 17.0 10 25 0.0 1-May-12 11.384 170.300 TÜV-Nord 0.773 0.773 1 22-Apr-13 31-Aug-12 Deloitte-TECO Asia Carbon 23-Mar-12 30-Dec-99 5 8 9 4 0 Thermax India 0.800 No Investment 2 17.030 17.030 17.030 17.030 17.030 17.030 17.030 17.030 17.030 17.030

141CPA0013.08 4041-0008 Asia & Pacific Southern Asia India Uttar Pradesh Registered Biomass energy Biomass energy Agricultural residues: rice husk Biomass boiler using rice husk AMS-I.C. 1 15.7 10 25 0.0 1-May-12 10.464 156.530 TÜV-Nord Deloitte-TECO Asia Carbon 23-Mar-12 30-Dec-99 5 8 9 4 0 Thermax India 0.800 No Investment 2 15.653 15.653 15.653 15.653 15.653 15.653 15.653 15.653 15.653 15.653

142CPA0013.09 4041-0009 Asia & Pacific Southern Asia India Andhra Pradesh Registered Biomass energy Biomass energy Agricultural residues: rice husk Biomass boiler using rice husk AMS-I.C. 1 12.7 10 25 0.0 1-Jun-12 7.409 126.960 TÜV-Nord Deloitte-TECO Asia Carbon 23-Mar-12 30-Dec-99 5 8 9 4 0 Thermax India 0.860 No Investment 2 12.696 12.696 12.696 12.696 12.696 12.696 12.696 12.696 12.696 12.696

143CPA0013.10 4041-0010 Asia & Pacific Southern Asia India Punjab Registered Biomass energy Biomass energy Agricultural residues: rice husk Biomass boiler using rice husk AMS-I.C. 1 13.2 10 25 0.0 1-Jun-12 7.694 131.850 TÜV-Nord 1.969 1.969 1 22-Apr-13 31-Aug-12 Deloitte-TECO Asia Carbon 23-Mar-12 30-Dec-99 5 8 9 4 0 Thermax India 0.860 No Investment 2 13.185 13.185 13.185 13.185 13.185 13.185 13.185 13.185 13.185 13.185

144CPA0013.11 4041-0011 Asia & Pacific Southern Asia India Rajasthan Registered Biomass energy Biomass energy Agricultural residues: rice husk AMS-I.C. 1 12.9 10 25 0.0 1-Jun-12 7.544 129.280 TÜV-Nord 0.675 0.675 1 22-Apr-13 31-Aug-12 Deloitte-TECO Asia Carbon 23-Mar-12 30-Dec-99 5 8 9 4 0 Thermax India 0.800 No Investment 2 12.928 12.928 12.928 12.928 12.928 12.928 12.928 12.928 12.928 12.928

145CPA0013.12 4041-0012 Asia & Pacific Southern Asia India Maharashtra Registered Biomass energy Biomass energy Biomass briquettes Biomass boiler using biomass briquettes AMS-I.C. 1 5.3 10 25 0.0 1-Jul-12 2.637 52.600 TÜV-Nord 0.491 0.491 1 22-Apr-13 31-Aug-12 Deloitte-TECO Asia Carbon 23-Mar-12 30-Dec-99 5 8 9 4 0 Thermax India 0.800 No Investment 2 5.260 5.260 5.260 5.260 5.260 5.260 5.260 5.260 5.260 5.260

146CPA0013.13 4041-0013 Asia & Pacific Southern Asia India Chhattisgarh Registered Biomass energy Biomass energy Agricultural residues: rice husk Biomass boiler using rice husk AMS-I.C. 1 16.5 10 25 0.0 1-Jul-12 8.257 164.680 TÜV-Nord 0.077 0.077 1 22-Apr-13 31-Aug-12 Deloitte-TECO Asia Carbon 23-Mar-12 30-Dec-99 5 8 9 4 0 Thermax India 0.800 No Investment 2 16.468 16.468 16.468 16.468 16.468 16.468 16.468 16.468 16.468 16.468

147CPA0013.14 4041-0014 Asia & Pacific Southern Asia India Maharashtra Registered Biomass energy Biomass energy Agricultural residues: rice husk AMS-I.C. 1 11.1 10 25 0.0 1-Jul-12 5.544 110.570 TÜV-Nord Deloitte-TECO Asia Carbon 23-Mar-12 30-Dec-99 5 8 9 4 0 Thermax India 0.800 No Investment 2 11.057 11.057 11.057 11.057 11.057 11.057 11.057 11.057 11.057 11.057

148CPA0013.15 4041-0015 Asia & Pacific Southern Asia India Maharashtra Registered Biomass energy Biomass energy Biomass briquettes Biomass boiler using biomass briquettes AMS-I.C. 1 12.7 10 25 0.0 1-Aug-12 5.291 127.060 TÜV-Nord 0.003 0.003 1 22-Apr-13 31-Aug-12 Deloitte-TECO Asia Carbon 23-Mar-12 30-Dec-99 5 8 9 4 0 Thermax India 0.800 No Investment 2 12.706 12.706 12.706 12.706 12.706 12.706 12.706 12.706 12.706 12.706

149CPA0013.16 4041-0016 Asia & Pacific Southern Asia India Andhra Pradesh Registered Biomass energy Biomass energy Agricultural residues: rice husk Biomass boiler using rice husk AMS-I.C. 1 8.2 10 25 0.0 1-Aug-12 3.430 82.370 TÜV-Nord Deloitte-TECO Asia Carbon 31-Jul-12 30-Dec-99 5 8 9 4 0 Thermax India 0.860 No Investment 2 8.237 8.237 8.237 8.237 8.237 8.237 8.237 8.237 8.237 8.237

150CPA0013.17 4041-0017 Asia & Pacific Southern Asia India Andhra Pradesh Registered Biomass energy Biomass energy Agricultural residues: rice husk AMS-I.C. 1 11.1 10 25 0.0 1-Sep-12 3.665 110.570 TÜV-Nord Deloitte-TECO Asia Carbon 30-Aug-12 30-Dec-99 5 8 9 4 0 Thermax India 0.800 No Investment 2 11.057 11.057 11.057 11.057 11.057 11.057 11.057 11.057 11.057 11.057

151CPA0013.18 4041-0018 Asia & Pacific Southern Asia India Andhra Pradesh Registered Biomass energy Biomass energy Agricultural residues: rice husk Biomass boiler using rice husk AMS-I.C. 1 31.7 10 25 0.0 1-Oct-12 7.901 316.920 TÜV-Nord Asia Carbon 29-Sep-12 30-Dec-99 5 8 9 4 0 Thermax India 0.800 No Investment 2 31.692 31.692 31.692 31.692 31.692 31.692 31.692 31.692 31.692 31.692

152CPA0013.19 4041-0019 Asia & Pacific Southern Asia India Andhra Pradesh Registered Biomass energy Biomass energy Agricultural residues: rice husk Biomass boiler using rice husk AMS-I.C. 1 5.5 10 25 0.0 1-Oct-12 1.376 55.210 TÜV-Nord Asia Carbon 29-Sep-12 30-Dec-99 5 8 9 4 0 Thermax India 0.860 No Investment 2 5.521 5.521 5.521 5.521 5.521 5.521 5.521 5.521 5.521 5.521

153CPA0013.20 4041-0020 Asia & Pacific Southern Asia India Himachal Pradesh Registered Biomass energy Biomass energy Agricultural residues: rice husk Biomass boiler using rice husk AMS-I.C. 1 16.5 10 25 0.0 1-Nov-12 2.715 165.140 TÜV-Nord Asia Carbon 31-Oct-12 30-Dec-99 5 8 9 4 0 Thermax India 0.800 No Investment 2 16.514 16.514 16.514 16.514 16.514 16.514 16.514 16.514 16.514 16.514

154CPA0013.21 4041-0021 Asia & Pacific Southern Asia India Andhra Pradesh Registered Biomass energy Biomass energy Agricultural residues: rice husk Biomass boiler using rice husk AMS-I.C. 1 13.8 10 25 0.0 1-Nov-12 2.267 137.930 TÜV-Nord Asia Carbon 31-Oct-12 30-Dec-99 5 8 9 4 0 Thermax India 0.860 No Investment 2 13.793 13.793 13.793 13.793 13.793 13.793 13.793 13.793 13.793 13.793

155CPA0013.22 4041-0022 Asia & Pacific Southern Asia India Andhra Pradesh Registered Biomass energy Biomass energy Agricultural residues: rice husk AMS-I.C. 1 32.7 10 25 0.0 1-Nov-12 5.382 327.410 TÜV-Nord Asia Carbon 31-Oct-12 30-Dec-99 5 8 9 4 0 Thermax India 0.860 No Investment 2 32.741 32.741 32.741 32.741 32.741 32.741 32.741 32.741 32.741 32.741

156CPA0013.23 4041-0023 Asia & Pacific Southern Asia India Uttarakhand Registered Biomass energy Biomass energy Agricultural residues: rice husk AMS-I.C. 1 21.9 10 25 0.0 1-Nov-12 3.601 219.070 TÜV-Nord Asia Carbon 31-Oct-12 30-Dec-99 5 8 9 4 0 Thermax India 0.800 No Investment 2 21.907 21.907 21.907 21.907 21.907 21.907 21.907 21.907 21.907 21.907

157CPA0013.24 4041-0024 Asia & Pacific Southern Asia India Andhra Pradesh Registered Biomass energy Biomass energy Agricultural residues: rice husk AMS-I.C. 1 81.7 10 25 0.0 1-Dec-12 6.719 817.440 TÜV-Nord Asia Carbon 31-Oct-12 30-Dec-99 5 8 9 4 0 Thermax India 0.860 No Investment 2 81.744 81.744 81.744 81.744 81.744 81.744 81.744 81.744 81.744 81.744

158CPA0013.25 4041-0025 Asia & Pacific Southern Asia India Haryana Registered Biomass energy Biomass energy Agricultural residues: other kinds AMS-I.C. 1 15.2 10 25 0.0 1-Jan-13 0.000 152.420 TÜV-Nord Asia Carbon 27-Nov-12 30-Dec-99 5 8 9 4 0 Thermax India 0.800 No Investment 2 15.242 15.242 15.242 15.242 15.242 15.242 15.242 15.242 15.242 15.242

159CPA0013.26 4041-0026 Asia & Pacific Southern Asia India Maharashtra Registered Biomass energy Biomass energy Biomass briquettes AMS-I.C. 1 6.3 10 25 0.0 31-Dec-12 0.000 63.260 TÜV-Nord Asia Carbon 27-Nov-12 30-Dec-99 5 8 9 4 0 Thermax India 0.800 No Investment 2 6.326 6.326 6.326 6.326 6.326 6.326 6.326 6.326 6.326 6.326

160CPA0013.27 4041-0027 Asia & Pacific Southern Asia India Puducherry Registered Biomass energy Biomass energy Biomass briquettes AMS-I.C. 1 6.4 10 25 0.0 1-Apr-13 0.000 64.250 TÜV-Nord Asia Carbon 31-Dec-12 30-Dec-99 5 8 9 4 0 Thermax India 0.860 No Investment 2 6.425 6.425 6.425 6.425 6.425 6.425 6.425 6.425 6.425 6.425

161CPA0013.28 4041-0028 Asia & Pacific Southern Asia India Maharashtra Registered Biomass energy Biomass energy Agricultural residues: rice husk Biomass boiler using rice husk AMS-I.C. 1 16.6 10 25 0.0 1-Apr-13 0.000 166.380 TÜV-Nord Asia Carbon 31-Dec-12 30-Dec-99 5 8 9 4 0 Thermax India 0.800 No Investment 2 16.638 16.638 16.638 16.638 16.638 16.638 16.638 16.638 16.638 16.638

162CPA0013.29 4041-0029 Asia & Pacific Southern Asia India Karnataka Registered Biomass energy Biomass energy Biomass briquettes AMS-I.C. 1 13.0 10 25 0.0 1-Jan-13 0.000 129.520 TÜV-Nord Asia Carbon 31-Dec-12 30-Dec-99 5 8 9 4 0 Thermax India 0.860 No Investment 2 12.952 12.952 12.952 12.952 12.952 12.952 12.952 12.952 12.952 12.952

163CPA0013.30 4041-0030 Asia & Pacific Southern Asia India Maharashtra Registered Biomass energy Biomass energy Biomass briquettes AMS-I.C. 1 8.5 10 25 0.0 1-Feb-13 0.000 84.940 TÜV-Nord Asia Carbon 31-Dec-12 30-Dec-99 5 8 9 4 0 Thermax India 0.800 No Investment 2 8.494 8.494 8.494 8.494 8.494 8.494 8.494 8.494 8.494 8.494

164CPA0013.31 4041-0031 Asia & Pacific Southern Asia India Kerala Registered Biomass energy Biomass energy Biomass briquettes AMS-I.C. 1 6.5 10 25 0.0 1-Aug-13 0.000 64.770 TÜV-Nord Asia Carbon 20-Jun-13 30-Dec-99 5 8 9 4 0 Thermax India 0.860 No Investment 2 3.239 6.477 6.477 6.477 6.477 6.477 6.477 6.477 6.477 3.239

165CPA0013.32 4041-0032 Asia & Pacific Southern Asia India Maharashtra Registered Biomass energy Biomass energy Biomass briquettes AMS-I.C. 1 8.8 10 25 0.0 1-Apr-14 0.000 88.160 TÜV-Nord 28-Mar-14 30-Dec-99 5 8 9 4 0 Thermax India 0.860 No Investment 8.816 8.816 8.816 8.816 8.816 8.816 8.816 8.816 8.816 8.816

166PoA0014 3PZT61O72LFYTMK2KT4FANFNR9BUUF 4791 Improved Cooking Stoves in Bangladesh Asia & Pacific Southern Asia Bangladesh Bangladesh Registered EE households EE households Stoves AMS-II.G. 19 936.9 12-Feb-08 28 23.145 5,469.141 TÜV-SÜD 28.551 0.000 413.148 1 28-Jan-13 12-Jan-17 LRQA United K. (JP Morgan) HED Consulting, JP Morgan 25-Aug-09 26-Jun-11 6-Jul-11 11-Aug-11 19-Jul-11 PoA 30-Dec-99PoA 1 6 8 4 5 9 0.0167CPA0014.01 4791-0001 Improved Cooking Stoves in Bangladesh – CPA No.01 Grameen Shakti Asia & Pacific Southern Asia Bangladesh Bangladesh Registered EE households EE households Stoves AMS-II.G. 1 50.2 7 21 0.0 19-Jul-11 23.145 475.218 TÜV-SÜD 28.551 28.551 1 28-Jan-13 27-Mar-12 LRQA United K. (JP Morgan) HED Consulting, JP Morgan 25-Aug-09 19-Jul-11 30-Dec-99 1 6 8 4 5 9 0 92.0 No 25.116 50.233 50.233 50.233 50.233 50.233 50.233 25.116 168CPA0014.02 4791-0002 Improved Cooking Stoves in Bangladesh – CPA No.02 “Grameen Shakti” Asia & Pacific Southern Asia Bangladesh Bangladesh Registered EE households EE households Stoves Dissemination of 62504 ICS AMS-II.G. 1 50.2 7 21 0.0 8-Nov-14 308.574 TÜV-SÜD Climate-Secure Services 25-Aug-09 6-Nov-14 30-Dec-99 1 6 8 4 5 9 0 179.8 No 50.169 50.169 50.169 50.169 50.169 50.169 50.169

169CPA0014.03 4791-0003 Improved Cooking Stoves in Bangladesh – CPA No.03 “Grameen Shakti” Asia & Pacific Southern Asia Bangladesh Bangladesh Registered EE households EE households Stoves Disssemination of 57822 ICS AMS-II.G. 1 49.5 7 21 0.0 8-Nov-14 304.496 TÜV-SÜD Climate-Secure Services 25-Aug-09 6-Nov-14 30-Dec-99 1 6 8 4 5 9 0 177.4 No 49.506 49.506 49.506 49.506 49.506 49.506 49.506

170CPA0014.04 4791-0004 Improved Cooking Stoves in Bangladesh – CPA No.04 “Grameen Shakti” Asia & Pacific Southern Asia Bangladesh Bangladesh Registered EE households EE households Stoves Dissemination of 61253 ICS AMS-II.G. 1 50.0 7 21 0.0 8-Nov-14 307.633 TÜV-SÜD Climate-Secure Services 25-Aug-09 6-Nov-14 30-Dec-99 1 6 8 4 5 9 0 179.2 No 50.015 50.015 50.015 50.015 50.015 50.015 50.015

171CPA0014.05 4791-0005 Improved Cooking Stoves in Bangladesh – CPA No.05 “Grameen Shakti” Asia & Pacific Southern Asia Bangladesh Bangladesh Registered EE households EE households Stoves Dissemination of 59673 ICS AMS-II.G. 1 49.9 7 21 0.0 8-Nov-14 307.128 TÜV-SÜD Climate-Secure Services 25-Aug-09 6-Nov-14 30-Dec-99 1 6 8 4 5 9 0 178.9 No 49.934 49.934 49.934 49.934 49.934 49.934 49.934

172CPA0014.06 4791-0006 Improved Cooking Stoves in Bangladesh – CPA No.06 “Grameen Shakti” Asia & Pacific Southern Asia Bangladesh Bangladesh Registered EE households EE households Stoves Dissemination of 60158 ICS AMS-II.G. 1 49.9 7 21 0.0 8-Nov-14 307.098 TÜV-SÜD Climate-Secure Services 25-Aug-09 6-Nov-14 30-Dec-99 1 6 8 4 5 9 0 178.9 No 49.929 49.929 49.929 49.929 49.929 49.929 49.929

173CPA0014.07 4791-0007 Improved Cooking Stoves in Bangladesh – CPA No.07 “Grameen Shakti” Asia & Pacific Southern Asia Bangladesh Bangladesh Registered EE households EE households Stoves Dissemination of 57743 ICS AMS-II.G. 1 47.9 7 21 0.0 8-Nov-14 294.495 TÜV-SÜD Climate-Secure Services 25-Aug-09 6-Nov-14 30-Dec-99 1 6 8 4 5 9 0 171.6 No 47.880 47.880 47.880 47.880 47.880 47.880 47.880

174CPA0014.08 4791-0008 Improved Cooking Stoves in Bangladesh – CPA No.08 “Grameen Shakti” Asia & Pacific Southern Asia Bangladesh Bangladesh Registered EE households EE households Stoves Dissemination of 57972 ICS AMS-II.G. 1 48.6 7 21 0.0 8-Nov-14 298.788 TÜV-SÜD Climate-Secure Services 25-Aug-09 6-Nov-14 30-Dec-99 1 6 8 4 5 9 0 174.1 No 48.578 48.578 48.578 48.578 48.578 48.578 48.578

175CPA0014.09 4791-0009 Improved Cooking Stoves in Bangladesh – CPA No.09 “Grameen Shakti” Asia & Pacific Southern Asia Bangladesh Bangladesh Registered EE households EE households Stoves Dissemination of 59831 ICS AMS-II.G. 1 50.1 7 21 0.0 8-Nov-14 308.149 TÜV-SÜD Climate-Secure Services 25-Aug-09 6-Nov-14 30-Dec-99 1 6 8 4 5 9 0 179.5 No 50.100 50.100 50.100 50.100 50.100 50.100 50.100

176CPA0014.10 4791-0010 Improved Cooking Stoves in Bangladesh – CPA No.10 “Grameen Shakti” Asia & Pacific Southern Asia Bangladesh Bangladesh Registered EE households EE households Stoves Dissemination of 53979 ICS AMS-II.G. 1 49.6 7 21 0.0 8-Nov-14 305.363 TÜV-SÜD Climate-Secure Services 25-Aug-09 6-Nov-14 30-Dec-99 1 6 8 4 5 9 0 177.9 No 49.647 49.647 49.647 49.647 49.647 49.647 49.647

177CPA0014.11 4791-0011 Improved Cooking Stoves in Bangladesh – CPA No.11 “Grameen Shakti” Asia & Pacific Southern Asia Bangladesh Bangladesh Registered EE households EE households Stoves Dissemination of 51107 ICS AMS-II.G. 1 46.8 7 21 0.0 8-Nov-14 288.098 TÜV-SÜD Climate-Secure Services 25-Aug-09 6-Nov-14 30-Dec-99 1 6 8 4 5 9 0 167.8 No 46.840 46.840 46.840 46.840 46.840 46.840 46.840

178CPA0014.12 4791-0012 Asia & Pacific Southern Asia Bangladesh Bangladesh Registered EE households EE households Stoves Dissemination of 44457 ICS AMS-II.G. 1 49.6 7 21 0.0 8-Jan-16 246.955 TÜV-SÜD 48.759 48.759 9-Mar-18 12-Jan-17 RINA Climate-Secure Services 25-Aug-09 13-Jan-16 30-Dec-99 1 6 8 4 5 9 0 177.6 No 49.554 49.554 49.554 49.554 49.554 49.554 49.554

179CPA0014.13 4791-0013 Asia & Pacific Southern Asia Bangladesh Bangladesh Registered EE households EE households Stoves Dissemination of 49842 ICS AMS-II.G. 1 49.3 7 21 0.0 8-Jan-16 245.550 TÜV-SÜD 48.254 48.254 9-Mar-18 12-Jan-17 RINA Climate-Secure Services 25-Aug-09 13-Jan-16 30-Dec-99 1 6 8 4 5 9 0 176.6 No 49.272 49.272 49.272 49.272 49.272 49.272 49.272

180CPA0014.14 4791-0014 Asia & Pacific Southern Asia Bangladesh Bangladesh Registered EE households EE households Stoves Dissemination of 53837 ICS AMS-II.G. 1 49.6 7 21 0.0 8-Jan-16 247.205 TÜV-SÜD 48.433 48.433 9-Mar-18 12-Jan-17 RINA Climate-Secure Services 25-Aug-09 13-Jan-16 30-Dec-99 1 6 8 4 5 9 0 177.8 No 49.604 49.604 49.604 49.604 49.604 49.604 49.604

181CPA0014.15 4791-0015 Asia & Pacific Southern Asia Bangladesh Bangladesh Registered EE households EE households Stoves Dissemination of 57433 ICS AMS-II.G. 1 49.6 7 21 0.0 8-Jan-16 247.040 TÜV-SÜD 48.255 48.255 9-Mar-18 12-Jan-17 RINA Climate-Secure Services 25-Aug-09 13-Jan-16 30-Dec-99 1 6 8 4 5 9 0 177.6 No 49.571 49.571 49.571 49.571 49.571 49.571 49.571

182CPA0014.16 4791-0016 Asia & Pacific Southern Asia Bangladesh Bangladesh Registered EE households EE households Stoves Dissemination of 55934 ICS AMS-II.G. 1 50.2 7 21 0.0 8-Jan-16 250.115 TÜV-SÜD 48.944 48.944 9-Mar-18 12-Jan-17 RINA Climate-Secure Services 25-Aug-09 13-Jan-16 30-Dec-99 1 6 8 4 5 9 0 179.8 No 50.188 50.188 50.188 50.188 50.188 50.188 50.188

183CPA0014.17 4791-0017 Asia & Pacific Southern Asia Bangladesh Bangladesh Registered EE households EE households Stoves Dissemination of 60068 ICS AMS-II.G. 1 50.1 7 21 0.0 8-Jan-16 249.711 TÜV-SÜD 48.695 48.695 9-Mar-18 12-Jan-17 RINA Climate-Secure Services 25-Aug-09 13-Jan-16 30-Dec-99 1 6 8 4 5 9 0 179.6 No 50.107 50.107 50.107 50.107 50.107 50.107 50.107

184CPA0014.18 4791-0018 Asia & Pacific Southern Asia Bangladesh Bangladesh Registered EE households EE households Stoves Dissemination of 58448 ICS AMS-II.G. 1 50.1 7 21 0.0 8-Jan-16 249.831 TÜV-SÜD 48.785 48.785 9-Mar-18 12-Jan-17 RINA Climate-Secure Services 25-Aug-09 13-Jan-16 30-Dec-99 1 6 8 4 5 9 0 179.6 No 50.131 50.131 50.131 50.131 50.131 50.131 50.131

185CPA0014.19 4791-0019 Asia & Pacific Southern Asia Bangladesh Bangladesh Registered EE households EE households Stoves Dissemination of 53033 ICS AMS-II.G. 1 45.7 7 21 0.0 8-Jan-16 227.694 TÜV-SÜD 44.472 44.472 9-Mar-18 12-Jan-17 RINA Climate-Secure Services 25-Aug-09 13-Jan-16 30-Dec-99 1 6 8 4 5 9 0 163.7 No 45.689 45.689 45.689 45.689 45.689 45.689 45.689

186PoA0015 QWUIDIMQZ3L3Z8O0N1HQFH8J7258AL 5174 Heat Retention Cooking in South Africa Africa Southern Africa South Africa South Africa Rejected EE households EE households Stoves AMS-II.C. 1 43.4 1-Jun-09 28 66.470 476.304 TÜV-SÜD 0.000 United K. (JP Morgan) JP Morgan, Molora Consulting 22-Sep-09 PoA 30-Dec-99PoA 1 6 8 4 5 9 0 0.0187CPA0015.01 5174-0001 Heat Retention Cooking in South-West Gauteng Africa Southern Africa South Africa Gauteng Rejected EE households EE households Stoves Wonderbag Heat Retention Cookers AMS-II.C. 1 43.4 7 21 6.0 16-Jan-10 66.470 476.304 TÜV-SÜD United K. (JP Morgan) JP Morgan, Molora Consulting 22-Sep-09 30-Dec-99 1 6 8 4 5 9 0 0.890 No Foik 7.385 22.155 36.925 44.310 44.310 44.310 44.310 188PoA0016 G1NU99KPWG655SQX4X5F0EQE8BNT17 2897 Egypt Vehicle Scrapping and Recycling Program Africa North Africa Egypt Egypt Ministry of Finance Registered Transport Transport Scrapping old vehicles AMS-III.C. 3 21.2 11-May-11 28 0.030 212.460 TÜV-Nord 222.624 222.624 21-Sep-16 31-Dec-15 AENOR WB-CF 20-Nov-09 1-Jun-10 12-Apr-11 11-May-11 CPA 30-Dec-99CPA 1 6 9 11 0.0

189CPA0016.01 2897-0001 Greater Cairo Region Taxi Scrapping and Recycling Project Africa North Africa Egypt Cairo Ministry of Finance Registered Transport Transport Scrapping old vehicles AMS-III.C. 1 0.0 10 20 -4.0 30-Jun-11 0.030 0.200 TÜV-Nord WB-CF 20-Nov-09 11-May-11 30-Dec-99 1 6 9 11 0 No Prevailing practice 0.057 0.044 0.034 0.024 0.018 0.012 0.008 0.005 0.003 0.001

190CPA0016.02 2897-0002 Africa North Africa Egypt Greater Cairo Ministry of Finance Registered Transport Transport Scrapping old vehicles AMS-III.C. 1 14.4 10 20 -4.0 22-Apr-13 0.000 144.220 TÜV-Nord 157.732 157.732 21-Sep-16 31-Dec-14 AENOR WB-CF 18-Apr-13 30-Dec-99 1 6 9 11 0 No Prevailing practice 45.001 34.287 25.465 18.351 12.714 8.406

191CPA0016.03 2897-0003 Africa North Africa Egypt Greater Cairo Ministry of Finance Registered Transport Transport Scrapping old vehicles AMS-III.C. 1 6.8 10 20 -4.0 1-Jun-13 0.000 68.040 TÜV-Nord 64.892 64.892 21-Sep-16 31-Dec-14 AENOR WB-CF 17-May-13 30-Dec-99 1 6 9 11 0 No Prevailing practice 20.620 16.202 12.157 8.807 6.151 4.105

192PoA0017 XZCFF4R5RTZ3GB7XXU7OZ1ARYWUIK5 Hunan Household Biogas Digester Programme Asia & Pacific East Asia China Hunan Validation Terminated Methane avoidance Methane avoidance Manure AMS-I.C. 1 58.4 1-May-08 28 267.550 583.750 DNV 0.000 Finland (Finland Ministry for Foreign Affairs) Gaia Consulting 24-Nov-09 PoA 30-Dec-99CPA 1 6 8 11 0.0193CPA0017.01 The 1st Northern CPA of Hunan Household Biogas Digester Programme Asia & Pacific East Asia China Validation Terminated Methane avoidance Methane avoidance Manure AMS-I.C. 1 58.4 10 10 0.0 1-May-08 267.550 583.750 DNV Finland (Finland Ministry for Foreign Affairs) Gaia Consulting 24-Nov-09 30-Dec-99 1 6 8 11 0 No 29.464 58.928 58.928 58.928 58.928 58.928 58.928 58.928 58.928 58.928 29.464

194PoA0018 EY77EH8X8BRE7I6ZAMIB1826FES1OQ 2896 SGCC In-advance Distribution Transformer Replacement CDM Programme Asia & Pacific East Asia China China State Grid Corporation of China Registered Energy distribution Energy distribution Efficient electricity distribution AMS-II.A. 4 99.4 1-Jan-11 20 62.699 993.980 TÜV-Nord 22.331 53.581 75.912 2 15-Jan-13 31-Dec-13 Spain (Government of Spain) WB-CF 24-Nov-09 1-Jul-10 2-Dec-10 15-Jan-11 12-Feb-11 PoA 30-Dec-99PoA 4 5 0.0

195CPA0018.01 2896-0001 Asia & Pacific East Asia China Liaoning State Grid Corporation of China Registered Energy distribution Energy distribution Efficient electricity distribution AMS-II.A. 1 4.1 10 20 -0.2 1-Jan-11 8.158 40.790 TÜV-Nord 5.339 3.974 9.313 2 15-Jan-13 31-Dec-13 Spain (Government of Spain) WB-CF 24-Nov-09 12-Feb-11 30-Dec-99 4 5 10 0 0.927 0.0 No Other;Prevailing practice 4.722 4.722 4.722 4.722 4.435 4.005 3.699 3.469 3.246 3.050

196CPA0018.02 2896-0002 Asia & Pacific East Asia China Many State Grid Corporation of China Registered Energy distribution Energy distribution Efficient electricity distribution AMS-II.A. 1 29.7 10 20 -2.0 1-Jun-12 7.915 297.390 TÜV-Nord 4.974 15.423 20.397 1 29-Oct-14 31-Dec-13 WB-CF 28-May-12 30-Dec-99 10 5 4 0 0.0 No Other;Prevailing practice 7.915 38.122 38.122 36.212 32.774 30.083 28.527 26.894 25.438 23.937 9.374

197CPA0018.03 2896-0003 Asia & Pacific East Asia China Many State Grid Corporation of China Registered Energy distribution Energy distribution Efficient electricity distribution AMS-II.A. 1 30.6 10 20 -3.1 1-Jun-12 24.540 306.400 TÜV-Nord 9.045 26.548 35.593 1 29-Oct-14 31-Dec-13 WB-CF 28-May-12 30-Dec-99 10 5 4 0 0.0 No Other;Prevailing practice 24.540 41.862 41.862 39.492 33.980 28.158 24.502 24.502 22.115 21.153 8.262

198CPA0018.04 2896-0004 Asia & Pacific East Asia China Many State Grid Corporation of China Registered Energy distribution Energy distribution Efficient electricity distribution AMS-II.A. 1 34.9 10 20 -1.3 1-Jun-12 22.086 349.400 TÜV-Nord 2.973 7.636 10.609 1 29-Oct-14 31-Dec-13 WB-CF 28-May-12 30-Dec-99 10 5 0 0.0 No Other;Prevailing practice 22.086 37.671 37.671 37.338 36.633 36.049 35.657 34.323 31.847 29.065 11.066

199PoA0019 97MHN57ORZLBG85D8RZ8CCK41LJH6W Asia & Pacific Southern Asia India India Validation Terminated EE industry EE industry Chemicals AMS-II.D. 1 0.8 18-Dec-07 28 2.292 7.640 RINA 0.000 n.a. Thermax Sustainable Energy Solutions 11-Dec-09 PoA 30-Dec-99CPA 7 9 5 4 1 8 0.0

200CPA0019.01 Asia & Pacific Southern Asia India Maharashtra Validation Terminated EE industry EE industry Chemicals AMS-II.D. 1 0.8 10 15 0.0 1-Jan-10 2.292 7.640 RINA n.a. Thermax Sustainable Energy Solutions 11-Dec-09 30-Dec-99 7 9 5 4 1 8 0 0.800 No 0.764 0.764 0.764 0.764 0.764 0.764 0.764 0.764 0.764 0.764

201PoA0020 1KZZKH1T52DEHPVHAFOC975XWWXTLP 9557 Yemen Electricity Distribution Loss Reduction Programme Middle-East Arabian Peninsula Yemen Yemen Registered Energy distribution Energy distribution Efficient electricity distribution AMS-II.A. 1 6.7 1-Jan-10 28 21.434 67.100 BV Cert 0.000 Netherlands (IBRD) 17-Dec-09 31-Jan-13 26-Sep-13 31-Jan-13 PoA 31-Dec-99CPA 1 10 4 9 0.0 MSC LDC202CPA0020.01 9557-0001 Yemen Electricity Distribution Loss Reduction Program: Yarim and Ibb Middle-East Arabian Peninsula Yemen Ibb Registered Energy distribution Energy distribution Efficient electricity distribution AMS-II.A. 1 6.7 10 25 0.0 1-Apr-10 21.434 67.100 BV Cert Netherlands (IBRD) 17-Dec-09 31-Jan-13 30-Dec-99 1 10 4 9 0 0.909 No Financial;Other MSC LDC 5.846 7.794 7.794 7.794 7.794 7.794 7.794 7.794 7.794 7.794 1.949 203PoA0021 6V7V9IQGKLEM7IU7RT9MDZWB2GDN16 8027 Thailand Small Scale Livestock Waste Management Program Asia & Pacific Southeast Asia Thailand Thailand Registered Methane avoidance Methane avoidance Manure AMS-III.D. 3 119.8 15-May-07 28 0.000 1,197.970 DNV 13.858 13.858 1 7-Jul-17 31-Dec-14 RINA Portugal (IBRD) WB-CF 22-Dec-09 30-Jun-11 6-Nov-12 29-Dec-12 11-Sep-12 PoA 30-Dec-99CPA 1 5 10 6 11 1.1204CPA0021.01 8027-0001 Thailand Small Scale Livestock Waste Management Program CPA 01 Asia & Pacific Southeast Asia Thailand Bangkok Registered Methane avoidance Methane avoidance Manure AMS-III.D. 1 55.8 10 15 0.0 5-Dec-12 557.710 DNV 13.858 13.858 1 7-Jul-17 31-Dec-14 RINA Portugal (IBRD) WB-CF 22-Dec-09 11-Sep-12 30-Dec-99 1 5 10 6 11 0 0.550 No 55.774 55.774 55.771 55.771 55.771 55.771 55.771 55.771 55.771 51.798 205CPA0021.02 8027-0002 Thailand Small Scale Livestock Waste Management Program CPA 02 Asia & Pacific Southeast Asia Thailand Registered Methane avoidance Methane avoidance Manure AMS-III.D. 1 24.8 10 15 0.0 1-Dec-14 248.010 DNV WB-CF 22-Dec-09 28-Nov-14 30-Dec-99 1 5 10 6 11 0 0.5 2 0.566 No 2.066 24.801 24.801 24.801 24.801 24.801 24.801 24.801 24.801 24.801 206CPA0021.03 8027-0003 Thailand Small Scale Livestock Waste Management Program CPA 03 Asia & Pacific Southeast Asia Thailand Registered Methane avoidance Methane avoidance Manure AMS-III.D. 1 39.2 10 15 0.0 1-Dec-14 392.250 DNV WB-CF 22-Dec-09 28-Nov-14 30-Dec-99 1 5 10 6 11 0 0.6 4 0.566 No 3.268 39.225 39.225 39.225 39.225 39.225 39.225 39.225 39.225 39.225 207PoA0022 8NQSNDGXJC1SL5OHIPOBRGZGADTHG6 5104 Composting and Co-composting Programme of Activities (PoA) in Indonesia Asia & Pacific Southeast Asia Indonesia Indonesia Registered Methane avoidance Methane avoidance Palm oil waste AMS-III.F. 1 22.4 9-Jun-08 28 29.410 301.603 TÜV-SÜD 0.000 Switzerland (South Pole Carbon Asset Management) South Pole Carbon Asset Management 22-Dec-09 26-Mar-10 26-Mar-10 10-Aug-11 22-Nov-11 2 CPA 30-Dec-99CPA 7 9 1 6 3 5 0.0

208CPA0022.01 5104-0001 Asia & Pacific Southeast Asia Indonesia Riau Registered Methane avoidance Methane avoidance Palm oil waste AMS-III.F. 1 22.4 7 15 2.0 22-Jul-07 29.410 301.603 TÜV-SÜD Switzerland (South Pole Carbon Asset Management) South Pole Carbon Asset Management 22-Dec-09 22-Nov-112 30-Dec-99 7 9 1 6 3 5 -2 N0 Investment 3 15.140 18.263 20.898 23.121 24.996 26.578 27.913

209PoA0023 J7BOTN9LCWLN2SNVRY5LIGMT0B22D1 5616 Sustainable Small Hydropower Programme of Activities (PoA) in Indonesia Asia & Pacific Southeast Asia Indonesia Indonesia Registered Hydro Hydro Run of river AMS-I.D. 1 5.3 22-Jul-07 28 19.160 71.593 TÜV-SÜD 0.000 Switzerland (South Pole Carbon Asset Management) South Pole Carbon Asset Management 22-Dec-09 21-Jan-10 2-May-12 22-Jun-12 2-May-12 CPA 30-Dec-99Both Gold Standard 4 9 5 10 11 1.2

210CPA0023.01 5616-0001 1.1 MW Manggani Mini Hydroelectric Project, West Sumatra, Indonesia Asia & Pacific Southeast Asia Indonesia West Sumatra Registered Hydro Hydro Run of river 1.1 MW run of river hydropower plant AMS-I.D. 1 5.3 7 30 0.0 22-Jul-07 19.160 71.593 TÜV-SÜD Switzerland (South Pole Carbon Asset Management) South Pole Carbon Asset Management 22-Dec-09 2-May-12 30-Dec-99 4 9 5 10 11 0 1.2 7152 0.743 No MSC SUZ 3 5.201 5.201 5.201 5.201 5.201 5.201 5.201 5.201 5.201 5.201 5.201 5.201 5.201 5.201 5.201 5.201 5.201 5.201 5.201 5.201 5.201 211PoA0024 Z36X1S3M65OLXAHEUE7ELY7571XD4Q 9572 Nepal Biogas Support Program-PoA Asia & Pacific Southern Asia Nepal Nepal Implementing household biogas applications Registered Methane avoidance Methane avoidance Domestic manure AMS-I.E. 8 515.0 30-Apr-10 28 104.676 3,409.056 TÜV-SÜD 0.000 866.749 866.749 2 22-Jun-15 31-Jul-16 EPIC Germany (atmosfair) 22-Dec-09 31-Dec-09 31-Jan-13 31-Jan-13 PoA 30-Dec-99PoA 1 6 4 8 0.0 Plist212CPA0024.01 9572-0001 Nepal Biogas Support Program - CPA 1: 20,000 digesters. Asia & Pacific Southern Asia Nepal Nepal Nepal Implementing household biogas applications Registered Methane avoidance Methane avoidance Domestic manure 20,000 biogas digesters AMS-I.E. 1 61.5 7 20 0.0 31-Jan-13 104.676 487.193 TÜV-SÜD 219.910 219.910 2 22-Jun-15 31-Jul-16 EPIC Germany (atmosfair) 22-Dec-09 31-Jan-13 30-Dec-99 1 6 4 8 0 No Investment;Other Plist 30.115 61.510 61.510 61.510 61.510 61.510 61.510 61.510 61.510 61.510 61.510 213CPA0024.02 9572-0002 Nepal Biogas Support Program - CPA 2: 19,927 digesters. Asia & Pacific Southern Asia Nepal Nepal Nepal Implementing household biogas applications Registered Methane avoidance Methane avoidance Domestic manure 19,927 biogas digesters AMS-I.E. 1 66.2 7 20 0.0 31-Jan-13 0.000 524.625 TÜV-SÜD 141.231 141.231 2 22-Jun-15 31-Jul-16 EPIC Germany (atmosfair) 22-Dec-09 8-May-14 30-Dec-99 1 6 4 8 0 No Investment;Other Plist 33.099 66.236 66.236 66.236 66.236 66.236 66.236 214CPA0024.03 9572-0003 Nepal Biogas Support Program - CPA 3: 19,959 digesters. Asia & Pacific Southern Asia Nepal Nepal Nepal Implementing household biogas applications Registered Methane avoidance Methane avoidance Domestic manure 19,959 biogas digesters AMS-I.E. 1 66.3 7 20 0.0 31-Jan-13 0.000 525.362 TÜV-SÜD 132.287 132.287 2 22-Jun-15 31-Jul-16 EPIC Germany (atmosfair) 22-Dec-09 8-May-14 30-Dec-99 1 6 4 8 0 No Investment;Other Plist 33.111 66.329 66.329 66.329 66.329 66.329 66.329 215CPA0024.04 9572-0004 Nepal Biogas Support Program - CPA 4: 19,970 digesters. Asia & Pacific Southern Asia Nepal Nepal Implementing household biogas applications Registered Methane avoidance Methane avoidance Domestic manure 19,970 biogas digesters AMS-I.E. 1 66.4 7 20 0.0 31-Jan-13 0.000 525.901 TÜV-SÜD 133.036 133.036 2 22-Jun-15 31-Jul-16 EPIC Germany (atmosfair) 22-Dec-09 8-May-14 30-Dec-99 1 6 4 8 0 No Investment;Other Plist 33.131 66.397 66.397 66.397 66.397 66.397 39.234 216CPA0024.05 9572-0005 Nepal Biogas Support Program - CPA 5: 19,842 digesters Asia & Pacific Southern Asia Nepal Nepal Nepal Implementing household biogas applications Registered Methane avoidance Methane avoidance Domestic manure 19,842 biogas digesters AMS-I.E. 1 65.9 7 20 0.0 25-Aug-14 0.000 418.763 TÜV-SÜD 120.576 120.576 1 13-Apr-17 31-Jul-16 EPIC Germany (atmosfair) 22-Dec-09 25-Aug-14 30-Dec-99 1 6 4 8 0 No Investment;Other Plist 65.883 65.883 65.883 65.883 65.883 65.883 65.883 217CPA0024.06 9572-0006 Nepal Biogas Support Program - CPA 6: 18,504 digesters Asia & Pacific Southern Asia Nepal Nepal Nepal Implementing household biogas applications Registered Methane avoidance Methane avoidance Domestic manure biogas digester (GGC 2047 model) AMS-I.E. 1 61.6 7 20 0.0 15-Jul-15 0.000 336.668 TÜV-SÜD 61.151 61.151 23-Jan-18 31-Jul-16 EPIC Germany (atmosfair) 22-Dec-09 8-Jul-15 PoA 30-Dec-99PoA 1 6 4 8 0 Investment;Other Plist218CPA0024.07 9572-0007 Nepal Biogas Support Program - CPA 7: 18,392 digesters Asia & Pacific Southern Asia Nepal Nepal Nepal Implementing household biogas applications Registered Methane avoidance Methane avoidance Domestic manure biogas digester (GGC 2047 model) AMS-I.E. 1 61.5 7 20 0.0 15-Jul-15 0.000 336.367 TÜV-SÜD 58.558 58.558 23-Jan-18 31-Jul-16 EPIC Germany (atmosfair) 22-Dec-09 8-Jul-15 PoA 30-Dec-99PoA 1 6 4 8 0 Investment;Other Plist219CPA0024.07 9572-0008 Nepal Biogas Support Program - CPA 8: 19,445 digesters Asia & Pacific Southern Asia Nepal Nepal Nepal Implementing household biogas applications Registered Methane avoidance Methane avoidance Domestic manure biogas digester (GGC 2047 model) AMS-I.E. 1 65.6 7 20 0.0 15-Feb-17 0.000 254.177 TÜV-SÜD 22-Dec-09 1-Feb-17 PoA 30-Dec-99PoA 1 6 4 8 0 Investment;Other Plist 65.6 65.6 65.6 65.6 65.6 65.6 65.6 220PoA0025 J8AS7C008XO90OT9BYMYLY2T23DSUS KIPRAH community based integrated waste management project, Indonesia Asia & Pacific Southeast Asia Indonesia Indonesia BORDA/atmosfair Germany Validation Terminated Methane avoidance Methane avoidance Composting AMS-III.F. 1 2.8 1-Dec-09 28 5.000 28.753 TÜV-Nord 0.000 Germany (Atmosfair) Atmosfair, BORDA 23-Dec-09 CPA 31-Dec-99PoA 1 8 4 5 6 9 0.0

221CPA0025.01 Asia & Pacific Southeast Asia Indonesia Java, Bali BORDA/atmosfair Germany Validation Terminated Methane avoidance Methane avoidance Composting 15 Material Recovery Facilities (MRFs) AMS-III.F. 1 2.8 7 30 0.6 1-Aug-10 5.000 28.753 TÜV-Nord Germany (Atmosfair) Atmosfair, BORDA 23-Dec-09 30-Dec-99 1 8 4 5 6 9 0 Yes 1.206 2.068 2.647 3.034 3.294 3.469 3.585 3.585 3.585 3.585 3.585 3.585 3.585 3.585 3.585 3.585 3.585 3.585 3.585 3.585 3.585

222PoA0026 PFA0158W92RYKF7PWAHT39VPU9POPL Sustainable Small Hydropower Programme of Activities (PoA) in Viet Nam Asia & Pacific Southeast Asia Vietnam Vietnam Replaced At Validation Hydro Hydro New dam ACM2 31-Dec-09 28 BV Cert Switzerland (South Pole Carbon Asset Management) South Pole Carbon Asset Management 23-Dec-09 13-Sep-11 CPA 31-Dec-99CPA 4 8 10 5 9 11

223CPA0026.01 Song Mien Hydropower Project Asia & Pacific Southeast Asia Vietnam Ha Giang Vietnam PoA JSC Replaced At Validation Hydro Hydro New dam 6 MW run of river hydropower plant ACM2 1 9.6 7 30 0.0 1-Jan-11 19.248 96.293 BV Cert Switzerland (South Pole Carbon Asset Management) South Pole Carbon Asset Management 23-Dec-09 13-Sep-11 30-Dec-99 4 8 10 5 9 11 1 China 6.0 21657 0.536 No 3 9.624 9.624 9.624 9.624 9.624 9.624 9.624 9.624 9.624 9.624 9.624 9.624 9.624 9.624 9.624 9.624 9.624 9.624 9.624 9.624 9.624

224PoA0027 842J7KCG5SRVNU5AZ2O6DK8SK18ND1 Futuro Forestal Nicaragua Reforestation Program Latin America Central America Nicaragua Opera At Validation Reforestation Reforestation Reforestation AR-AM4 1 4.9 28-May-07 30 24.520 66.721 BV Cert 0.000 Canada (IBRD) WB-CF, Opera 24-Dec-09 CPA 30-Dec-99CPA 5 9 8 7 0.0225CPA0027.01 Latin America Central America Nicaragua Opera At Validation Reforestation Reforestation Reforestation AR-AM4 1 4.9 20 60 0.0 28-May-07 24.520 66.721 BV Cert Canada (IBRD) WB-CF, Opera 24-Dec-09 30-Dec-99 5 9 8 7 0 No Foik 2.110 4.928 6.346 4.461 4.461 5.051 5.051 5.051 5.051 5.051 5.051 5.051 5.051 5.051 5.051 5.051 5.051 5.051 5.051 5.051

226PoA0028 OY69YK027B749EEOTOZMDYH6KIWB3H 5979 Asia & Pacific Southeast Asia Philippines Philippines Registered Methane avoidance Methane avoidance Manure AMS-III.D. 18 275.2 1-Jun-12 28 40.370 1,302.194 DNV 0.942 26.545 27.487 22-Jul-16 30-Jun-15 BVCH n.a. WB-CF 24-Dec-09 7-Mar-11 11-Apr-12 28-Jun-12 10-May-12 CPA 30-Dec-99CPA 1 2 7 9 8 4.9

227CPA0028.01 5979-0001 Asia & Pacific Southeast Asia Philippines Central Visayas LBP Registered Methane avoidance Methane avoidance Manure AMS-III.D. 1 23.1 7 25 0.0 10-May-10 40.370 246.116 DNV 0.942 7.812 8.754 22-Jul-16 30-Jun-15 n.a. WB-CF 24-Dec-09 10-May-12 30-Dec-99 1 2 7 9 8 0 0.8 5500 0.542 No 13.483 23.105 23.105 23.105 23.105 23.105 23.105 9.622

228CPA0028.02 5979-0002 Asia & Pacific Southeast Asia Philippines South Cotabato LBP Registered Methane avoidance Methane avoidance Manure AMS-III.D. 1 63.0 7 25 0.0 8-Sep-13 0.000 461.227 DNV 18.733 18.733 22-Jul-16 30-Jun-15 WB-CF 24-Dec-09 8-Sep-13 CPA 30-Dec-99 1 2 7 9 8 0 0.8 5376 0.542 No 18.331 57.189 63.028 63.028 63.028 63.028 63.028 42.824

229CPA0028.03 5979-0003 Asia & Pacific Southeast Asia Philippines Victoria, Tarlac LBP Registered Methane avoidance Methane avoidance Manure AMS-III.D. 1 4.2 7 25 0.0 1-Oct-17 0.000 13.506 DNV WB-CF 24-Dec-09 26-Jan-17 CPA 30-Dec-99 1 2 7 9 8 0 0.644 No 1.044 4.152 4.152 4.152 4.152 4.152 4.152

230CPA0028.04 5979-0004 Asia & Pacific Southeast Asia Philippines Ilocos Norte LBP Registered Methane avoidance Methane avoidance Manure AMS-III.D. 1 50.2 7 25 0.0 1-Oct-17 163.364 TÜV-Nord WB-CF 24-Dec-09 29-Sep-17 CPA 30-Dec-99 1 2 7 9 8 0 0.9 5813 0.644 7.793 36.415 41.441 46.466 51.492 56.517 61.543 59.972

231CPA0028.05 5979-0005 Asia & Pacific Southeast Asia Philippines LBP Registered Methane avoidance Methane avoidance Manure AMS-III.D. 1 3.5 7 25 0.0 1-Oct-17 11.314 TÜV-Nord WB-CF 24-Dec-09 29-Sep-17 CPA 30-Dec-99 1 2 7 9 8 0 0.1 813 0.644 0.642 2.996 3.175 3.354 3.532 3.712 3.890 3.055

232CPA0028.06 5979-0006 Asia & Pacific Southeast Asia Philippines Cagayan LBP Registered Methane avoidance Methane avoidance Manure AMS-III.D. 1 5.6 7 25 0.0 1-Oct-17 18.192 TÜV-Nord WB-CF 24-Dec-09 29-Sep-17 CPA 30-Dec-99 1 2 7 9 8 0 0.1 334 0.644 0.896 4.803 4.803 5.582 5.582 6.360 6.360 4.774

233CPA0028.07 5979-0007 Asia & Pacific Southeast Asia Philippines Cebu LBP Registered Methane avoidance Methane avoidance Manure AMS-III.D. 1 35.0 7 25 0.0 1-Dec-17 107.970 TÜV-Nord WB-CF 24-Dec-09 29-Sep-17 CPA 30-Dec-99 1 2 7 9 8 0 0.2 1189 0.644 2.964 34.987 34.987 34.987 34.987 34.987 34.987 32.109

234CPA0028.08 5979-0008 Asia & Pacific Southeast Asia Philippines Bontoc LBP Registered Methane avoidance Methane avoidance Manure AMS-III.D. 1 1.8 7 25 0.0 1-Oct-17 5.824 TÜV-Nord WB-CF 24-Dec-09 29-Sep-17 CPA 30-Dec-99 1 2 7 9 8 0 0.1 806 0.644 0.450 1.719 1.719 1.719 1.719 1.719 1.719 1.344

235CPA0028.09 5979-0009 Asia & Pacific Southeast Asia Philippines Bukidnon LBP Registered Methane avoidance Methane avoidance Manure AMS-III.D. 1 6.1 7 25 0.0 1-Oct-17 19.883 TÜV-Nord WB-CF 24-Dec-09 29-Sep-17 CPA 30-Dec-99 1 2 7 9 8 0 0.2 1512 0.462 1.082 4.886 5.099 5.846 6.902 6.902 6.902 5.180

236CPA0028.10 5979-0010 Asia & Pacific Southeast Asia Philippines Bukidnon LBP Registered Methane avoidance Methane avoidance Manure AMS-III.D. 1 5.6 7 25 0.0 1-Oct-17 18.091 TÜV-Nord WB-CF 24-Dec-09 29-Sep-17 CPA 30-Dec-99 1 2 7 9 8 0 0.1 672 0.460 1.398 5.562 5.562 5.562 5.562 5.562 5.562 4.175

237CPA0028.11 5979-0011 Asia & Pacific Southeast Asia Philippines South Cotabato LBP Registered Methane avoidance Methane avoidance Manure AMS-III.D. 1 4.3 7 25 0.0 1-Nov-17 13.720 TÜV-Nord WB-CF 24-Dec-09 29-Sep-17 CPA 30-Dec-99 1 2 7 9 8 0 0.2 1309 0.460 0.722 4.331 4.331 4.331 4.331 4.331 4.331 3.619

238CPA0028.12 5979-0012 Asia & Pacific Southeast Asia Philippines Isabela LBP Registered Methane avoidance Methane avoidance Manure AMS-III.D. 1 12.8 7 25 0.0 1-Dec-17 39.546 TÜV-Nord WB-CF 24-Dec-09 29-Sep-17 CPA 30-Dec-99 1 2 7 9 8 0 0.4 2688 0.644 0.485 10.643 10.643 10.643 10.643 10.643 16.455

239CPA0028.13 5979-0013 Asia & Pacific Southeast Asia Philippines Tarlac LBP Registered Methane avoidance Methane avoidance Manure AMS-III.D. 1 6.6 7 25 1-Dec-17 20.410 DNV WB-CF 24-Dec-09 30-Nov-17 CPA 30-Dec-99 1 2 7 9 8 0 0.1 6550 0.644 0.336 4.409 5.017 5.717 6.498 7.370 8.342 8.629

240CPA0028.14 5979-0014 Asia & Pacific Southeast Asia Philippines Pampanga LBP Registered Methane avoidance Methane avoidance Manure AMS-III.D. 1 39.2 7 25 1-Dec-17 120.871 DNV WB-CF 24-Dec-09 30-Nov-17 CPA 30-Dec-99 1 2 7 9 8 0 0.3 6556 0.644 2.213 28.274 31.278 34.736 38.594 42.903 47.705 48.571

241CPA0028.15 5979-0015 Asia & Pacific Southeast Asia Philippines Tugbok LBP Registered Methane avoidance Methane avoidance Manure AMS-III.D. 1 5.7 7 25 1-Dec-17 17.575 DNV WB-CF 24-Dec-09 30-Nov-17 CPA 30-Dec-99 1 2 7 9 8 0 0.2 3360 0.460 0.336 4.324 4.720 5.158 5.639 6.168 6.750 6.782

242CPA0028.16 5979-0016 Asia & Pacific Southeast Asia Philippines Oroquieta LBP Registered Methane avoidance Methane avoidance Manure AMS-III.D. 1 4.5 7 25 0.0 1-Feb-18 13.147 DNV WB-CF 24-Dec-09 31-Jan-18 CPA 30-Dec-99 1 2 7 9 8 0 0.1 6717 0.460 3.267 4.652 4.652 4.652 4.652 4.652 4.652 0.395

243CPA0028.17 5979-0017 Asia & Pacific Southeast Asia Philippines Pampanga LBP Registered Methane avoidance Methane avoidance Manure AMS-III.D. 1 2.1 7 25 0.0 1-Feb-18 6.090 DNV WB-CF 24-Dec-09 31-Jan-18 CPA 30-Dec-99 1 2 7 9 8 0 0.1 6550 0.644 1.908 2.090 2.090 2.090 2.090 2.090 2.090 0.178

244CPA0028.18 5979-0018 Asia & Pacific Southeast Asia Philippines Bukidnon LBP Registered Methane avoidance Methane avoidance Manure AMS-III.D. 1 1.9 7 25 0.0 1-Apr-18 5.350 DNV WB-CF 24-Dec-09 7-Mar-18 CPA 30-Dec-99 1 2 7 9 8 0 0.1 6717 0.460 1.464 1.943 1.943 1.943 1.943 1.943 1.943 0.478

245PoA0029 XC2SATT3LMM67V2K1EB76ZU0FO3P2P 5787 Asia & Pacific Southern Asia India Punjab Registered Energy distribution Energy distribution Efficient electricity distribution AMS-II.A. 4 124.6 25-Oct-07 28 1.413 1,245.990 BV Cert 0.000 Denmark (IBRD) Punjab State Electricity Board 27-Dec-09 6-Aug-10 13-Jul-12 15-Sep-12 13-Jul-12 PoA 30-Dec-99PoA 4 10 5 8 9 0 0.0

246CPA0029.01 5787-0001 Asia & Pacific Southern Asia India Dhuri Registered Energy distribution Energy distribution Efficient electricity distribution AMS-II.A. 1 3.4 10 30 0.0 1-Aug-12 1.413 33.900 BV Cert Denmark (IBRD) Punjab State Electricity Board 27-Dec-09 13-Jul-12 30-Dec-99 4 10 5 8 9 0 0.840 32.2 No Financial;Investment 14.248 14.248 14.248 14.248 14.248 14.248 14.248 14.248 14.248 14.248

247CPA0029.02 5787-0002 Asia & Pacific Southern Asia India Punjab Registered Energy distribution Energy distribution Efficient electricity distribution AMS-II.A. 1 34.0 10 28 0.0 7-Aug-13 0.000 339.590 BV Cert Punjab State Electricity Board 27-Dec-09 7-Aug-13 PoA 30-Dec-99 4 10 5 8 9 0 36.9 No Financial;Investment

248CPA0029.03 5787-0003 Asia & Pacific Southern Asia India Punjab Registered Energy distribution Energy distribution Efficient electricity distribution AMS-II.A. 1 42.4 10 25 0.0 7-Aug-13 0.000 424.490 BV Cert Punjab State Electricity Board 27-Dec-09 7-Aug-13 PoA 30-Dec-99 4 10 5 8 9 0 46.1 No Financial;Investment 42.449 42.449 42.449 42.449 42.449 42.449 42.449 42.449 42.449 42.449 42.449

249CPA0029.04 5787-0004 Asia & Pacific Southern Asia India Punjab Registered Energy distribution Efficient electricity distribution AMS-II.A. 1 44.8 10 25 0.0 7-Aug-13 0.000 448.010 BV Cert Punjab State Electricity Board 27-Dec-09 7-Aug-13 PoA 30-Dec-99 4 10 5 8 9 0 48.6 No Financial;Investment 44.801 44.801 44.801 44.801 44.801 44.801 44.801 44.801 44.801 44.801 44.801

250PoA0030 O5VZTS7UTZ8EADX1N81S4DB6O8IYV2 Asia & Pacific Southern Asia India India Johnsons Controls At Validation EE service EE service HVAC & lighting AMS-II.C. 1 11.9 1-Jan-10 28 32.854 119.470 BV Cert 0.000 n.a. Johnsons Controls 27-Dec-09 CPA 30-Dec-99PoA 5 4 6 9 11 0.0

251CPA0030.01 Asia & Pacific Southern Asia India India Johnsons Controls At Validation EE service EE service HVAC & lighting Installation of 33 EE chillers AMS-II.C. 1 11.9 10 15 0.0 1-Apr-10 32.854 119.470 BV Cert n.a. Johnsons Controls 27-Dec-09 30-Dec-99 5 4 6 9 11 0 No Investment;Other 11.947 11.947 11.947 11.947 11.947 11.947 11.947 11.947 11.947 11.947

252PoA0031 SYWCXSBVI11NV3XMS7HEGTFUE3DFWU 4793 Efficient Lighting Initiative of Bangladesh (ELIB) Asia & Pacific Southern Asia Bangladesh Bangladesh Registered EE households EE households Lighting AMS-II.J. 9 124.3 2-Feb-10 28 43.338 1,243.480 TÜV-SÜD 0.000 Denmark (Danish Ministry of Climate & Energy) WB-CF 29-Dec-09 13-Oct-10 13-May-11 13-May-11 PoA 30-Dec-99PoA 10 9 8 5 7 1 0.0253CPA0031.01 4793-0001 Efficient Lighting Initiative of Bangladesh (ELIB): DHAKA- DESCO - CPA # 1 Asia & Pacific Southern Asia Bangladesh Dhaka Registered EE households EE households Lighting AMS-II.J. 1 17.5 10 10 -2.0 6-Aug-11 43.338 175.400 TÜV-SÜD Denmark (Danish Ministry of Climate & Energy) WB-CF 29-Dec-09 13-May-11 30-Dec-99 10 9 8 5 7 1 0 0.620 50.8 Yes Financial 31.507 29.357 27.207 25.058 22.908 20.758 18.608 0.000 0.000 0.000

254CPA0031.02 4793-0002 Efficient Lighting Initiative of Bangladesh (ELIB): Rangpur- REB- CPA # 2 Asia & Pacific Southern Asia Bangladesh Rangpur Registered EE households EE households Lighting AMS-II.J. 1 13.4 10 6 -3.8 1-Sep-14 0.000 133.510 TÜV-SÜD WB-CF 29-Dec-09 30-Nov-13 30-Dec-99 10 9 8 5 7 0 0.670 Yes Financial 28.415 25.950 23.484 21.019 18.553 16.087 0.000 0.000 0.000 0.000

255CPA0031.03 4793-0003 Efficient Lighting Initiative of Bangladesh (ELIB): Sylhet- REB- CPA # 3 Asia & Pacific Southern Asia Bangladesh Sylhet Registered EE households EE households Lighting AMS-II.J. 1 13.4 10 6 -3.8 1-Sep-14 0.000 133.510 TÜV-SÜD WB-CF 29-Dec-09 30-Nov-13 30-Dec-99 10 9 8 5 7 0 0.670 No Financial 28.415 25.950 23.484 21.019 18.553 16.087 0.000 0.000 0.000 0.000

256CPA0031.04 4793-0004 Efficient Lighting Initiative of Bangladesh (ELIB): Rajshahi- REB- CPA # 4 Asia & Pacific Southern Asia Bangladesh Rajshahi Registered EE households EE households Lighting AMS-II.J. 1 13.4 10 6 -3.8 1-Sep-14 0.000 133.510 TÜV-SÜD WB-CF 29-Dec-09 30-Nov-13 30-Dec-99 10 9 8 5 7 0 0.670 Yes Financial 28.415 25.950 23.484 21.019 18.553 16.087 0.000 0.000 0.000 0.000

257CPA0031.05 4793-0005 Efficient Lighting Initiative of Bangladesh (ELIB): Khulna- REB- CPA # 5 Asia & Pacific Southern Asia Bangladesh Khulna Registered EE households EE households Lighting AMS-II.J. 1 13.4 10 6 -3.8 1-Sep-14 0.000 133.510 TÜV-SÜD WB-CF 29-Dec-09 30-Nov-13 30-Dec-99 10 9 8 5 7 0 0.670 Yes Financial 28.415 25.950 23.484 21.019 18.553 16.087 0.000 0.000 0.000 0.000

258CPA0031.06 4793-0006 Efficient Lighting Initiative of Bangladesh (ELIB): Norsingdi- REB- CPA # 6 Asia & Pacific Southern Asia Bangladesh Norsingdi Registered EE households EE households Lighting AMS-II.J. 1 13.4 10 6 -3.8 1-Sep-14 0.000 133.510 TÜV-SÜD WB-CF 29-Dec-09 30-Nov-13 30-Dec-99 10 9 8 5 7 0 0.670 Yes Financial 28.415 25.950 23.484 21.019 18.553 16.087 0.000 0.000 0.000 0.000

259CPA0031.07 4793-0007 Efficient Lighting Initiative of Bangladesh (ELIB): Chandpur - REB- CPA # 7 Asia & Pacific Southern Asia Bangladesh Chandpur Registered EE households EE households Lighting AMS-II.J. 1 13.4 10 6 -3.8 1-Sep-14 0.000 133.510 TÜV-SÜD WB-CF 29-Dec-09 30-Nov-13 30-Dec-99 10 9 8 5 7 0 0.670 Yes Financial 28.415 25.950 23.484 21.019 18.553 16.087 0.000 0.000 0.000 0.000

260CPA0031.08 4793-0008 Efficient Lighting Initiative of Bangladesh (ELIB): Barisal - REB- CPA # 8 Asia & Pacific Southern Asia Bangladesh Barisal Registered EE households EE households Lighting AMS-II.J. 1 13.4 10 6 -3.8 1-Sep-14 0.000 133.510 TÜV-SÜD WB-CF 29-Dec-09 30-Nov-13 30-Dec-99 10 9 8 5 7 0 0.670 Yes Financial 28.415 25.950 23.484 21.019 18.553 16.087 0.000 0.000 0.000 0.000

Province/State/Region

Number of CPAs

1st period ktCO2/yr

2nd period

ktCO2/yr

PoA lifetime start

POA Lifetime

Tech Lifetime CPA (Years)

CP1 kCERs

CP2 kCERs

Tota l issuance (kCERs)

Number of issu-ances

Expected kCERs

Issuance success

Voluntary cancel-la tions

Submitted again la ter

Start date for 4 weeks request

review period

Date of registra tion

Date of inc lusion

SDStandard:SD Tool, Gold Standard, CCB

Tech Transfer code

Manu-facturer 1

Equipment supplier country 1

Manu-facturer 2

Equipment supplier country 2

Know-how Provider

Know-how country

MWh produced

Grid emission

factor tCO2e/MW

EE GWh reduced

Automatic additionali ty

Supported by CDM Loan Scheme

Investment Analysis Type

Finance Indicator

In frastructure Development Company L imited

To provide households with electricity which have no access to thepower grid by implementing Solar Home Systems (SHS)

Denmark (Danish Min istry o f Cl imate & Energy), Austria (Kommunalkredit)

Installation of Solar Home Systems in Bangladesh (22/06/2007 to 31/12/2010) by IDCOL

Infrastructure Development Company L imited

Bundle of estimated4 205,000 uni ts of Solar Home Systems (SHS)

Denmark (Danish Min istry o f Cl imate & Energy), Germany (BASF+kfW), Spain (Government of Spain+Gas Natural SDG+Hidroelectrica de l Cantabrico+Endesa), Belgium (Wal loon Air and Climate

Investment;Other;Technological

Investment comparison analysisInstallation of Solar Home Systems in Bangladesh (01/01/2011 to

31/12/2011) by IDCOLInfrastructure Development Company L imited

Bundle of estimated4 225,205 uni ts of Solar Home Systems (SHS)

Investment;Other;Technological

Investment comparison analysisInstallation of Solar Home Systems in Bangladesh (01/01/2010 to

31/12/2010) by Grameen ShaktiIn frastructure Development Company L imited

Bundle of estimated4 175,079 uni ts of Solar Home Systems (SHS)

Investment;Other;Technological

Investment comparison analysisInstallation of Solar Home Systems in Bangladesh (01/01/2012 to

30/06/2012) by IDCOLInfrastructure Development Company L imited

Bundle of estimated4 177,851 uni ts of Solar Home Systems (SHS)

Investment;Other;Technological

Investment comparison analysis

Installation of Solar Home Systems in Bangladesh (01/01/2011 to 31/12/2011) by Grameen Shakti

In frastructure Development Company L imited

Bundle of estimated4 211,284 uni ts of Solar Home Systems (SHS)

Investment;Other;Technological

Investment comparison analysisInstallation of Solar Home Systems in Bangladesh (01/01/2012 to

31/12/2012) by Grameen ShaktiIn frastructure Development Company L imited

Bundle of estimated4 245,009 uni ts of Solar Home Systems (SHS)

Investment;Other;Technological

Investment comparison analysisInstallation of Solar Home Systems in Bangladesh (01/07/2012 to

31/12/2012) by IDCOLInfrastructure Development Company L imited

Bundle of estimated4 194,802 uni ts of Solar Home Systems (SHS)

Investment;Other;Technological

Investment comparison analysis

Installation of Solar Home Systems in Bangladesh (22/06/2007 to 31/12/2009) by Grameen Shakti

In frastructure Development Company L imited

Bundle of estimated4 151,895 uni ts of Solar Home Systems (SHS)

Investment;Other;Technological

Investment comparison analysisInstallation of Solar Home Systems in Bangladesh (01/01/2013 to

31/08/2013) by Grameen ShaktiIn frastructure Development Company L imited

Bundle of estimated 213,333 units of Solar Home Systems (SHS)

Investment;Other;Technological

Investment comparison analysisInstallation of Solar Home Systems in Bangladesh (01/09/2013 to

30/04/2014) by Grameen ShaktiIn frastructure Development Company L imited

Bundle of estimated 226,667 units of Solar Home Systems (SHS)

Investment;Other;Technological

Investment comparison analysisInstallation of Solar Home Systems in Bangladesh (01/05/2014 to

31/12/2014) by Grameen ShaktiIn frastructure Development Company L imited

Bundle of estimated 240,000 units of Solar Home Systems (SHS)

Investment;Other;Technological

Investment comparison analysisInstallation of Solar Home Systemsin Bangladesh (01/01/2013 to

31/08/2013) by IDCOL2Infrastructure Development Company L imited

Bundle of estimated 266,667 units of Solar Home Systems (SHS)

Investment;Other;Technological

Investment comparison analysisInstallation of Solar Home Systemsin Bangladesh (01/09/2013 to

30/04/2014) by IDCOL2Infrastructure Development Company L imited

Bundle of estimated 273,333 units of Solar Home Systems (SHS)

Investment;Other;Technological

Investment comparison analysisMethane capture and combustion from Animal Waste Management System

(AWMS) of the 3S Program farms of the Instituto Sadia de SustentabilidadeRio Grande do Sul & Santa Catarina & Paraná & Minas Gerais & Mato

Promoting sustainabledevelopment among swine producers

Investment;Other;Technological

Investment comparison analysis

Prostart Traders 40 - New Energ ies

Promotion of renewable energy technologies across commercial and public oriented buildings, or residentia l bui ldings, with large scale hot water consumption

New Energ ies Commercia l Solar Water Heating Programme in South Africa. CPA Nr 1

Prostart Traders 40 - New Energ ies

Investment;Prevailing practice;Technological

CUIDEMOS Mexico (Campana De Uso Intelegente De Energia Mexico) – Smart Use of Energy Mexico

To transform the energy efficiency of Mexic o’s residential lighting stock bydistributing up to 30 mil lion compact fluorescent lamps (CFLs) to households

SD Tool, Gold Standard

CUIDEMOS Mexico (Campana De Uso Intelegente De Energia Mexico) – Puebla

Distribution of free Compact Fluorescent Lamps (CFLs)

Simple cost analysis

CUIDEMOS Mexico (Campana De Uso Intelegente De Energia Mexico) – CPA-02

Distribution of free Compact Fluorescent Lamps (CFLs)

Simple cost analysis

CUIDEMOS Mexico (Campana De Uso Intelegente De Energia Mexico) – CPA-03

Distribution of free Compact Fluorescent Lamps (CFLs)

Simple cost analysis

CUIDEMOS Mexico (Campana De Uso Intelegente De Energia Mexico) – CPA-04

Distribution of free Compact Fluorescent Lamps (CFLs)

Simple cost analysis

CUIDEMOS Mexico (Campana De Uso Intelegente De Energia Mexico) – CPA-05

Distribution of free Compact Fluorescent Lamps (CFLs)

Simple cost analysis

CUIDEMOS Mexico (Campana De Uso Intelegente De Energia Mexico) – CPA-06

Distribution of free Compact Fluorescent Lamps (CFLs)

Simple cost analysis

CUIDEMOS Mexico (Campana De Uso Intelegente De Energia Mexico) – CPA-07

Distribution of free Compact Fluorescent Lamps (CFLs)

Simple cost analysis

CUIDEMOS Mexico (Campana De Uso Intelegente De Energia Mexico) – CPA-08

Distribution of free Compact Fluorescent Lamps (CFLs)

Simple cost analysis

CUIDEMOS Mexico (Campana De Uso Intelegente De Energia Mexico) – CPA-09

Distribution of free Compact Fluorescent Lamps (CFLs)

Simple cost analysis

CUIDEMOS Mexico (Campana De Uso Intelegente De Energia Mexico) – CPA-10

Distribution of free Compact Fluorescent Lamps (CFLs)

Simple cost analysis

CUIDEMOS Mexico (Campana De Uso Intelegente De Energia Mexico) – CPA-11

Distribution of free Compact Fluorescent Lamps (CFLs)

Simple cost analysis

CUIDEMOS Mexico (Campana De Uso Intelegente De Energia Mexico) – CPA-12

Distribution of free Compact Fluorescent Lamps (CFLs)

Simple cost analysis

CUIDEMOS Mexico (Campana De Uso Intelegente De Energia Mexico) – CPA-13

Distribution of free Compact Fluorescent Lamps (CFLs)

Simple cost analysis

CUIDEMOS Mexico (Campana De Uso Intelegente De Energia Mexico) – CPA-14

Distribution of free Compact Fluorescent Lamps (CFLs)

Simple cost analysis

CUIDEMOS Mexico (Campana De Uso Intelegente De Energia Mexico) – CPA-15

Distribution of free Compact Fluorescent Lamps (CFLs)

Simple cost analysis

CUIDEMOS Mexico (Campana De Uso Intelegente De Energia Mexico) – CPA-16

Distribution of free Compact Fluorescent Lamps (CFLs)

Simple cost analysis

CUIDEMOS Mexico (Campana De Uso Intelegente De Energia Mexico) – CPA-17

Distribution of free Compact Fluorescent Lamps (CFLs)

Simple cost analysis

CUIDEMOS Mexico (Campana De Uso Intelegente De Energia Mexico) – CPA-18

Distribution of free Compact Fluorescent Lamps (CFLs)

Simple cost analysis

CUIDEMOS Mexico (Campana De Uso Intelegente De Energia Mexico) – CPA-19

Distribution of free Compact Fluorescent Lamps (CFLs)

Simple cost analysis

CUIDEMOS Mexico (Campana De Uso Intelegente De Energia Mexico) – CPA-20

Distribution of free Compact Fluorescent Lamps (CFLs)

Simple cost analysis

CUIDEMOS Mexico (Campana De Uso Intelegente De Energia Mexico) – CPA-21

Distribution of free Compact Fluorescent Lamps (CFLs)

Simple cost analysis

CUIDEMOS Mexico (Campana De Uso Intelegente De Energia Mexico) – CPA-22

Distribution of free Compact Fluorescent Lamps (CFLs)

Simple cost analysis

CUIDEMOS Mexico (Campana De Uso Intelegente De Energia Mexico) – CPA-23

Distribution of free Compact Fluorescent Lamps (CFLs)

Simple cost analysis

CUIDEMOS Mexico (Campana De Uso Intelegente De Energia Mexico) – CPA-24

Distribution of free Compact Fluorescent Lamps (CFLs)

Simple cost analysis

CUIDEMOS Mexico (Campana De Uso Intelegente De Energia Mexico) – CPA-25

Distribution of free Compact Fluorescent Lamps (CFLs)

Simple cost analysis

National Environmenta l Management Authori ty (NEMA)

To avoid methane emissions from Municipal waste landfi lls by undertaking composting of the wastes and using the organic matter in wastes as humus for so il

Denmark (Danish Min istry o f Cl imate & Energy+DONG+Maersk+Aalborg Portland)National Environmenta l

Management Authori ty (NEMA)Denmark (Danish Min istry o f Cl imate & Energy+DONG+Maersk+Aalborg Portland)

Prevai ling practice;TechnologicalMUNICIPAL WASTE COMPOSTING PROJECT FOR FORT PORTAL

MUNICIPALITYNational Environmenta l Management Authori ty (NEMA)

Prevai ling practice;Technological

MUNICIPAL WASTE COMPOSTING PROJECT FOR KABALE MUNICIPALITY

National Environmenta l Management Authori ty (NEMA)

Prevai ling practice;Technological

MUNICIPAL WASTE COMPOSTING PROJECT FOR KASESE MUNICIPALITY

National Environmenta l Management Authori ty (NEMA)

Prevai ling practice;Technological

National Environmenta l Management Authori ty (NEMA)

Prevai ling practice;Technological

MUNICIPAL WASTE COMPOSTING PROJECT FOR MBALE MUNICIPALITY

National Environmenta l Management Authori ty (NEMA)

Prevai ling practice;Technological

MUNICIPAL WASTE COMPOSTING PROJECT FOR MUKONO MUNICIPALITY

National Environmenta l Management Authori ty (NEMA)

Prevai ling practice;Technological

National Environmenta l Management Authori ty (NEMA)

Prevai ling practice;Technological

National Environmenta l Management Authori ty (NEMA)

Prevai ling practice;TechnologicalNational Environmenta l

Management Authori ty (NEMA)Prevai ling practice;TechnologicalNational Environmenta l

Management Authori ty (NEMA)Prevai ling practice;TechnologicalNational Environmenta l

Management Authori ty (NEMA)Prevai ling practice;TechnologicalPromotion of Energy-Efficient lighting using Compact Fluorescent Light Bulbs

in rural areas in SenegalAgence Senegalaise d’Electrification Rurale

To promote energy efficient lighting in newly electrified households in rura lareas of SenegalPromotion of Energy-Efficient lighting using Compact Fluorescent Light Bulbs

in the concess ion of Saint-Louis-Dagana-Podor as part of the Senegalese rura l electri fication p lan.

Agence Senegalaise d’Electrification Rurale

Energy-Efficient lighting using Compact Fluorescent Light Bulbs

Investment;Prevailing practice

To develop a p latform for overcominginsti tu tional, financial and structural hurdles for the construction of a series of small hydroprojects in Honduras

Benchmark analysisBenchmark analysisBenchmark analysisBenchmark analysisAgence Nationale pour la

Maîtrise de l 'Energ ie (ANME)To instal l around 30,000 SWH per year in households, therebyAgence Nationale pour la

Maîtrise de l 'Energ ie (ANME)Financial ;Other;Prevail ing practice;Technological

Agence Nationale pour la Maîtrise de l 'Energ ie (ANME)

Financial ;Other;Prevail ing practice;Technological

Agence Nationale pour la Maîtrise de l 'Energ ie (ANME)

Financial ;Other;Prevail ing practice;Technological

Agence Nationale pour la Maîtrise de l 'Energ ie (ANME)

Financial ;Other;Prevail ing practice;Technological

Agence Nationale pour la Maîtrise de l 'Energ ie (ANME)

Financial ;Other;Prevail ing practice;Technological

Agence Nationale pour la Maîtrise de l 'Energ ie (ANME)

Financial ;Other;Prevail ing practice;Technological

Agence Nationale pour la Maîtrise de l 'Energ ie (ANME)

Financial ;Other;Prevail ing practice;Technological

Agence Nationale pour la Maîtrise de l 'Energ ie (ANME)

Financial ;Other;Prevail ing practice;Technological

Energy Saving Renovation Programme at Instant Coffee Production Factories of Dongsuh Foods Corporation in Korea

South Korea (Incheon, Gyeungsangnam)

To promote energy saving through rep lacements of existing systems wi th high energyEnergy Saving Renovation Activity 1 at Bupyung Instant Coffee Production

Factory Freeze Dry Line of Dongsuh Foods Corporation in Korea (CPA-1)Replacing absorption refrigerators wi th a mechanical refrigerator

Benchmark analysis

To promote energy saving in the southern reg ion of Viet Nam Investment;Prevailing

practice;TechnologicalReduction of green house gases by providing renewable mechanica lenergy for irrigation to rura l farmers which would otherwise be supplied by d iesel pumps

Hydraul ic rams dissemination in Songyang and Kaihua, Zhejiang province, China in 2008

Songyang and Kaihua, Zhejiang

Dissemination of 65 hydraulic ram pumps (“hydrams”)

Investment;Technological

To replace ICLs amongst residential users in Ind ia wi th qual ity long-life CFLsCFL lighting scheme – “Bachat Lamp Yojana” in Ranga Reddy District,

Ranga Reddy North Ci rcle, Habsiguda Division, Central Power Distribution Company of Andhra Pradesh L imited, Andhra Pradesh, India

Simple cost analysis

CFL lighting scheme – “Bachat Lamp Yojana” in Thiruvananthapuram Urban Ci rcle of Kerala State Electrici ty Board, Kerala, Ind ia

Simple cost analysis

CFL lighting scheme – “Bachat Lamp Yojana” in Thiruvananthapuram Rura l Ci rcle of Kerala State Electrici ty Board, Kerala, Ind ia

Simple cost analysis

CFL lighting scheme – “Bachat Lamp Yojana” in Pathanamthitta Circle of Kera la State Electricity Board, Kerala, Ind ia

Simple cost analysis

CFL lighting scheme – “Bachat Lamp Yojana” in Kottayam Circle of Kerala State Electrici ty Board, Kerala, Ind ia

Simple cost analysis

CFL lighting scheme – “Bachat Lamp Yojana” in Kottarakkara Circle of Kera la State Electricity Board, Kerala, Ind ia

Simple cost analysis

CFL lighting scheme – “Bachat Lamp Yojana” in Kollam Circle of Kerala State Electrici ty Board, Kerala, Ind ia

Simple cost analysis

CFL lighting scheme – “Bachat Lamp Yojana” in Palakkad Ci rcle of Kerala State Electrici ty Board, Kerala, Ind ia

Simple cost analysis

CFL lighting scheme – “Bachat Lamp Yojana” in Shornur Circle of Kerala State Electrici ty Board, Kerala, Ind ia

Simple cost analysis

CFL lighting scheme – “Bachat Lamp Yojana” in Ti rur Circle of Kerala State Electricity Board, Kera la, India

Simple cost analysis

CFL lighting scheme – “Bachat Lamp Yojana” in Manjeri Ci rc le of Kerala State Electrici ty Board, Kerala, Ind ia

Simple cost analysis

CFL lighting scheme – “Bachat Lamp Yojana” in Kannur and Kalpetta Circles of Kerala State Electrici ty Board, Kerala, Ind ia

Simple cost analysis

CFL lighting scheme – “Bachat Lamp Yojana” in Kozhikode Circle of Kera la State Electrici ty Board, Kerala, Ind ia

Simple cost analysis

CFL lighting scheme – “Bachat Lamp Yojana” in Vadakara Ci rcle of Kerala State Electrici ty Board, Kerala, Ind ia

Simple cost analysis

CFL lighting scheme – “Bachat Lamp Yojana” in Kasargod and Sreekandpuram Circles of Kerala State Electricity Board, Kera la, India

Simple cost analysis

CFL lighting scheme – “Bachat Lamp Yojana” in Thrissur Circle of Kerala State Electrici ty Board, Kerala, Ind ia

Simple cost analysis

CFL lighting scheme – “Bachat Lamp Yojana” in Ernakulam Circle of Kerala State Electrici ty Board, Kerala, Ind ia

Simple cost analysis

CFL lighting scheme – “Bachat Lamp Yojana” in Irinja lakkuda Ci rcle of Kera la State Electricity Board, Kerala, Ind ia

Simple cost analysis

CFL lighting scheme – “Bachat Lamp Yojana” in Pala & Thodupuzha Circles of Kerala State Electrici ty Board, Kerala, Ind ia

Simple cost analysis

CFL lighting scheme – “Bachat Lamp Yojana” in Perumbavoor Circle of Kera la State Electricity Board, Kerala, Ind ia

Simple cost analysis

CFL lighting scheme – “Bachat Lamp Yojana” in Allappuzha Ci rcle of Kerala State Electrici ty Board, Kerala, Ind ia

Simple cost analysis

CFL lighting scheme – “Bachat Lamp Yojana” in KOLAR DISTRICT, ELECTRICAL DIVISION OF KOLAR CIRCLE, KGF DIVISION, BESCOM, KARNATAKA, INDIA

Simple cost analysis

CFL lighting scheme – “Bachat Lamp Yojana” in CHIKKABALLAPURA DISTRICT, ELECTRICAL DIVISION OF KOLAR CIRCLE, CHIKKABALLAPURA (CB PURA) DIVISION, BESCOM, KARNATAKA, INDIA

Simple cost analysis

CFL lighting scheme – “Bachat Lamp Yojana” in BANGALORE RURAL DISTRICT, ELECTRICAL DIVISION OF BANGALORE RURAL CIRCLE, CHANDAPURA DIVISION, BESCOM, KARNATAKA, INDIA

Simple cost analysis

CFL lighting scheme – “Bachat Lamp Yojana” in KOLAR DISTRICT, ELECTRICAL DIVISION OF KOLAR CIRCLE, KOLAR DIVISION, BESCOM, KARNATAKA, INDIA

Simple cost analysis

CFL lighting scheme – “Bachat Lamp Yojana” in BANGALORE RURAL DISTRICT, ELECTRICAL DIVISION OF BANGALORE RURAL CIRCLE, NELAMANGALA DIVIS ION, BESCOM, KARNATAKA, INDIA

Simple cost analysis

CFL lighting scheme – “Bachat Lamp Yojana” in RAMANAGARA DISTRICT, ELECTRICAL DIVISION OF BANGALORE RURAL CIRCLE, RAMANAGARA DIVISION, BESCOM, KARNATAKA, INDIA

Simple cost analysis

CFL lighting scheme – “Bachat Lamp Yojana” in BANGALORE RURAL DISTRICT, ELECTRICAL DIVISION OF BANGALORE RURAL CIRCLE, YELAHANKA DIVIS ION, BESCOM, KARNATAKA, INDIA

Simple cost analysis

CFL lighting scheme – “Bachat Lamp Yojana” in Shal imar Bagh District of North West Circle and Model Town District of North Ci rcle, North Delhi Power Limited, Delhi, India

Simple cost analysis

CFL lighting scheme – “Bachat Lamp Yojana” in Keshav Puram, Civil L ines and Shakti Nagar Districts o f North Circle , North Delh i Power L imited, Delh i, India

Simple cost analysis

CFL lighting scheme – “Bachat Lamp Yojana” in Pitampura District of North Ci rcle, Rohini District o f Northwest Circle, North Delhi Power Limited, Delhi, India

Simple cost analysis

Bachat Lamp Yojana” in Moti Nagar District of North Ci rcle, Mangol Puri District of Northwest Circle , North Delh i Power Limi ted, Delh i, Ind ia

Simple cost analysis

CFL lighting scheme – “Bachat Lamp Yojana” in Bawana District, Badl i District and Nare la District of North West Circle , North Delhi Power Limi ted, Delhi , India

Simple cost analysis

CFL lighting scheme – “Bachat Lamp Yojana” in NORTH GOA, ADMINISTRATIVE DIVISIONS OF BLOCK-II, GOA ELECTRICITY DEPARTMENT, GOA, INDIA

Simple cost analysis

CFL lighting scheme – “Bachat Lamp Yojana” in South Goa, Admin istrative Divisions of Block- I, Goa Electricity Department, Goa , India

Simple cost analysis

Simple cost analysisSimple cost analysisSimple cost analysisSimple cost analysisSimple cost analysisSimple cost analysisSimple cost analysis

CFL lighting scheme – “Bachat Lamp Yojana” in Ranga Reddy District, Ranga Reddy North Ci rcle, Kukatpally Division, Central Power Distribution Company of Andhra Pradesh L imited, Andhra Pradesh, India

Simple cost analysis

CFL lighting scheme – “Bachat Lamp Yojana” in Ranga Reddy District, Ranga Reddy North Ci rcle, Gachibowl i Division, Central Power Distribution Company of Andhra Pradesh L imited, Andhra Pradesh, India

Simple cost analysis

CFL lighting scheme – “Bachat Lamp Yojana” in Ranga Reddy District, Ranga Reddy North Ci rcle, Medchal Division, Central Power Distribution Company of Andhra Pradesh L imited, Andhra Pradesh, India

Simple cost analysis

CFL lighting scheme – “Bachat Lamp Yojana” in Hyderabad District, Hyderabad North Circle ,B owenpally and Paradise Divisions, Centra l Power Distribution Company of Andhra Pradesh Limited, Andhra Pradesh, India

Simple cost analysis

CFL lighting scheme – “Bachat Lamp Yojana” in Hyderabad District, Hyderabad Central Circle and Hyderabad North Circle with underlying Azamabad and Green Lands Divisions respectively , Andhra Pradesh, Ind ia

Simple cost analysis

CFL lighting scheme – “Bachat Lamp Yojana” in Ranga Reddy District, Ranga Reddy South Ci rcle and Ranga Reddy East Ci rcle wi th underlying Champapet and Saroornagar Divisions respective ly, Andhra Pradesh, Ind ia

Simple cost analysis

CFL lighting scheme – “Bachat Lamp Yojana” in Ranga Reddy District, Ranga Reddy South Ci rcle and Ranga Reddy East Ci rcle wi th underlying Champapet and Saroornagar Divisions respective ly, Andhra Pradesh, Ind ia

Simple cost analysis

CFL lighting scheme – “Bachat Lamp Yojana” in Ranga Reddy District, Ranga Reddy South Ci rcle,Vikarabad and Rajendra Nagar Divisions, Central Power Distribution Company of Andhra PradeshLimited, Andhra Pradesh, India

Simple cost analysis

Thermax Susta inable Energy Solutions

To disp lace fossi l fuel util ization for thermal energy generation by the Promotion ofPromotion of Biomass Based Heat Generation Systems in Ind ia CPA

Number 001Thermax Susta inable Energy Solutions

Investment comparison analysisPromotion of Biomass Based Heat Generation Systems in Ind ia CPA

Number 002Thermax Susta inable Energy Solutions

Investment comparison analysisPromotion of Biomass Based Heat Generation Systems in Ind ia CPA

Number 011Thermax Susta inable Energy Solutions

Investment comparison analysisPromotion of Biomass Based Heat Generation Systems in Ind ia CPA

Number 003Thermax Susta inable Energy Solutions

Investment comparison analysis

Promotion of Biomass Based Heat Generation Systems in Ind ia CPA Number 004

Thermax Susta inable Energy Solutions

Investment comparison analysisPromotion of Biomass Based Heat Generation Systems in Ind ia CPA

Number 006Thermax Susta inable Energy Solutions

Investment comparison analysisPromotion of Biomass Based Heat Generation Systems in Ind ia CPA

Number 007Thermax Susta inable Energy Solutions

Investment comparison analysisPromotion of Biomass Based Heat Generation Systems in Ind ia CPA

Number 008Thermax Susta inable Energy Solutions

Investment comparison analysisPromotion of Biomass Based Heat Generation Systems in Ind ia CPA

Number 005Thermax Susta inable Energy Solutions

Investment comparison analysisPromotion of Biomass Based Heat Generation Systems in Ind ia CPA

Number 009Thermax Susta inable Energy Solutions

Investment comparison analysisPromotion of Biomass Based Heat Generation Systems in Ind ia CPA

Number 010Thermax Susta inable Energy Solutions

Biomass boi ler using rice and mustard husk

Investment comparison analysisPromotion of Biomass Based Heat Generation Systems in Ind ia CPA

Number 012Thermax Susta inable Energy Solutions

Investment comparison analysis

Promotion of Biomass Based Heat Generation Systems in Ind ia CPA Number 013

Thermax Susta inable Energy Solutions

Investment comparison analysisPromotion of Biomass Based Heat Generation Systems in Ind ia CPA

Number 014Thermax Susta inable Energy Solutions

Biomass boi ler using rice husk and bagasse

Investment comparison analysisPromotion of Biomass Based Heat Generation Systems in Ind ia CPA

Number 015Thermax Susta inable Energy Solutions

Investment comparison analysis

Promotion of Biomass Based Heat Generation Systems in Ind ia CPA Number 016

Thermax Susta inable Energy Solutions

Investment comparison analysisPromotion of Biomass Based Heat Generation Systems in Ind ia CPA

Number 017Thermax Susta inable Energy Solutions

Biomass boi ler using rice husk and bagasse

Investment comparison analysisPromotion of Biomass Based Heat Generation Systems in Ind ia CPA

Number 018Thermax Susta inable Energy Solutions

Investment comparison analysisPromotion of Biomass Based Heat Generation Systems in Ind ia CPA

Number 019Thermax Susta inable Energy Solutions

Investment comparison analysisPromotion of Biomass Based Heat Generation Systems in Ind ia” (CPA

Number 020).Thermax Susta inable Energy Solutions

Simple cost analysis

Promotion of Biomass Based Heat Generation Systems in Ind ia” (CPA Number 021)

Thermax Susta inable Energy Solutions

Simple cost analysis

Promotion of Biomass Based Heat Generation Systems in Ind ia” (CPA Number 022)

Thermax Susta inable Energy Solutions

Biomass boi ler using rice husk at two separate sites

Simple cost analysis

Promotion of Biomass Based Heat Generation Systems in Ind ia” (CPA Number 023)

Thermax Susta inable Energy Solutions

Biomass boi ler using rice husk at two separate sites

Simple cost analysis

Promotion of Biomass Based Heat Generation Systems in Ind ia” (CPA Number 025)

Thermax Susta inable Energy Solutions

Biomass boi ler using rice husk at two separate sites

Simple cost analysis

Promotion of Biomass Based Heat Generation Systems in Ind ia” (CPA Number 024)

Thermax Susta inable Energy Solutions

Biomass boi ler using rice husk, cotton ta lk and mustard stalk

Simple cost analysis

Promotion of Biomass Based Heat Generation Systems in Ind ia” (CPA Number 026)

Thermax Susta inable Energy Solutions

Biomass boi ler using biomass briquettes

Simple cost analysis

Promotion of Biomass Based Heat Generation Systems in Ind ia” (CPA Number 027)

Thermax Susta inable Energy Solutions

Biomass boi ler using biomass briquettes

Simple cost analysis

Promotion of Biomass Based Heat Generation Systems in Ind ia” (CPA Number 028)

Thermax Susta inable Energy Solutions

Simple cost analysis

Promotion of Biomass Based Heat Generation Systems in Ind ia” (CPA Number 032)

Thermax Susta inable Energy Solutions

Biomass boi ler using briquettes from agricultural residues

Simple cost analysis

Promotion of Biomass Based Heat Generation Systems in Ind ia” (CPA Number 034)

Thermax Susta inable Energy Solutions

Biomass boi ler using briquettes from agricultural residues

Simple cost analysis

Promotion of Biomass Based Heat Generation Systems in Ind ia” (CPA Number 029)

Thermax Susta inable Energy Solutions

Biomass boi ler using briquettes from agricultural residues

Simple cost analysis

“Promotion of Biomass Based Heat Generation Systems in Ind ia” (CPA Number 030)

Thermax Susta inable Energy Solutions

Biomass boi ler using briquettes from agricultural residues

Simple cost analysis

JPMorgan Ventures Energy Corporation

Dissemination of efficientcooking stoves in BangladeshJPMorgan Ventures Energy

CorporationDissemination of 38167 improved cooking stoves

Financial ;Other;Prevail ing practice;Technological

JPMorgan Ventures Energy Corporation

Financial ;Other;Prevail ing practice;TechnologicalJPMorgan Ventures Energy

CorporationFinancial ;Other;Prevail ing practice;TechnologicalJPMorgan Ventures Energy

CorporationFinancial ;Other;Prevail ing practice;TechnologicalJPMorgan Ventures Energy

CorporationFinancial ;Other;Prevail ing practice;TechnologicalJPMorgan Ventures Energy

CorporationFinancial ;Other;Prevail ing practice;Technological

JPMorgan Ventures Energy Corporation

Financial ;Other;Prevail ing practice;TechnologicalJPMorgan Ventures Energy

CorporationFinancial ;Other;Prevail ing practice;TechnologicalJPMorgan Ventures Energy

CorporationFinancial ;Other;Prevail ing practice;Technological

JPMorgan Ventures Energy Corporation

Financial ;Other;Prevail ing practice;TechnologicalJPMorgan Ventures Energy

CorporationFinancial ;Other;Prevail ing practice;TechnologicalImproved Cooking S toves in Bangladesh – CPA No.12 “SZ Consultancy

Services Ltd.”JPMorgan Ventures Energy Corporation

Financial ;Other;Prevail ing practice;TechnologicalImproved Cooking S toves in Bangladesh – CPA No.13 “SZ Consultancy

Services Ltd.”JPMorgan Ventures Energy Corporation

Financial ;Other;Prevail ing practice;TechnologicalImproved Cooking S toves in Bangladesh – CPA No.14 “SZ Consultancy

Services Ltd.”JPMorgan Ventures Energy Corporation

Financial ;Other;Prevail ing practice;Technological

Improved Cooking S toves in Bangladesh – CPA No.15 “SZ Consultancy Services Ltd.”

JPMorgan Ventures Energy Corporation

Financial ;Other;Prevail ing practice;TechnologicalImproved Cooking S toves in Bangladesh – CPA No.16 “SZ Consultancy

Services Ltd.”JPMorgan Ventures Energy Corporation

Financial ;Other;Prevail ing practice;TechnologicalImproved Cooking S toves in Bangladesh – CPA No.17 “SZ Consultancy

Services Ltd.”JPMorgan Ventures Energy Corporation

Financial ;Other;Prevail ing practice;Technological

Improved Cooking S toves in Bangladesh – CPA No.18 “SZ Consultancy Services Ltd.”

JPMorgan Ventures Energy Corporation

Financial ;Other;Prevail ing practice;TechnologicalImproved Cooking S toves in Bangladesh – CPA No.19 “SZ Consultancy

Services Ltd.”JPMorgan Ventures Energy Corporation

Financial ;Other;Prevail ing practice;TechnologicalJPMorgan Ventures Energy

CorporationIntroducing large-scale adoption of heat retention cooking toJPMorgan Ventures Energy

CorporationInvestment;Other;Prevail ing practice;Technological

To support the enforcement of Traffic Law #121 (2008),4 thereby improving air quali ty, reducing greenhouse gas emiss ions, and improving overal l road safety in Egypt

Denmark (Danish Min istry o f Cl imate & Energy), Norway (Norwegian Min istry o f Finance), Spain (Government of Spain), Sweden (Government of Sweden)

Moni tored scrapping and recycling of old vehicles in exchange for financia l incentives

Denmark (Danish Min istry o f Cl imate & Energy), Norway (Norwegian Min istry o f Finance), Spain (Government of Spain), Sweden (Government of Sweden)

Greater Cairo Region Taxi Scrapping and Recycling Pro ject (22 Apri l 2009 to 30 November 2010)

Moni tored scrapping and recycling of old vehicles in exchange for financia l incentivesGreater Cairo Region Taxi Scrapping and Recycling Pro ject (01 December

2010 to 29 November 2012)Moni tored scrapping and recycling of old vehicles in exchange for financia l incentivesBeij ing Hebaiyi Ecolog ical

Energy Development Co.To to reduce CO2 emissions from coal used in cooking and methane emissions from swine manure management by

Yueyang, Changde and Zhangj iaj ie municipa lities in Hunan

Beij ing Hebaiyi Ecolog ical Energy Development Co.

Small -scale biogas digesters in 30,000households

Investment;Prevailing practice;Technological

To improve the supply side energy efficiency of the grid by rep lacing in advance the basel ine transformers wi th over 150,000 project transformers and to

SGCC In-advance Distribution Transformer Replacement CDM Programme CPA-001

In-advance replacements of 1,100 transformers

SGCC In-advance Distribution Transformer Replacement CDM Programme CPA-002

In-advance replacements of 8,662 transformers

SGCC In-advance Distribution Transformer Replacement CDM Programme CPA-003

In-advance replacements of 9,289 transformers

SGCC In-advance Distribution Transformer Replacement CDM Programme CPA-004

In-advance replacements of 9,570 transformers

Energy Efficiency Measures Uti lising Waste Heat in Vapour Absorption Machine (VAM)

Thermax Susta inable Energy Solutions

To reduce GHG emissions by install ing waste heat fi red vapourabsorption machine for the process requirement

Energy Efficiency Measures Uti lising Waste Heat in Vapour Absorption Machine (VAM) CPA Number 001

Thermax Susta inable Energy Solutions

Utilising Waste Heat in Vapour Absorption Machine

Prevai ling practice;Technological

Public Electricity Corporation of Yemen

To improve the quality of supply and technical e fficiency of the electricity sector of Yemen

WB-CF, Publ ic Electrici ty Corporation of Y emenPublic Electricity Corporation of

YemenReplacing transmission lines and upgrading of distribution feeder cables

WB-CF, Publ ic Electrici ty Corporation of Y emenEnergy Research and

Development Institute of Chiang Mai Universi ty (ERDI)

To improve the livestock waste management practice, reduce GHG emiss ions, and take advantage of the captured renewable energy of l ivestock

Energy Research and Development Institute of Chiang Mai Universi ty (ERDI)

Flow closed anaerobic treatment digesters wi th b iogas capture and power generation

Investment;TechnologicalEnergy Research and

Development Institute of Chiang Mai Universi ty (ERDI)

Flow closed anaerobic treatment digesters wi th b iogas capture and power generation

Investment;TechnologicalEnergy Research and

Development Institute of Chiang Mai Universi ty (ERDI)

Flow closed anaerobic treatment digesters wi th b iogas capture and power generation

Investment;TechnologicalComposting Program

International (PT.CPI)To develop a p latform for supporting the developmentof composting and co-composting plants in Indonesia in order to reduce organic waste and associated

Fetty Mina Jaya Co-composting – Under PoA Composting and Co-composting Programme of Activi ties (PoA) in Indonesia

Composting Program International (PT.CPI)

Diverting the EFBs and POME to a contro lled aerobic composting p lant

Benchmark analysis

Hydro Program International (PT. HPI)

To develop a p latform for supporting thedevelopment of sustainable smal l hydropower pro jects in IndonesiaHydro Program International

(PT. HPI)Financial ;P revai ling practice

Benchmark analysisTerai, Hil l and

Mounta in reg ionsAlternative Energy Promotion Centre (A EPC)

Climate Focus, Alternative Energy Promotion CenterAlternative Energy Promotion

Centre (A EPC)Climate Focus, Alternative Energy Promotion Center

Simple cost analysisAlternative Energy Promotion

Centre (A EPC)Climate Focus, Alternative Energy Promotion Center

Simple cost analysisAlternative Energy Promotion

Centre (A EPC)Climate Focus, Alternative Energy Promotion Center

Simple cost analysisTerai, Hil l and

Mounta in reg ionsAlternative Energy Promotion Centre (A EPC)

Climate Focus, Alternative Energy Promotion Center

Simple cost analysisAlternative Energy Promotion

Centre (A EPC)Climate Focus, Alternative Energy Promotion Center

Simple cost analysisAlternative Energy Promotion

Centre (A EPC)Climate Focus, Alternative Energy Promotion Center

Simple cost analysisAlternative Energy Promotion

Centre (A EPC)Climate Focus, Alternative Energy Promotion Center

Simple cost analysisAlternative Energy Promotion

Centre (A EPC)Climate Focus, Alternative Energy Promotion Center

Simple cost analysisTo reduce greenhouse gases that are

released to the atmosphere by dumping of organic waste2010 pro ject activi ty KIPRAH Communi ty-based Integrated Solid Waste

ManagementInvestment;Other;Technological

Vietnam PoA Carbon Management Joint Stock Company (Vietnam PoA JSC)

To develop a p latform for supporting the developmentof small hydropower projects in Viet Nam. Benchmark

analysisPacific lowlands of western Nicaragua

To plant 15,000 hectares of mul ti -species tropical forest plantations in Nicaragua over the next five years

Futuro Forestal Nicaragua; Cosigüina, Nandaime and Sauce Reforestation Project

Chinandega, León, Granada, Carazo

Reforestation with teak and native species for sustainable commercial forestry

Investment;Prevailing practice;Technological

Methane recovery and combustion wi th renewable energy generation from anaerobic an imal manure management systems under Land Bank of the Phi lippines Carbon Finance Support Facil ity

Land Bank of the Phi lippines (LBP)

To introduce wastewater methane recovery systems in piggeries that are using open anaerobic systems to treat thei r wastewater

Spain (IBRD), Norway (Norwegian Min istry of Finance)

CPA-1: Methane recovery and combustion wi th renewable energy generation from anaerobic an imal manure management systems under Land Bank of the Phi lippines‘ (LBP) Carbon Finance Support Facili ty

Anaerobic digestion system wi th methane recovery and combustion

Spain (IBRD), Norway (Norwegian Min istry of Finance)

Financial ;P revai ling practice;Technological

CPA-2: Methane recovery and combustion wi th renewable energy generation from anaerobic an imal manure management systems under the Land Bank of the Phil ipp ines’ (LBP) Carbon Finance Support Faci lity

Replaces anaerobic manure management system with anaerobic digestion system with methane recovery and combustion.

Financial ;P revai ling practice;Technological

CPA-10. Methane recovery and combustion with renewable energy generation from anaerobic an imal manure management systems under the Land Bank of the Philippines’ (LBP) Carbon Finance Support Facili ty

Replaces anaerobic manure management system with anaerobic digestion system with methane recovery and combustion.

CPA-3. Methane recovery and combustion wi th renewable energy generation from anaerobic an imal manure management systems under the Land Bank of the Phil ipp ines’ (LBP) Carbon Finance Support Faci lity

Replaces anaerobic manure management system with anaerobic digestion system with methane recovery and combustion.

CPA-19. Methane recovery and combustion with renewable energy generation from anaerobic an imal manure management systems under the Land Bank of the Philippines’ (LBP) Carbon Finance Support Facili ty

CamarinesSur

Replaces anaerobic manure management system with anaerobic digestion system with methane recovery and combustion.

CPA-20. Methane recovery and combustion with renewable energy generation from anaerobic an imal manure management systems under the Land Bank of the Philippines’ (LBP) Carbon Finance Support Facili ty

Replaces anaerobic manure management system with anaerobic digestion system with methane recovery and combustion.

CPA-21. Methane recovery and combustion with renewable energy generation from anaerobic an imal manure management systems under the Land Bank of the Philippines’ (LBP) Carbon Finance Support Facili ty

Replaces anaerobic manure management system with anaerobic digestion system with methane recovery and combustion.

CPA-22. Methane recovery and combustion with renewable energy generation from anaerobic an imal manure management systems under the Land Bank of the Philippines’ (LBP) Carbon Finance Support Facili ty

Replaces anaerobic manure management system with anaerobic digestion system with methane recovery and combustion.

CPA-23. Methane recovery and combustion with renewable energy generation from anaerobic an imal manure management systems under the Land Bank of the Philippines’ (LBP) Carbon Finance Support Facili ty

Replaces anaerobic manure management system with anaerobic digestion system with methane recovery and combustion.

CPA-24. Methane recovery and combustion with renewable energy generation from anaerobic an imal manure management systems under the Land Bank of the Philippines’ (LBP) Carbon Finance Support Facili ty

Replaces anaerobic manure management system with anaerobic digestion system with methane recovery and combustion.

CPA-28. Methane recovery and combustion with renewable energy generation from anaerobic an imal manure management systems under the Land Bank of the Philippines’ (LBP) Carbon Finance Support Facili ty

Replaces anaerobic manure management system with anaerobic digestion system with methane recovery and combustion.

CPA-29. Methane recovery and combustion with renewable energy generation from anaerobic an imal manure management systems under the Land Bank of the Philippines’ (LBP) Carbon Finance Support Facili ty

Replaces anaerobic manure management system with anaerobic digestion system with methane recovery and combustion.

CPA-11. Methane recovery and combustion with renewable energy generation from anaerobic an imal manure management systems under the Land Bank of the Philippines’ (LBP) Carbon Finance Support Facili ty

Replaces anaerobic manure management system with anaerobic digestion system with methane recovery and combustion.

CPA-12. Methane recovery and combustion with renewable energy generation from anaerobic an imal manure management systems under the Land Bank of the Philippines’ (LBP) Carbon Finance Support Facili ty

Replaces anaerobic manure management system with anaerobic digestion system with methane recovery and combustion.

CPA-27. Methane recovery and combustion with renewable energy generation from anaerobic an imal manure management systems under the Land Bank of the Philippines’ (LBP) Carbon Finance Support Facili ty

Replaces anaerobic manure management system with anaerobic digestion system with methane recovery and combustion.

CPA-34. Methane recovery and combustion with renewable energy generation from anaerobic an imal manure management systems under the Land Banks of the Philippines’ (LBP) Carbon Finance Support Facili ty

Replaces anaerobic manure management system with anaerobic digestion system with methane recovery and combustion.

CPA-42. Methane recovery and combustion with renewable energy generation from anaerobic an imal manure management systems under the Land Bank of the Philippines’ (LBP) Carbon Finance Support Facili ty

Replaces anaerobic manure management system with anaerobic digestion system with methane recovery and combustion.

CPA-47. Methane recovery and combustion with renewable energy generation from anaerobic an imal manure management systems under the Land Bank of the Philippines’ (LBP) Carbon Finance Support Facili ty

Replaces anaerobic manure management system with anaerobic digestion system with methane recovery and combustion.

Punjab State Electricity Board: High Vol tage Distribution System for Agricultura l Consumers in the Rura l Areas of the Punjab

Punjab State Electricity Board (PSEB)

To reduce energy loss in the electricity distribution system for the agricul ture sector and hence to increase the amount of avai lab le energy in the State

Punjab State Electricity Board: High Vol tage Distribution System for Agricultura l consumers in the Rural Areas of Punjab, CPA – 1

Punjab State Electricity Board (PSEB)

Upgrading the existing 3-phase 400V Low Voltage Distribution System (LVDS) wi th an 11kV HVDS

Benchmark analysis

Punjab State Electricity Board: High Vol tage Distribution System for Agricultura l consumers in the Rural Areas of the Punjab, CPA – 02

Punjab State Electricity Board (PSEB)

Upgrading the existing 3-phase 400V Low Voltage Distribution System (LVDS) wi th an 11kV HVDS

Benchmark analysis

Punjab State Electricity Board: High Vol tage Distribution System for Agricultura l consumers in the Rural Areas of the Punjab, CPA – 03

Punjab State Electricity Board (PSEB)

Upgrading the existing 3-phase 400V Low Voltage Distribution System (LVDS) wi th an 11kV HVDS

Benchmark analysis

Punjab State Electricity Board: High Vol tage Distribution System for Agricultura l consumers in the Rural Areas of the Punjab, CPA – 04

Punjab State Electricity Board (PSEB)

Upgrading the existing 3-phase 400V Low Voltage Distribution System (LVDS) wi th an 11kV HVDS

Benchmark analysis

Demand Side Management (DSM) for accelerationg the d iffusion of energy-efficient ch iller technology

To accelarate the di ffusion of EE chil ler technology in India

CPA 1 - Demand Side Management (DSM) for accelerationg the di ffusion of energy-efficient chil ler technology

Infrastructure Development Company

To remove barriers to the large scale use of CFLs by distributing 28 mill ion CFLs and col lecting equivalent amount of ICLs from about 12 mil lion households in

In frastructure Development Company

Exchange of 810,000 incandescent lamps (ICLs) with compact fluorescent lamps (CFLs)

In frastructure Development Company

Col lection and destruction of 906,250 incandescent lamps (ICLs) and subsequent replacement o f equal amount of compact flourescent lamps (CFLs)

In frastructure Development Company

Col lection and destruction of 906,250 incandescent lamps (ICLs) and subsequent replacement o f equal amount of compact flourescent lamps (CFLs)

In frastructure Development Company

Col lection and destruction of 906,250 incandescent lamps (ICLs) and subsequent replacement o f equal amount of compact flourescent lamps (CFLs)

In frastructure Development Company

Col lection and destruction of 906,250 incandescent lamps (ICLs) and subsequent replacement o f equal amount of compact flourescent lamps (CFLs)

In frastructure Development Company

Col lection and destruction of 906,250 incandescent lamps (ICLs) and subsequent replacement o f equal amount of compact flourescent lamps (CFLs)

In frastructure Development Company

Col lection and destruction of 906,250 incandescent lamps (ICLs) and subsequent replacement o f equal amount of compact flourescent lamps (CFLs)

In frastructure Development Company

Col lection and destruction of 906,250 incandescent lamps (ICLs) and subsequent replacement o f equal amount of compact flourescent lamps (CFLs)

Q4
This column subdivide the type into Resources, technology or subsectors
U4
Average over 7/10 years or 20/30 years.
V4
Average over 2 nd 7 years or 2nd 20 years.
AA4
If the expected GHG reductions change over the first 7 or 10 years, the increase is approximated with a line with the slope in this collumn (Unit ktCO2/yr). If negative reductions decrease over time.
AL4
This is defined as the CERs issued devided by the number of CERs expected in the PDD for the same period
BA4
Correction 1: The project had a request for corrections after a request fro review. Correction 2: The project had a Request for correction after a review
BF4
Marco Christian Schletz: 1 -Air 2 - Land 3 - Water 4- Natural resources 5 - Jobs 6 - Heatlth and safety 7 - Education 8 - Welfare 9 - Growth 10 - Energy 11 - Tchnology Transfer 12 - Balance of Payments
BS4
The total MW installed at the end of 2012
BU4
=Wom*OM+Wbm*BM
BY4
Foik = First of its kind Plist= Positive List MSC = Micro Scale SUZ=Special Underdeveloped Zone DNA = Recommended by a DNA and approved by EB

261CPA0031.09 4793-0009 Efficient Lighting Initiative of Bangladesh (ELIB): Chittagong - REB- CPA # 9 Asia & Pacific Southern Asia Bangladesh Chittagong Registered EE households EE households Lighting AMS-II.J. 1 13.4 10 6 -3.8 1-Sep-14 0.000 133.510 TÜV-SÜD WB-CF 29-Dec-09 30-Nov-13 30-Dec-99 10 9 8 5 7 0 0.670 Yes Financial 28.415 25.950 23.484 21.019 18.553 16.087 0.000 0.000 0.000 0.000

262PoA0032 RYITC6B13PQ3BA4Q841GUJFNTOMR0N Solar Water Heater Program in India Asia & Pacific Southern Asia India India Neutech Solar Systems Validation Terminated Solar Solar Solar water heating AMS-I.C. 1 59.7 1-Dec-07 28 149.370 597.480 TÜV-SÜD 0.000 Netherlands (Mabanaft) Climate Focus 29-Dec-09 30-Dec-99CPA 4 12 1 5 9 11 0.0 0.670 Financial

263CPA0032.01 Solar Water Heater Program in India- “CPA 1” Asia & Pacific Southern Asia India India Neutech Solar Systems Validation Terminated Solar Solar Solar water heating Solar Water Heataers AMS-I.C. 1 59.7 10 15 0.0 1-Jul-10 149.370 597.480 TÜV-SÜD Netherlands (Mabanaft) Climate Focus 29-Dec-09 30-Dec-99 4 12 1 5 9 11 0 0.810 No 29.874 59.748 59.748 59.748 59.748 59.748 59.748 59.748 59.748 59.748 29.874

264PoA0033 2WI373KQPBX3HHZVL1K39W9CFO8OJQ 8521 Distribution of ONIL Stoves—Mexico Latin America North America Mexico Mexico Helps International Registered EE households EE households Stoves AMS-II.G. 1 40.1 30-Dec-09 28 0.000 320.390 TÜV-SÜD 0.000 19.050 19.050 1 10-Dec-14 31-Dec-13 Netherlands (C-Quest Capital) EnergetixClimate 30-Dec-09 31-Aug-11 3-Dec-12 19-Jan-13 7-Dec-12 PoA 30-Dec-99CPA 4 1 6 8 9 7 0.0 Plist

265CPA0033.01 8521-0001 Distribution of ONIL Stoves —Mexico, San Felipe Usila 1 Latin America North America Mexico Oaxaca Helps International Registered EE households EE households Stoves AMS-II.G. 1 40.1 7 7 0.0 5-Jan-13 0.000 320.390 TÜV-SÜD 0.000 19.050 19.050 1 10-Dec-14 31-Dec-13 Netherlands (C-Quest Capital) EnergetixClimate 30-Dec-09 7-Dec-12 30-Dec-99 4 1 6 8 9 7 -5 No Plist 2.500 2.500 2.500 2.500 2.500 2.500 2.500 2.500 2.500 2.500 2.500 2.500 2.500 2.500 2.500 2.500 2.500 2.500 2.500 2.500 2.500

266PoA0034 PX3DLROQVMMON45T0ZHHBM4DKLSCZJ 8390 Asia & Pacific East Asia China Registered Methane avoidance Methane avoidance Domestic manure AMS-I.C. 1 0.5 1-Jul-07 28 0.000 4.650 TÜV-SÜD 0.000 United K. (Gazprom Marketing & Trading) 30-Dec-09 1-Jul-10 31-Dec-12 25-Jun-13 31-Dec-12 PoA 31-Dec-99PoA 1 6 8 5 9 11 0.0 Plist

267CPA0034.01 8390-0001 Asia & Pacific East Asia China Registered Methane avoidance Methane avoidance Domestic manure AMS-I.C. 1 0.5 10 10 0.0 1-Jan-13 0.000 4.650 TÜV-SÜD United K. (Gazprom Marketing & Trading) 30-Dec-09 31-Dec-12 30-Dec-99 1 6 8 5 9 11 0 No Plist 0.465 0.465 0.465 0.465 0.465 0.465 0.465 0.465 0.465 0.465

268PoA0035 KH28I19T150Y33MLEEG3GWME4168BO 6810 Vietnam Renewable Energy Development Program (REDP) Asia & Pacific Southeast Asia Vietnam Vietnam Registered Hybrid renewables Hybrid renewables Run of river ACM2 18 517.8 25-Sep-12 28 0.000 2,364.715 AENOR 0.000 427.239 427.239 1 13-Jan-15 31-Dec-16 TÜV-Nord 30-Dec-09 10-Feb-11 19-Dec-12 19-Dec-12 CPA 30-Dec-99CPA 12 1 5 9 6 3 220.5

269CPA0035.01 6810-0001 Asia & Pacific Southeast Asia Vietnam Lao Cai Registered Hydro Hydro Run of river 18 MW run of river hydropower plant ACM2 2 30.2 7 30 0.0 1-Jan-13 0.000 241.323 AENOR 140.592 140.592 3 13-Jan-15 31-Dec-16 TÜV-Nord 30-Dec-09 19-Dec-12 30-Dec-99 12 1 5 9 6 3 0 18.0 53246 0.576 No Financial;Other 3 30.116 30.116 30.116 30.116 30.116 30.116 30.116

270CPA0035.02 6810-0002 CPA3_Pa Chien Hydropower Project. Asia & Pacific Southeast Asia Vietnam Son La Registered Hydro Hydro Run of river 22MW run of river hydropower plant ACM2 2 48.1 7 30 0.0 10-Jun-14 0.000 315.878 AENOR 80.006 80.006 2 15-Jul-16 31-Dec-16 TÜV-Nord 30-Dec-09 10-Jun-14 30-Dec-99 12 1 5 9 6 3 0 22.0 82750 0.587 No Financial;Other 3 28.070 48.120 48.120 48.120 48.120 48.120 48.120 20.050

271CPA0035.03 6810-0003 CPA2_Nam Tha 4 Hydropower Project Asia & Pacific Southeast Asia Vietnam Lao Cai Registered Hydro Hydro Run of river 11.5MW run of river hydropower plant ACM2 2 26.9 7 30 0.0 1-Nov-14 0.000 166.167 AENOR 78.762 78.762 2 15-Jul-16 31-Dec-16 TÜV-Nord 30-Dec-09 26-Nov-14 30-Dec-99 12 1 5 9 6 3 0 11.5 45852 0.587 No Financial;Other 3 4.489 26.932 26.932 26.932 26.932 26.932 26.932 22.443

272CPA0035.04 6810-0004 CPA4_Song Rieng Hydropower Project. Asia & Pacific Southeast Asia Vietnam Quang Ngai Registered Hydro Hydro Run of river 3.75MW run of river hydropower plant ACM2 2 8.2 7 30 0.0 1-Nov-14 0.000 50.618 AENOR 16.163 16.163 2 15-Jul-16 31-Dec-16 TÜV-Nord 30-Dec-09 26-Nov-14 30-Dec-99 12 1 5 9 6 3 0 3.8 14006 0.587 No Financial;Other 3 1.367 8.204 8.227 8.227 8.227 8.227 8.227 6.856

273CPA0035.05 6810-0005 CPA5_ Hoa Phu Hydropower Project. Asia & Pacific Southeast Asia Vietnam Dak Nong Registered Hydro Hydro Run of river 29MW run of river hydropower plant ACM2 2 77.1 7 30 0.0 1-Nov-14 0.000 475.388 AENOR 107.415 107.415 2 15-Jul-16 31-Dec-16 TÜV-Nord 30-Dec-09 26-Nov-14 30-Dec-99 12 1 5 9 6 3 0 29.0 131175 0.587 No Financial;Other 3 12.842 77.050 77.050 77.050 77.050 77.050 77.050 64.208

274CPA0035.06 6810-0006 CPA8_Trung Thu Hydropower Project Asia & Pacific Southeast Asia Vietnam Dien Bien Registered Hydro Hydro Run of river 30MW run of river hydropower plant ACM2 1 67.0 7 30 0.0 30-Sep-16 0.000 285.046 AENOR 3.260 3.260 30-Dec-09 31-Jul-15 30-Dec-99 12 1 5 9 6 3 0 30.0 124100 0.546 No Financial;Other 3 16.749 66.994 66.994 66.994 66.994 66.994 66.994 50.246

275CPA0035.07 6810-0007 CPA7_Bao Lam 1 Hydropower Project. Asia & Pacific Southeast Asia Vietnam Cao Bang Registered Hydro Hydro Run of river 30MW run of river hydropower plant ACM2 1 62.3 7 30 0.0 30-Nov-16 0.000 254.539 AENOR 0.000 30-Dec-09 31-Jul-15 30-Dec-99 12 1 5 9 6 3 0 30.0 115700 0.546 No Financial;Other 3 5.189 62.270 62.270 62.270 62.270 62.270 62.270 57.081

276CPA0035.08 6810-0008 CPA6_Ban Ang Hydropower Project Asia & Pacific Southeast Asia Vietnam Nghe An Registered Hydro Hydro Run of river 17MW run of river hydropower plant ACM2 1 37.1 7 30 0.0 1-Nov-16 0.000 154.429 AENOR 0.000 30-Dec-09 31-Jul-15 30-Dec-99 12 1 5 9 6 3 0 17.0 68510 0.546 No Financial;Other 3 6.177 37.059 37.059 37.059 37.059 37.059 37.059 30.883

277CPA0035.09 6810-0009 CPA9_Bai Thuong Hydropower Project Asia & Pacific Southeast Asia Vietnam Thanh Hoa Registered Hydro Hydro Run of river 6MW run of river hydropower plant ACM2 1 13.3 7 30 0.0 15-Nov-16 0.000 54.937 AENOR 1.041 1.041 12-Jan-18 31-Dec-16 TÜV-Nord 30-Dec-09 11-Sep-15 30-Dec-99 12 1 5 9 6 3 0 6.0 24353 0.546 No Financial;Other 3 1.663 13.306 13.306 13.306 13.306 13.306 13.306 11.643

278CPA0035.10 6810-0010 CPA10_Than Giap Hydropower Project Asia & Pacific Southeast Asia Vietnam Than Giap Registered Hydro Hydro Run of river 6MW run of river hydropower plant ACM2 1 14.5 7 30 0.0 1-Jan-18 0.000 43.566 AENOR 30-Dec-09 28-Sep-17 31-Dec-99 12 1 5 9 6 3 0 6.0 21275 0.683 No Financial;Other 3 14.522 14.522 14.522 14.522 14.522 14.522 14.522

279CPA0035.11 6810-0011 CPA11_Muong Khuong Hydropower Project Asia & Pacific Southeast Asia Vietnam Muong Khuong Registered Hydro Hydro Run of river 8.2MW run of river hydropower plant ACM2 1 25.5 7 30 0.0 1-Aug-18 0.000 61.713 AENOR 30-Dec-09 28-Sep-17 31-Dec-99 12 1 5 9 6 3 0 8.2 37371 0.683 No Financial;Other 3 10.629 25.510 25.510 25.510 25.510 25.510 25.510 14.881

280CPA0035.12 6810-0012 CPA12_Muong Hung Hydropower Project Asia & Pacific Southeast Asia Vietnam Muong Hung Registered Hydro Hydro Run of river 24MW run of river hydropower plant ACM2 1 63.2 7 30 0.0 1-Oct-18 0.000 142.391 AENOR 30-Dec-09 28-Sep-17 31-Dec-99 12 1 5 9 6 3 0 24.0 92624 0.683 No Financial;Other 3 15.807 63.227 63.227 63.227 63.227 63.227 63.227 47.420

281CPA0035.13 6810-0013 CPA13_Xuan Minh Hydropower Project Asia & Pacific Southeast Asia Vietnam Xuan Minh Registered Hydro Hydro Run of river 15MW run of river hydropower plant ACM2 1 44.4 7 30 0.0 1-May-18 0.000 118.720 AENOR 30-Dec-09 28-Sep-17 31-Dec-99 12 1 5 9 6 3 0 15.0 65109 0.683 No Financial;Other 3 29.629 44.444 44.444 44.444 44.444 44.444 44.444 14.815

282PoA0036 WF7W47MLD9F0Y2AFTRY9A41JVLCPJB 8480 Distribution of ONIL Stoves—Guatemala Latin America Central America Guatemala Guatemala Helps International Registered EE households EE households Stoves AMS-II.G. 2 85.5 11-Jan-10 28 0.000 498.628 TÜV-SÜD 0.000 Netherlands (C-Quest Capital) EnergetixClimate 30-Dec-09 29-Aug-11 18-Dec-12 19-Dec-12 PoA 30-Dec-99CPA 4 9 8 11 6 7 0.0 Plist

283CPA0036.01 8480-0001 ONIL Stoves —Guatemala - Uspantán Latin America Central America Guatemala Quiché Helps International Registered EE households EE households Stoves Installation of 751 ONIL Stoves AMS-II.G. 1 42.8 7 7 0.0 19-Jan-13 0.000 340.192 TÜV-SÜD Netherlands (C-Quest Capital) EnergetixClimate 30-Dec-09 19-Dec-12 30-Dec-99 4 9 8 11 6 7 -2 180.0 No Plist 2.261 2.261 2.261 2.261 2.261 2.261 2.261 2.261 2.261 2.261 2.261 2.261 2.261 2.261 2.261 2.261 2.261 2.261 2.261 2.261 2.261

284CPA0036.02 8480-0002 ONIL Stoves —Guatemala – CPA 002 Latin America Central America Guatemala Guatamala Helps International Registered EE households EE households Stoves Installation of 11148 ONIL Stoves AMS-II.G. 1 42.8 7 7 0.0 19-Apr-17 0.000 158.436 TÜV-SÜD Netherlands (C-Quest Capital) C-Quest Capital 30-Dec-09 19-Apr-17 30-Dec-99 4 9 8 11 6 7 -2 180.0 No Plist 2.261 2.261 2.261 2.261 2.261 2.261 2.261 2.261 2.261 2.261 2.261 2.261 2.261 2.261 2.261 2.261 2.261 2.261 2.261 2.261 2.261

285PoA0037 005JRIZUHLT62OZXHGKUIKNXL8O45D Asia & Pacific East Asia China At Validation Methane avoidance Methane avoidance Domestic manure AMS-I.C. 1 4.1 1-Jan-08 28 8.270 41.350 TÜV-SÜD 0.000 United K. (Gazprom Marketing & Trading) 30-Dec-09 PoA 31-Dec-99PoA 1 6 8 9 5 11 0.0

286CPA0037.01 Asia & Pacific East Asia China At Validation Methane avoidance Methane avoidance Domestic manure AMS-I.C. 1 4.1 10 10 0.0 1-Jan-11 8.270 41.350 TÜV-SÜD United K. (Gazprom Marketing & Trading) 30-Dec-09 30-Dec-99 1 6 8 9 5 11 -2 No 4.135 4.135 4.135 4.135 4.135 4.135 4.135 4.135 4.135 4.135

287PoA0038 GTBFSFMNVZXMQFMLW7KYE9J2PE08ED Rajasthan Urban Solid Waste Composting Program, India Asia & Pacific Southern Asia India Rajasthan At Validation Landfill gas Landfill gas Landfill composting AMS-III.F. 1 3.7 3-Sep-07 28 8.743 39.600 TÜV-Rhein 0.000 n.a. ADB CDM Facility 31-Dec-09 CPA 31-Dec-99CPA 5 6 9 3 1 11 0.0

288CPA0038.01 Asia & Pacific Southern Asia India Alwar city At Validation Landfill gas Landfill gas Landfill composting AMS-III.F. 1 3.7 7 30 1.0 1-May-10 8.743 39.600 TÜV-Rhein n.a. ADB CDM Facility 31-Dec-09 30-Dec-99 5 6 9 3 1 11 0 No 9.380 1.971 2.934 3.832 4.668 5.448 6.176 6.176 6.176 6.176 6.176 6.176 6.176 6.176 6.176 6.176 6.176 6.176 6.176 6.176 6.176

289PoA0039 FYHTWZ3QLWM91NKR9DB47YIHGQ5KSU 5816 Vietnam National Biogas Programme Asia & Pacific Southeast Asia Vietnam Viet Nam Registered Methane avoidance Methane avoidance Domestic manure AMS-I.C. 1 28.5 22-Jun-07 28 134.535 313.161 TÜV-Rhein 0.000 n.a. ADB CDM Facility 31-Dec-09 15-Feb-12 17-Feb-12 11-Jan-13 PoA 30-Dec-99PoA 8 12 5 2 1 6 0.0

290CPA0039.01 5816-0001 Vietnam National Biogas Program (PoA) – North-East zone (CPA1) Asia & Pacific Southeast Asia Vietnam MARD Registered Methane avoidance Methane avoidance Domestic manure Domestic biogas digesters AMS-I.C. 1 28.5 7 20 0.0 1-Jan-10 134.535 313.161 TÜV-Rhein n.a. ADB CDM Facility 31-Dec-09 11-Jan-13 30-Dec-99 8 12 5 2 1 6 -2 Yes 44.845 44.845 44.845 44.845 44.845 44.845 44.845 44.845 44.845 44.845 44.845 44.845 44.845 44.845 44.845 44.845 44.845 44.845 44.845 44.845 44.845

291PoA0040 8VZ9ESO6M7057RIZMA19PEPVJWXZCA Asia & Pacific East Asia China Chongqing At Validation Methane avoidance Methane avoidance Domestic manure AMS-III.R. 1 2.8 14-Mar-09 28 7.305 28.280 TÜV-SÜD 0.000 Japan (PEAR Carbon Offset Initiative) Climate Experts 1-Jan-10 CPA 30-Dec-99CPA 7 8 6 1 9 0.0

292CPA0040.01 Asia & Pacific East Asia China Kai County At Validation Methane avoidance Methane avoidance Domestic manure AMS-III.R. 1 2.8 10 20 0.0 1-May-10 7.305 28.280 TÜV-SÜD Japan (PEAR Carbon Offset Initiative) Climate Experts 1-Jan-10 30-Dec-99 7 8 6 1 9 0 Yes 2.828 2.828 2.828 2.828 2.828 2.828 2.828 2.828 2.828 2.828

293PoA0041 GLFOCKSJDNB17PMML7BFXH8YT66R55 South African Solar Water Heater (SWH) Programme Africa Southern Africa South Africa South Africa Unlimited Energy Resources Validation Terminated Solar Solar Solar water heating AMS-I.C. 1 7.6 20-Apr-09 28 20.919 76.070 TÜV-SÜD 0.000 Germany (KfW) Unlimited Energy Resources 19-Feb-10 PoA 30-Dec-99PoA 11 9 4 5 8 0.0

294CPA0041.01 Africa Southern Africa South Africa South Africa Unlimited Energy Resources Validation Terminated Solar Solar Solar water heating Solar Water Heaters AMS-I.C. 1 7.6 10 10 -0.2 1-Oct-10 20.919 76.070 TÜV-SÜD Germany (KfW) Unlimited Energy Resources 19-Feb-10 30-Dec-99 11 9 4 5 8 0 1.020 No 8.401 8.401 8.233 8.068 7.907 7.749 7.361 6.993 6.644 6.311

295PoA0042 CC3SL63S21H7EKTUKG004693GJ7T0E 5092 “Turbococinas”, rural cooking stove substitution program in El Salvador Latin America Central America El Salvador El Salvador Registered EE households EE households Stoves AMS-II.G. 1 46.6 9-Mar-10 28 55.155 465.840 AENOR 0.000 Switzerland (Soter) South Pole Carbon Asset Management 27-Feb-10 23-Oct-10 5-Aug-11 27-Aug-11 25-Oct-11 PoA 30-Dec-99PoA Gold Standard 1 6 8 9 4 11 0.0

296CPA0042.01 5092-0001 “Turbococinas”, rural cooking stove substitution program in El Salvador - CPA 1 Latin America Central America El Salvador La Libertad Registered EE households EE households Stoves Efficient sooking stoves AMS-II.G. 1 46.6 10 10 0.0 25-Oct-11 55.155 465.840 AENOR Switzerland (Soter) South Pole Carbon Asset Management 27-Feb-10 25-Oct-11 30-Dec-99 1 6 8 9 4 11 3 Spain 180.0 No 33.983 47.985 47.985 47.985 47.985 47.985 47.985 47.985 47.985 47.985

297PoA0043 UYS6BZUGD4PMRTD4M5GFA72GU8YZG0 Asia & Pacific Southeast Asia Singapore Singapore Climate Resources Exchange At Validation EE service EE service HVAC & lighting AMS-II.E. 1 3.0 15-Jul-10 28 0.960 29.640 BV Cert 0.000 n.a. n.a. 6-Apr-10 PoA 30-Dec-99PoA 1 4 9 0.0

298CPA0043.01 Asia & Pacific Southeast Asia Singapore Climate Resources Exchange At Validation EE service EE service HVAC & lighting AMS-II.E. 1 3.0 10 10 0.0 1-Jan-12 0.960 29.640 BV Cert n.a. n.a. 6-Apr-10 30-Dec-99 1 4 9 0 6.4 No Other;Prevailing practice 2.964 2.964 2.964 2.964 2.964 2.964 2.964 2.964 2.964 2.964

299PoA0044 Z95M9RDTVIEL6YN7RLYGEMO5JWS1AJ 6694 Manufacture and distribution of CFLs in India Asia & Pacific Southern Asia India India Balaji Greentech Products Registered EE households EE households Lighting AMS-II.C. 1 0.0 16-Apr-08 28 0.000 0.130 BV Cert 0.000 n.a. Balaji Greentech Products 10-Apr-10 28-Sep-10 12-Oct-12 14-Dec-12 15-Oct-12 CPA 30-Dec-99CPA 5 10 7 9 0.0

300CPA0044.01 6694-0001 Asia & Pacific Southern Asia India Andra Pradesh Balaji Greentech Products Registered EE households EE households Lighting CFLs AMS-II.C. 1 0.0 10 10 0.0 15-Oct-12 0.130 BV Cert n.a. Balaji Greentech Products 10-Apr-10 15-Oct-12 30-Dec-99 5 10 7 9 0 0.0 No 0.020 0.020 0.020 0.020 0.020 0.002 0.000 0.000 0.000 0.000

301PoA0045 QWJALQVOYC0C27VCTEOS60R4ZRN8L0 4302 SASSA Low Pressure Solar Water Heater Programme Africa Southern Africa South Africa South Africa Registered Solar Solar Solar water heating AMS-I.C. 7 325.8 29-Jan-11 28 166.262 3,258.350 JCI 48.976 50.194 99.170 3 26-Sep-14 31-Dec-12 United K. (Standard Bank) International Carbon 28-May-10 11-Nov-10 4-Mar-11 12-Mar-11 PoA 30-Dec-99PoA 10 9 5 8 7 0.0

302CPA0045.01 4302-0001 SASSA Low Pressure Solar Water Heater Programme – CPA- 001 Africa Southern Africa South Africa Registered Solar Solar Solar water heating AMS-I.C. 1 77.0 10 15 0.0 12-Mar-11 138.712 770.050 JCI 44.366 38.638 83.004 3 26-Sep-14 31-Dec-12 United K. (Standard Bank) International Carbon 28-May-10 12-Mar-11 30-Dec-99 10 9 5 8 7 0 0.940 81.9 No 63.580 77.005 77.005 77.005 77.005 77.005 77.005 77.005 77.005 77.005 12.834

303CPA0045.02 4302-0002 SASSA Low Pressure Solar Water Heater Programme – CPA- 002 Africa Southern Africa South Africa Many Registered Solar Solar Solar water heating AMS-I.C. 1 41.5 10 15 0.0 1-Apr-12 27.550 414.600 JCI 4.610 11.556 16.166 3 1-Dec-14 31-Dec-12 United K. (Standard Bank) International Carbon 29-Mar-12 30-Dec-99 10 9 5 8 7 0 0.955 43.4 No 31.105 41.460 41.460 41.460 41.460 41.460 41.460 41.460 41.460 41.460 10.355

304CPA0045.03 4302-0003 SASSA Low Pressure Solar Water Heater Programme – CPA- 003 Africa Southern Africa South Africa Many Registered Solar Solar Solar water heating AMS-I.C. 1 41.5 10 15 0.0 1-Jan-13 0.000 415.220 JCI United K. (Standard Bank) International Carbon 28-Dec-12 30-Dec-99 10 9 5 8 7 0 0.977 42.5 No N/A MSC 41.522 41.522 41.522 41.522 41.522 41.522 41.522 41.522 41.522 41.522

305CPA0045.04 4302-0004 SASSA Low Pressure Solar Water Heater Programme – CPA-004 Africa Southern Africa South Africa Many Registered Solar Solar Solar water heating AMS-I.C. 1 41.5 10 15 0.0 1-Jul-13 0.000 415.040 JCI United K. (Standard Bank) International Carbon 7-Jan-13 30-Dec-99 10 9 5 8 7 0 0.977 42.5 No MSC 20.752 41.504 41.504 41.504 41.504 41.504 41.504 41.504 41.504 41.504 20.752

306CPA0045.05 4302-0005 SASSA Low Pressure Solar Water Heater Programme – CPA-005 Africa Southern Africa South Africa Many Registered Solar Solar Solar water heating AMS-I.C. 1 41.5 10 15 0.0 1-Jul-13 0.000 414.760 JCI United K. (Standard Bank) International Carbon 7-Jan-13 30-Dec-99 10 9 5 8 7 0 0.977 42.4 No MSC 41.476 41.476 41.476 41.476 41.476 41.476 41.476 41.476 41.476 41.476

307CPA0045.06 4302-0006 SASSA Low Pressure Solar Water Heater Programme – CPA-006 Africa Southern Africa South Africa Many Registered Solar Solar Solar water heating AMS-I.C. 1 41.4 10 15 0.0 1-Jul-13 0.000 414.480 JCI United K. (Standard Bank) International Carbon 7-Jan-13 30-Dec-99 10 9 5 8 7 0 0.977 42.4 No MSC 41.448 41.448 41.448 41.448 41.448 41.448 41.448 41.448 41.448 41.448

308CPA0045.07 4302-0007 SASSA Low Pressure Solar Water Heater Programme – CPA-007 Africa Southern Africa South Africa Many Registered Solar Solar Solar water heating AMS-I.C. 1 41.4 10 15 0.0 1-Jul-13 0.000 414.200 JCI United K. (Standard Bank) International Carbon 7-Jan-13 30-Dec-99 10 9 5 8 7 0 0.977 42.4 No MSC 6.903 41.420 41.420 41.420 41.420 41.420 41.420 41.420 41.420 41.420 34.517

309PoA0046 29EI8GQ3VSXJBGHEHFFOAAH2Z0N4B2 Philippine CFL Distribution Project Asia & Pacific Southeast Asia Philippines Philippines At Validation EE households EE households Lighting AMS-II.J. 1 21.9 15-May-09 28 53.251 219.230 BV Cert 0.000 n.a. ADB CDM Facility 2-Jun-10 PoA 30-Dec-99PoA 4 9 7 8 0.0

310CPA0046.01 Philippine CFL Distribution Project – Luzon ECs in Region 1-3 Asia & Pacific Southeast Asia Philippines At Validation EE households EE households Lighting AMS-II.J. 1 21.9 10 8 -2.0 1-Jan-11 53.251 219.230 BV Cert n.a. ADB CDM Facility 2-Jun-10 30-Dec-99 4 9 7 8 0 0.525 Yes 27.566 25.685 23.804 21.923 20.043 18.162 16.281 0.000

311PoA0047 MFYU31ZBA2GG3OENYSE1MKHHIRXL3F 6707 Asia & Pacific Southeast Asia Philippines Philippines Land Bank of the Philippines Registered Landfill gas Landfill gas Landfill power ACM1 2 701.9 1-Oct-12 28 0.000 7,019.280 DNV 0.000 Spain (Government of Spain) WB-CF 16-Jun-10 5-Mar-12 18-Jul-12 21-Sep-12 20-Jul-12 CPA 31-Dec-99CPA 1 6 5 7 12 9 5.0

312CPA0047.01 6707-0001 Asia & Pacific Southeast Asia Philippines Cagayan Valey Land Bank of the Philippines Registered Landfill gas Landfill gas Landfill power ACM1 1 469.2 10 20 100.0 1-Jun-13 0.000 4,691.820 DNV Spain (Government of Spain) WB-CF 16-Jun-10 20-Jul-12 30-Dec-99 1 6 5 7 12 9 0 5.0 35040 0.542 No 3 66.309 164.659 299.611 390.579 476.168 542.448 595.119 638.063 673.936 704.569

313CPA0047.02 6707-0002 Asia & Pacific Southeast Asia Philippines Province of Rizal Land Bank of the Philippines Registered Landfill gas Landfill gas Landfill power ACM1 1 232.7 10 20 100.0 22-Sep-16 0.000 2,327.460 DNV WB-CF 16-Jun-10 22-Sep-16 30-Dec-99 1 6 5 7 12 9 0 96.715 580.001 430.652 321.799 244.755 182.657 141.769 110.845 90.745 74.932 52.586

314PoA0048 FE1O4X694G3CET6VGVGIOP16N11UPF Demand-side energy efficiency measures for cooling systems Asia & Pacific Southeast Asia Singapore Singapore United Premas Replaced At Validation EE service EE service HVAC & lighting AMS-II.C. 1-Nov-10 28 BV Cert n.a. United Premas 22-Jun-10 10-Jan-13 CPA 30-Dec-99CPA 4 9 12 5

315CPA0048.01 Asia & Pacific Southeast Asia Singapore United Premas Replaced At Validation EE service EE service HVAC & lighting AMS-II.C. 1 7.7 10 20 0.0 1-Oct-10 17.352 77.120 BV Cert n.a. United Premas 22-Jun-10 10-Jan-13 30-Dec-99 4 9 12 5 0 2.0 Yes 1.928 7.712 7.712 7.712 7.712 7.712 7.712 7.712 7.712 7.712 5.784

316PoA0049 EFGITXVLLD0JO8DUQR9ZMVBDPM5TFI Asia & Pacific East Asia South Korea South Korea At Validation EE own generation EE own generation Chemicals heat ACM12 1 12.9 29-Jun-10 28 32.243 128.974 KSA 0.000 n.a. Ecoeye 29-Jun-10 CPA 30-Dec-99CPA 1 9 0.0

317CPA0049.01 Asia & Pacific East Asia South Korea Gyeonggi At Validation EE own generation EE own generation Chemicals heat ACM12 1 12.9 10 10 0.0 1-Jul-10 32.243 128.974 KSA n.a. Ecoeye 29-Jun-10 30-Dec-99 1 9 0 0.538 No 12.897 12.897 12.897 12.897 12.897 12.897 12.897 12.897 12.897 12.897

318PoA0050 TW3BB1H0VB3ZONGB0PW4XZ7JNQE9RE 7760 AWMS Composting Project Latin America South America Brazil Brazil AMBIO Registered Methane avoidance Methane avoidance Composting AMS-III.F. 2 7.3 16-Jul-10 28 0.000 55.701 BV Cert 0.000 n.a. AMBIO 16-Jul-10 24-Sep-12 17-Oct-12 15-Dec-12 17-Oct-12 CPA 30-Dec-99PoA 1 3 6 9 5 11 0.0

319CPA0050.01 7760-0001 Latin America South America Brazil Mato Grosso AMBIO Registered Methane avoidance Methane avoidance Composting AMS-III.F. 1 3.5 7 30 0.0 17-Oct-12 28.385 BV Cert n.a. AMBIO 16-Jul-10 17-Oct-12 30-Dec-99 1 3 6 9 5 11 0 0.311 No 15.213 15.213 15.213 15.213 15.213 15.213 15.213 15.213 15.213 15.213 15.213 15.213 15.213 15.213 15.213 15.213 15.213 15.213 15.213 15.213 15.213

320CPA0050.02 7760-0002 Latin America South America Brazil Mato Grosso AMBIO Registered Methane avoidance Methane avoidance Composting AMS-III.F. 1 3.9 7 30 0.0 1-Dec-13 27.316 BV Cert n.a. AMBIO 16-Jul-10 30-Jan-14 30-Dec-99 1 3 6 9 5 11 0 No 0.321 3.854 3.854 3.854 3.854 3.854 3.854

321PoA0051 TUXCL897X8BIPUGILATNNKL4JTRB39 Programme of activities to switch from residual fuel oil to LPG in Peru Latin America South America Peru Peru Repsol YPF Comercial del Perú At Validation Fossil fuel switch Fossil fuel switch Oil to LPG AMS-III.B. 1 0.3 26-Jul-10 28 606.280 3.031 AENOR 0.000 Spain (Repsol) Garrigues Medio Ambiente 22-Jul-10 PoA 30-Dec-99PoA 1 6 11 9 0.0

322CPA0051.01 Latin America South America Peru Piura Repsol YPF Comercial del Perú At Validation Fossil fuel switch Fossil fuel switch Oil to LPG Replacing residual fuel oilwith LPG AMS-III.B. 1 0.3 10 10 0.0 1-Jan-11 606.280 3.031 AENOR Spain (Repsol) Garrigues Medio Ambiente 22-Jul-10 30-Dec-99 1 6 11 9 1 Algas Mexico Baltas Italy No Investment 3 0.303 0.303 0.303 0.303 0.303 0.303 0.303 0.303 0.303 0.303

323PoA0052 0854E2KKYMKHZ4AEGZSKFA3HP7SU1F Latin America South America Brazil Brazil Nemorus Securities Validation Terminated Methane avoidance Methane avoidance Manure AMS-III.D. 1 2.3 1-Sep-10 10 4.688 23.440 BV Cert 0.000 n.a. Nemorus Securities 30-Jul-10 PoA 30-Dec-99Both 3 2 1 6 9 7 0.0

324CPA0052.01 SWAMPA-PA.I – Under the PoA “SWAMPA-Brazil”. Latin America South America Brazil Mato Grosso do Sul Nemorus Securities Validation Terminated Methane avoidance Methane avoidance Manure Biodigester and flare technology AMS-III.D. 1 2.3 10 10 0.0 1-Jan-11 4.688 23.440 BV Cert n.a. Nemorus Securities 30-Jul-10 30-Dec-99 3 2 1 6 9 7 0 No 0.781 2.344 2.344 2.344 2.344 2.344 2.344 2.344 2.344 2.344 1.563

325PoA0053 HLD43PY3PVTGOA6485WEHS9X08ZKZ0 5019 The programme to promote efficient lightings in local areas Asia & Pacific East Asia South Korea South Korea KEMCO Registered EE service EE service Street lighting AMS-II.C. 24 9.7 27-Oct-09 28 0.028 96.880 KSA 0.000 n.a. KEMCO 7-Aug-10 17-Feb-11 2-Nov-11 19-Oct-11 CPA 30-Dec-99CPA 9 4 8 0.0 Investment;N/A

326CPA0053.01 5019-0001 Asia & Pacific East Asia South Korea Gwanju KEMCO Registered EE service EE service Street lighting AMS-II.C. 11 0.1 10 10 0.0 30-Nov-11 0.004 0.510 KSA n.a. KEMCO 7-Aug-10 19-Oct-11 30-Dec-99 9 4 8 0 0.674 0.1 No N/A MSC 0.051 0.051 0.051 0.051 0.051 0.051 0.051 0.051 0.051 0.051

327CPA0053.02 5019-0002 Asia & Pacific East Asia South Korea Gwangju KEMCO Registered EE service EE service Street lighting AMS-II.C. 1 0.5 10 10 0.0 17-Dec-12 0.018 4.560 KSA KEMCO 17-Dec-12 30-Dec-99 9 2 8 0 0.674 0.7 No N/A MSC 0.018 0.456 0.456 0.456 0.456 0.456 0.456 0.456 0.456 0.456 0.438

328CPA0053.03 5019-0003 The programme to promote efficient lightings in local areas – <2012-01, Seoul> Asia & Pacific East Asia South Korea Seoul KEMCO Registered EE service EE service Street lighting AMS-II.C. 1 0.0 10 10 0.0 17-Dec-12 0.002 0.480 KSA KEMCO 17-Dec-12 30-Dec-99 9 2 8 0 0.674 0.1 No N/A MSC 0.002 0.048 0.048 0.048 0.048 0.048 0.048 0.048 0.048 0.048 0.047

329CPA0053.04 5019-0004 Asia & Pacific East Asia South Korea Jeollanam-do KEMCO Registered EE service EE service Street lighting AMS-II.C. 1 0.0 10 10 0.0 17-Dec-12 0.001 0.260 KSA KEMCO 17-Dec-12 30-Dec-99 9 2 8 0 0.674 0.0 No N/A MSC 0.001 0.026 0.026 0.026 0.026 0.026 0.026 0.026 0.026 0.026 0.025

330CPA0053.05 5019-0005 Asia & Pacific East Asia South Korea Incheon KEMCO Registered EE service EE service Street lighting AMS-II.C. 1 0.0 10 10 0.0 17-Dec-12 0.002 0.380 KSA KEMCO 17-Dec-12 30-Dec-99 9 2 8 0 0.674 0.1 No N/A MSC 0.002 0.038 0.038 0.038 0.038 0.038 0.038 0.038 0.038 0.038 0.037

331CPA0053.06 5019-0006 Asia & Pacific East Asia South Korea Incheon KEMCO Registered EE service EE service Street lighting AMS-II.C. 1 0.0 10 10 0.0 17-Dec-12 0.001 0.180 KSA KEMCO 17-Dec-12 30-Dec-99 9 2 8 0 0.674 0.0 No N/A MSC 0.001 0.018 0.018 0.018 0.018 0.018 0.018 0.018 0.018 0.018 0.017

332CPA0053.07 5019-0007 The first CPA of Korea Expressway Corporation Asia & Pacific East Asia South Korea Central Region KEMCO Registered EE service EE service Street lighting AMS-II.C. 1 0.1 10 10 0.0 19-Dec-14 1.210 KSA KEMCO 19-Dec-14 30-Dec-99 9 2 8 0 0.674 0.2 No N/A MSC 0.121 0.121 0.121 0.121 0.121 0.121 0.121 0.121 0.121 0.121

333CPA0053.08 5019-0008 The first CPA of Daegu Metropolitan City Facilities Management Corporation Asia & Pacific East Asia South Korea KEMCO Registered EE service EE service Street lighting AMS-II.C. 1 0.7 10 10 0.0 19-Dec-14 7.060 KSA KEMCO 19-Dec-14 30-Dec-99 9 2 8 0 0.674 1.0 No N/A MSC 0.706 0.706 0.706 0.706 0.706 0.706 0.706 0.706 0.706 0.706

334CPA0053.09 5019-0009 The first CPA of Busan Metropolitan City Asia & Pacific East Asia South Korea KEMCO Registered EE service EE service Street lighting AMS-II.C. 1 0.2 10 10 0.0 19-Dec-14 1.630 KSA KEMCO 19-Dec-14 30-Dec-99 9 2 8 0 0.674 0.2 No N/A MSC 0.163 0.163 0.163 0.163 0.163 0.163 0.163 0.163 0.163 0.163

335CPA0053.10 5019-0010 The first CPA of Yeosu Gwangyang Port Authority Asia & Pacific East Asia South Korea Keonbudu-ro KEMCO Registered EE service EE service Street lighting AMS-II.C. 1 0.2 10 10 0.0 19-Dec-14 1.780 KSA KEMCO 19-Dec-14 30-Dec-99 9 2 8 0 0.674 0.3 No N/A MSC 0.178 0.178 0.178 0.178 0.178 0.178 0.178 0.178 0.178 0.178

336CPA0053.11 5019-0011 The second CPA of Incheon International Airport Corporation Asia & Pacific East Asia South Korea KEMCO Registered EE service EE service Street lighting AMS-II.C. 1 0.0 10 10 0.0 19-Dec-14 0.220 KSA KEMCO 19-Dec-14 30-Dec-99 9 2 8 0 0.674 0.0 No N/A MSC 0.022 0.022 0.022 0.022 0.022 0.022 0.022 0.022 0.022 0.022

337CPA0053.12 5019-0012 The Second CPA of Yeosu Gwangyang Port Authority Asia & Pacific East Asia South Korea KEMCO Registered EE service EE service Street lighting AMS-II.C. 1 0.2 10 10 0.0 22-Dec-15 1.980 KSA KEMCO 22-Dec-15 30-Dec-99 9 2 8 0 0.674 No N/A 0.198 0.198 0.198 0.198 0.198 0.198 0.198 0.198 0.198 0.198

338CPA0053.13 5019-0013 The Second CPA of Korea Expressway Corporation Asia & Pacific East Asia South Korea KEMCO Registered EE service EE service Street lighting AMS-II.C. 1 7.4 10 10 0.0 22-Dec-15 73.830 KSA KEMCO 22-Dec-15 30-Dec-99 9 2 8 0 0.674 No N/A 7.383 7.383 7.383 7.383 7.383 7.383 7.383 7.383 7.383 7.383

339CPA0053.14 5019-0014 The Second CPA of Busan Metropolitan City Asia & Pacific East Asia South Korea KEMCO Registered EE service EE service Street lighting AMS-II.C. 1 0.3 10 10 0.0 22-Dec-15 2.800 KSA KEMCO 22-Dec-15 30-Dec-99 9 2 8 0 0.67 No N/A 0.280 0.280 0.280 0.280 0.280 0.280 0.280 0.280 0.280 0.280

340PoA0054 E9BNZEOBN5JL9RCCSXVP63P3FP8Y10 6568 Landfills’ gas capture, flaring and use program in Morocco Africa North Africa Morocco Morocco Registered Landfill gas Landfill gas Landfill power ACM1 1 138.4 11-Aug-11 28 0.000 1,085.027 AENOR 11.169 TÜV-Nord Sweden (IBRD) ADS Maroc 11-Aug-10 15-Oct-10 18-Dec-12 18-Dec-12 CPA 30-Dec-99CPA 1 6 8 7 5 9 6.4

341CPA0054.01 6568-0001 Landfill’s gas (LFG) capture, flaring and use at the Oum Azza landfill. Africa North Africa Morocco Registered Landfill gas Landfill gas Landfill power LFG collection use and flaring ACM1 1 138.4 7 21 20.0 1-Mar-13 0.000 1,085.027 AENOR 11.169 11.169 1 26-May-17 31-Jul-16 TÜV-Nord Sweden (IBRD) ADS Maroc 11-Aug-10 18-Dec-12 30-Dec-99 1 6 8 7 5 9 0 6.4 478839 0.714 No 3 75.947 101.503 126.092 149.838 163.110 184.710 197.597 197.597 197.597 197.597 197.597 197.597 197.597 197.597

342PoA0055 QZJF145Q549K9CCC1AMAACHI1A3VFR 5324 Than Thien Small Hydropower Programme of Activities Managed by INTRACO Asia & Pacific Southeast Asia Vietnam Vietnam Registered Hydro Hydro Run of river AMS-I.D. 13 130.5 1-Jul-12 28 1.693 1,304.750 TÜV-Rhein 0.000 Netherlands (Mabanaft+Gunvor International) INTRACO 11-Aug-10 24-Nov-10 13-Oct-11 7-Jun-12 20-Apr-12 CPA 31-Dec-99Both 2 4 9 5 10 11 54.1

343CPA0055.01 5324-0001 Nhan Co Hydropower Project Asia & Pacific Southeast Asia Vietnam Dak Nong Registered Hydro Hydro Run of river 1.5 MW run of river hydropower plant AMS-I.D. 1 3.4 10 30 0.0 1-Jul-12 1.693 33.860 TÜV-Rhein Netherlands (Mabanaft+Gunvor International) INTRACO 11-Aug-10 20-Apr-12 30-Dec-99 2 4 9 5 10 11 -2 1.5 5870 0.576 No N/A MSW SUZ 3.386 3.386 3.386 3.386 3.386 3.386 3.386 3.386 3.386 3.386

344CPA0055.02 5324-0002 Dak Pone 2AB Hydropower Project Asia & Pacific Southeast Asia Vietnam Kon Tum Registered Hydro Hydro Run of river 1.5 MW run of river hydropower plant AMS-I.D. 1 12.9 10 30 0.0 1-Jun-13 0.000 129.340 TÜV-Rhein INTRACO 27-Apr-13 30-Dec-99 2 4 9 5 10 11 -2 5.1 22439 0.576 No Investment 3 12.934 12.934 12.934 12.934 12.934 12.934 12.934 12.934 12.934 12.934 12.934

345CPA0055.03 5324-0003 Dak Pia Hydropower Project Asia & Pacific Southeast Asia Vietnam Kon Tum Registered Hydro Hydro Run of river 1.5 MW run of river hydropower plant AMS-I.D. 1 5.8 10 30 0.0 1-Jun-13 0.000 57.570 TÜV-Rhein INTRACO 27-Apr-13 30-Dec-99 2 4 9 5 10 11 -2 2.3 9989 0.576 No N/A MSW SUZ 5.757 5.757 5.757 5.757 5.757 5.757 5.757 5.757 5.757 5.757 5.757

346CPA0055.04 5324-0004 Ea M’Doal 2 Hydropower Project Asia & Pacific Southeast Asia Vietnam Kon Tum Registered Hydro Hydro Run of river 1.5 MW run of river hydropower plant AMS-I.D. 1 7.6 10 30 0.0 1-Jun-13 0.000 76.130 TÜV-Rhein INTRACO 27-Apr-13 30-Dec-99 2 4 9 5 10 11 -2 2.3 9989 0.576 No N/A MSW SUZ 5.757 5.757 5.757 5.757 5.757 5.757 5.757 5.757 5.757 5.757 5.757

347CPA0055.05 5324-0005 Ta Nung Hydropower Project Asia & Pacific Southeast Asia Vietnam Lam Dong Registered Hydro Hydro Run of river 2 MW run of river hydropower plant AMS-I.D. 1 4.4 10 30 0.0 1-Jul-13 0.000 43.810 TÜV-Rhein INTRACO 29-Jun-13 30-Dec-99 2 4 9 5 10 11 -2 2.0 7601 0.576 No N/A MSW SUZ 3 2.190 4.381 4.381 4.381 4.381 4.381 4.381 4.381 4.381 4.381 2.190

348CPA0055.06 5324-0006 Tu Tren Hydropower Project Asia & Pacific Southeast Asia Vietnam Lao Cai Registered Hydro Hydro Run of river 2.8 MW run of river hydropower plant AMS-I.D. 1 6.3 10 30 0.0 1-Jul-13 0.000 63.210 TÜV-Rhein INTRACO 29-Jun-13 30-Dec-99 2 4 9 5 10 11 -2 2.8 10966 0.576 No N/A MSW SUZ 3.161 6.321 6.321 6.321 6.321 6.321 6.321 6.321 6.321 6.321 3.161

349CPA0055.07 5324-0007 Ta Vi Hydropower Project Asia & Pacific Southeast Asia Vietnam Quang Nam Registered Hydro Hydro Run of river 3 MW run of river hydropower plant AMS-I.D. 1 6.8 10 30 0.0 1-Jul-13 0.000 67.900 TÜV-Rhein INTRACO 29-Jun-13 30-Dec-99 2 4 9 5 10 11 -2 3.0 11780 0.576 No N/A MSW SUZ 3.395 6.790 6.790 6.790 6.790 6.790 6.790 6.790 6.790 6.790 3.395

350CPA0055.08 5324-0008 Dak Pone2 Hydropower Project Asia & Pacific Southeast Asia Vietnam Kon Tum Registered Hydro Hydro Run of river 3.6 MW run of river hydropower plant AMS-I.D. 1 8.9 10 30 0.0 1-Jul-13 0.000 89.130 TÜV-Rhein INTRACO 29-Jun-13 30-Dec-99 2 4 9 5 10 11 -2 3.6 15464 0.576 No N/A MSW SUZ 4.457 8.913 8.913 8.913 8.913 8.913 8.913 8.913 8.913 8.913 4.457

351CPA0055.09 5324-0009 Da Kai Hydropower Project Asia & Pacific Southeast Asia Vietnam Lam Dong Registered Hydro Hydro Run of river 8 MW run of river hydropower plant AMS-I.D. 1 17.7 10 30 0.0 1-Jul-13 0.000 176.890 TÜV-Rhein INTRACO 29-Jun-13 30-Dec-99 2 4 9 5 10 11 -2 8.0 30690 0.576 No N/A 3 8.845 17.689 17.689 17.689 17.689 17.689 17.689 17.689 17.689 17.689 8.845

352CPA0055.10 5324-0010 Dak Glun 2 Hydropower Project Asia & Pacific Southeast Asia Vietnam Binh Phuoc Registered Hydro Hydro Run of river 10 MW run of river hydropower plant AMS-I.D. 1 26.0 10 30 0.0 1-Jan-14 0.000 260.150 TÜV-Rhein INTRACO 29-Jun-13 30-Dec-99 2 4 9 5 10 11 -2 10.0 45134 0.576 No N/A 3 13.008 26.015 26.015 26.015 26.015 26.015 26.015 26.015 26.015 26.015 13.008

353CPA0055.11 5324-0011 Dray H’Linh 3 Hydropower Project Asia & Pacific Southeast Asia Vietnam Dak Lak Registered Hydro Hydro Run of river 6 MW run of river hydropower plant AMS-I.D. 1 12.0 10 30 0.0 1-Jul-13 0.000 119.830 TÜV-Rhein INTRACO 29-Jun-13 30-Dec-99 2 4 9 5 10 11 -2 6.0 20790 0.576 No N/A 3 5.992 11.983 11.983 11.983 11.983 11.983 11.983 11.983 11.983 11.983 5.992

354CPA0055.12 5324-0012 Dak U Hydropower Project Asia & Pacific Southeast Asia Vietnam Dak Lak Registered Hydro Hydro Run of river 6 MW run of river hydropower plant AMS-I.D. 1 6.0 10 30 0.0 1-Aug-13 0.000 59.860 TÜV-Rhein INTRACO 5-Jul-13 30-Dec-99 2 4 9 5 10 11 -2 2.4 10385 0.576 No N/A 3 2.494 5.986 5.986 5.986 5.986 5.986 5.986 5.986 5.986 5.986 3.492

355CPA0055.13 5324-0013 Ia Krel 2 Hydropower Project Asia & Pacific Southeast Asia Vietnam Dak Lak Registered Hydro Hydro Run of river 6 MW run of river hydropower plant AMS-I.D. 1 12.7 10 30 0.0 1-Aug-13 0.000 127.070 TÜV-Rhein INTRACO 5-Jul-13 30-Dec-99 2 4 9 5 10 11 -2 5.0 22050 0.576 No N/A MSW-SUZ 5.295 12.707 12.707 12.707 12.707 12.707 12.707 12.707 12.707 12.707 7.412

356PoA0056 JQZC58SKAT6F8L9IZW5NCBKF21Z90Z Demand side energy efficiency measures in building lighting systems. Asia & Pacific Southeast Asia Singapore Singapore United Premas Replaced At Validation EE households EE households Lighting AMS-II.E. 1-Dec-10 28 BV Cert n.a. United Premas 14-Aug-10 9-Oct-12 CPA 30-Dec-99CPA 4 9 12 5 8

357CPA0056.01 Asia & Pacific Southeast Asia Singapore Jurong United Premas Replaced At Validation EE households EE households Lighting AMS-II.E. 1 2.5 10 6 0.0 1-Apr-11 1.857 24.770 BV Cert n.a. United Premas 14-Aug-10 9-Oct-12 30-Dec-99 4 9 12 5 8 0 5.2 No 1.857 2.477 2.477 2.477 2.477 2.477 2.477 2.477 2.477 2.477 0.620

358PoA0057 LXVV519KCCOGQM4WL7JYFD3D752BA7 Methane abatement and household biogas utilization programme in India Asia & Pacific Southern Asia India India Managing Emissions Validation Terminated Methane avoidance Methane avoidance Domestic manure 1 57.7 13-Apr-10 28 110.538 576.620 DNV 0.000 n.a. Managing Emissions 22-Sep-10 CPA 30-Dec-99CPA 8 9 1 6 4 2 1.7

359CPA0057.01 Asia & Pacific Southern Asia India Maharashtra Managing Emissions Validation Terminated Methane avoidance Methane avoidance Domestic manure 1 57.7 10 20 0.0 1-Feb-11 110.538 576.620 DNV n.a. Managing Emissions 22-Sep-10 30-Dec-99 8 9 1 6 4 2 0 1.7 No 57.662 57.662 57.662 57.662 57.662 57.662 57.662 57.662 57.662 57.662

360PoA0058 L4WEGWIDWIP3GKLL46OQ4OQ46GABRM Latin America South America Brazil Brazil Caixa Replaced At Validation Landfill gas Landfill gas AM53+ACM1 1-Aug-10 28 BV Cert Spain (IBRD) WB-CF 22-Sep-10 9-Nov-11 CPA 31-Dec-99CPA 7 5

361CPA0058.01 Latin America South America Brazil Rio de Janeiro Caixa Replaced At Validation Landfill gas Landfill gas AM53+ACM1 1 870.4 7 15 150.0 31-Jan-11 709.961 8,636.991 BV Cert Spain (IBRD) WB-CF 22-Sep-10 9-Nov-11 30-Dec-99 7 5 0 77541 0.164 No 3 196.218 513.743 783.222 964.719 111.104 1,217.319 1,306.370 1,306.370 1,306.370 1,306.370 1,306.370 1,306.370 1,306.370 1,306.370

362PoA0059 9R3X4IB0SS5HVAEVQXYKCEIJM5J9YH 2898 Sichuan Rural Poor-Household Biogas Development Programme Asia & Pacific East Asia China Sichuan Registered Methane avoidance Methane avoidance Domestic manure AMS-III.R.+AMS-I.I. 87 864.9 10-Dec-10 28 1.000 8,648.850 TÜV-Nord 1.411 1831.206 1832.617 2 3-Jan-14 31-Dec-15 United K. (UPM) 28-Oct-10 1-Dec-11 5-Apr-12 11-Apr-12 PoA 30-Dec-99PoA 9 8 1 4 6 0.0

363CPA0059.01 2898-0001 Asia & Pacific East Asia China Yibin in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 1,000 household biogas systems AMS-III.R.+AMS-I.I. 1 2.3 10 20 0.0 1-May-12 1.000 22.780 TÜV-Nord 1.411 6.562 7.973 2 3-Jan-14 31-Dec-15 United K. (UPM) 28-Oct-10 11-Apr-12 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 2.278 2.278 2.278 2.278 2.278 2.278 2.278 2.278 2.278

364CPA0059.02 2898-0002 CPA Nb. SCHHBG-2012-002 Asia & Pacific East Asia China Yibin in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.1 10 20 0.0 11-Apr-13 0.000 101.460 TÜV-Nord 0.000 27.190 27.190 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 7.186 10.146 10.146 10.146 10.146 10.146 10.146 10.146 10.146 10.146 2.960

365CPA0059.03 2898-0003 CPA Nb. SCHHBG-2012-003 Asia & Pacific East Asia China Yibin in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.1 10 20 0.0 11-Apr-13 0.000 101.460 TÜV-Nord 0.000 27.190 27.190 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 7.186 10.146 10.146 10.146 10.146 10.146 10.146 10.146 10.146 10.146 2.960

366CPA0059.04 2898-0004 CPA Nb. SCHHBG-2012-004 Asia & Pacific East Asia China Yibin in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.1 10 20 0.0 11-Apr-13 0.000 101.460 TÜV-Nord 0.000 27.190 27.190 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 7.186 10.146 10.146 10.146 10.146 10.146 10.146 10.146 10.146 10.146 2.960

367CPA0059.05 2898-0005 CPA Nb. SCHHBG-2012-005 Asia & Pacific East Asia China Yibin in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.1 10 20 0.0 11-Apr-13 0.000 101.460 TÜV-Nord 0.000 27.190 27.190 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 7.186 10.146 10.146 10.146 10.146 10.146 10.146 10.146 10.146 10.146 2.960

368CPA0059.06 2898-0006 CPA Nb. SCHHBG-2012-006 Asia & Pacific East Asia China Yibin in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.1 10 20 0.0 11-Apr-13 0.000 101.460 TÜV-Nord 0.000 27.190 27.190 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 7.186 10.146 10.146 10.146 10.146 10.146 10.146 10.146 10.146 10.146 2.960

369CPA0059.07 2898-0007 CPA Nb. SCHHBG-2012-007 Asia & Pacific East Asia China Yibin in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.1 10 20 0.0 11-Apr-13 0.000 101.460 TÜV-Nord 0.000 27.190 27.190 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 7.186 10.146 10.146 10.146 10.146 10.146 10.146 10.146 10.146 10.146 2.960

370CPA0059.08 2898-0008 CPA Nb. SCHHBG-2012-008 Asia & Pacific East Asia China Yibin in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.1 10 20 0.0 11-Apr-13 0.000 101.460 TÜV-Nord 0.000 27.190 27.190 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 7.186 10.146 10.146 10.146 10.146 10.146 10.146 10.146 10.146 10.146 2.960

371CPA0059.09 2898-0009 CPA Nb. SCHHBG-2012-009 Asia & Pacific East Asia China Yibin in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.1 10 20 0.0 11-Apr-13 0.000 101.460 TÜV-Nord 0.000 27.190 27.190 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 7.186 10.146 10.146 10.146 10.146 10.146 10.146 10.146 10.146 10.146 2.960

372CPA0059.10 2898-0010 CPA Nb. SCHHBG-2012-010 Asia & Pacific East Asia China Yibin in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.1 10 20 0.0 11-Apr-13 0.000 101.460 TÜV-Nord 0.000 27.190 27.190 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 7.186 10.146 10.146 10.146 10.146 10.146 10.146 10.146 10.146 10.146 2.960

373CPA0059.11 2898-0011 CPA Nb. SCHHBG-2012-011 Asia & Pacific East Asia China Mianyang in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 9.9 10 20 0.0 11-Apr-13 0.000 98.700 TÜV-Nord 0.000 26.207 26.207 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 6.991 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 2.879

374CPA0059.12 2898-0012 CPA Nb. SCHHBG-2012-012 Asia & Pacific East Asia China Mianyang in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 9.9 10 20 0.0 11-Apr-13 0.000 98.700 TÜV-Nord 0.000 26.207 26.207 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 6.991 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 2.879

375CPA0059.13 2898-0013 CPA Nb. SCHHBG-2012-013 Asia & Pacific East Asia China Mianyang in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 9.9 10 20 0.0 11-Apr-13 0.000 98.700 TÜV-Nord 0.000 26.207 26.207 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 6.991 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 2.879

376CPA0059.14 2898-0014 CPA Nb. SCHHBG-2012-014 Asia & Pacific East Asia China Mianyang in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 9.9 10 20 0.0 11-Apr-13 0.000 98.700 TÜV-Nord 0.000 26.207 26.207 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 6.991 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 2.879

377CPA0059.15 2898-0015 CPA Nb. SCHHBG-2012-015 Asia & Pacific East Asia China Mianyang in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 9.9 10 20 0.0 11-Apr-13 0.000 98.700 TÜV-Nord 0.000 26.207 26.207 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 6.991 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 2.879

378CPA0059.16 2898-0016 CPA Nb. SCHHBG-2012-016 Asia & Pacific East Asia China Mianyang in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 9.9 10 20 0.0 11-Apr-13 0.000 98.700 TÜV-Nord 0.000 26.207 26.207 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 6.991 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 2.879

379CPA0059.17 2898-0017 CPA Nb. SCHHBG-2012-017 Asia & Pacific East Asia China Mianyang in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 9.9 10 20 0.0 11-Apr-13 0.000 98.700 TÜV-Nord 0.000 26.207 26.207 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 6.991 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 2.879

380CPA0059.18 2898-0018 CPA Nb. SCHHBG-2012-018 Asia & Pacific East Asia China Mianyang in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 9.9 10 20 0.0 11-Apr-13 0.000 98.700 TÜV-Nord 0.000 26.207 26.207 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 6.991 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 2.879

381CPA0059.19 2898-0019 CPA Nb. SCHHBG-2012-019 Asia & Pacific East Asia China Mianyang in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 9.9 10 20 0.0 11-Apr-13 0.000 98.700 TÜV-Nord 0.000 26.207 26.207 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 6.991 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 2.879

382CPA0059.20 2898-0020 CPA Nb. SCHHBG-2012-020 Asia & Pacific East Asia China Mianyang in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 9.9 10 20 0.0 11-Apr-13 0.000 98.700 TÜV-Nord 0.000 26.207 26.207 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 6.991 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 2.879

383CPA0059.21 2898-0021 CPA Nb. SCHHBG-2012-021 Asia & Pacific East Asia China Mianyang in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 9.9 10 20 0.0 11-Apr-13 0.000 98.700 TÜV-Nord 0.000 26.207 26.207 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 6.991 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 2.879

384CPA0059.22 2898-0022 CPA Nb. SCHHBG-2012-022 Asia & Pacific East Asia China Mianyang in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 9.9 10 20 0.0 11-Apr-13 0.000 98.700 TÜV-Nord 0.000 26.207 26.207 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 6.991 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 2.879

385CPA0059.23 2898-0023 CPA Nb. SCHHBG-2012-023 Asia & Pacific East Asia China Mianyang in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 9.9 10 20 0.0 11-Apr-13 0.000 98.700 TÜV-Nord 0.000 26.207 26.207 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 6.991 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 2.879

386CPA0059.24 2898-0024 CPA Nb. SCHHBG-2012-024 Asia & Pacific East Asia China Mianyang in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 9.9 10 20 0.0 11-Apr-13 0.000 98.700 TÜV-Nord 0.000 26.207 26.207 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 6.991 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 2.879

387CPA0059.25 2898-0025 CPA Nb. SCHHBG-2012-025 Asia & Pacific East Asia China Mianyang in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 9.9 10 20 0.0 11-Apr-13 0.000 98.700 TÜV-Nord 0.000 26.207 26.207 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 6.991 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 2.879

388CPA0059.26 2898-0026 CPA Nb. SCHHBG-2012-026 Asia & Pacific East Asia China Mianyang in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 9.9 10 20 0.0 11-Apr-13 0.000 98.700 TÜV-Nord 0.000 26.207 26.207 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 6.991 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 2.879

389CPA0059.27 2898-0027 CPA Nb. SCHHBG-2012-027 Asia & Pacific East Asia China Mianyang in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 9.9 10 20 0.0 11-Apr-13 0.000 98.700 TÜV-Nord 0.000 26.207 26.207 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 6.991 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 2.879

390CPA0059.28 2898-0028 CPA Nb. SCHHBG-2012-028 Asia & Pacific East Asia China Guang’an in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.1 10 20 0.0 11-Apr-13 0.000 101.460 TÜV-Nord 0.000 26.469 26.469 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 7.186 10.146 10.146 10.146 10.146 10.146 10.146 10.146 10.146 10.146 2.960

391CPA0059.29 2898-0029 CPA Nb. SCHHBG-2012-029 Asia & Pacific East Asia China Guang’an in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.1 10 20 0.0 11-Apr-13 0.000 101.460 TÜV-Nord 0.000 26.469 26.469 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 7.186 10.146 10.146 10.146 10.146 10.146 10.146 10.146 10.146 10.146 2.960

392CPA0059.30 2898-0030 CPA Nb. SCHHBG-2012-030 Asia & Pacific East Asia China Guang’an in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.1 10 20 0.0 11-Apr-13 0.000 101.460 TÜV-Nord 0.000 26.469 26.469 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 7.186 10.146 10.146 10.146 10.146 10.146 10.146 10.146 10.146 10.146 2.960

393CPA0059.31 2898-0031 CPA Nb. SCHHBG-2012-031 Asia & Pacific East Asia China Guang’an in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.1 10 20 0.0 11-Apr-13 0.000 101.460 TÜV-Nord 0.000 26.469 26.469 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 7.186 10.146 10.146 10.146 10.146 10.146 10.146 10.146 10.146 10.146 2.960

394CPA0059.32 2898-0032 CPA Nb. SCHHBG-2012-032 Asia & Pacific East Asia China Suining in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 9.9 10 20 0.0 11-Apr-13 0.000 98.700 TÜV-Nord 0.000 26.207 26.207 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 6.991 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 2.879

395CPA0059.33 2898-0033 CPA Nb. SCHHBG-2012-033 Asia & Pacific East Asia China Suining in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 9.9 10 20 0.0 11-Apr-13 0.000 98.700 TÜV-Nord 0.000 26.207 26.207 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 6.991 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 2.879

396CPA0059.34 2898-0034 CPA Nb. SCHHBG-2012-034 Asia & Pacific East Asia China Suining in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 9.9 10 20 0.0 11-Apr-13 0.000 98.700 TÜV-Nord 0.000 26.207 26.207 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 6.991 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 2.879

397CPA0059.35 2898-0035 CPA Nb. SCHHBG-2012-035 Asia & Pacific East Asia China Dazhou in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 9.9 10 20 0.0 11-Apr-13 0.000 98.700 TÜV-Nord 0.000 26.533 26.533 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 6.991 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 2.879

398CPA0059.36 2898-0036 CPA Nb. SCHHBG-2012-036 Asia & Pacific East Asia China Ziyang in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 9.9 10 20 0.0 11-Apr-13 0.000 98.700 TÜV-Nord 0.000 26.602 26.602 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 6.991 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 2.879

399CPA0059.37 2898-0037 CPA Nb. SCHHBG-2012-037 Asia & Pacific East Asia China Ziyang in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 9.9 10 20 0.0 11-Apr-13 0.000 98.700 TÜV-Nord 0.000 26.602 26.602 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 6.991 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 2.879

400CPA0059.38 2898-0038 CPA Nb. SCHHBG-2012-038 Asia & Pacific East Asia China Ziyang in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 9.9 10 20 0.0 11-Apr-13 0.000 98.700 TÜV-Nord 0.000 26.602 26.602 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 6.991 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 2.879

401CPA0059.39 2898-0039 CPA Nb. SCHHBG-2012-039 Asia & Pacific East Asia China Ziyang in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 9.9 10 20 0.0 11-Apr-13 0.000 98.700 TÜV-Nord 0.000 26.602 26.602 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 6.991 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 2.879

402CPA0059.40 2898-0040 CPA Nb. SCHHBG-2012-040 Asia & Pacific East Asia China Ziyang in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 9.9 10 20 0.0 11-Apr-13 0.000 98.700 TÜV-Nord 0.000 26.602 26.602 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 6.991 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 2.879

403CPA0059.41 2898-0041 CPA Nb. SCHHBG-2012-041 Asia & Pacific East Asia China Ziyang in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 9.9 10 20 0.0 11-Apr-13 0.000 98.700 TÜV-Nord 0.000 26.602 26.602 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 6.991 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 2.879

404CPA0059.42 2898-0042 CPA Nb. SCHHBG-2012-042 Asia & Pacific East Asia China Meishan in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 9.9 10 20 0.0 11-Apr-13 0.000 98.700 TÜV-Nord 0.000 26.602 26.602 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 6.991 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 2.879

405CPA0059.43 2898-0043 CPA Nb. SCHHBG-2012-043 Asia & Pacific East Asia China Meishan in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 9.9 10 20 0.0 11-Apr-13 0.000 98.700 TÜV-Nord 0.000 26.602 26.602 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 6.991 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 2.879

406CPA0059.44 2898-0044 CPA Nb. SCHHBG-2012-044 Asia & Pacific East Asia China Meishan in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 9.9 10 20 0.0 11-Apr-13 0.000 98.700 TÜV-Nord 0.000 26.602 26.602 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 6.991 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 2.879

407CPA0059.45 2898-0045 CPA Nb. SCHHBG-2012-045 Asia & Pacific East Asia China Meishan in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 9.9 10 20 0.0 11-Apr-13 0.000 98.700 TÜV-Nord 0.000 26.602 26.602 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 6.991 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 2.879

408CPA0059.46 2898-0046 CPA Nb. SCHHBG-2012-046 Asia & Pacific East Asia China Neijiang in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 9.9 10 20 0.0 11-Apr-13 0.000 98.700 TÜV-Nord 0.000 26.928 26.928 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 6.991 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 9.870 2.879

409CPA0059.47 2898-0047 CPA Nb. SCHHBG-2012-047 Asia & Pacific East Asia China Leshan in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.1 10 20 0.0 11-Apr-13 0.000 101.460 TÜV-Nord 0.000 26.966 26.966 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 7.186 10.146 10.146 10.146 10.146 10.146 10.146 10.146 10.146 10.146 2.960

410CPA0059.48 2898-0048 CPA Nb. SCHHBG-2012-048 Asia & Pacific East Asia China Leshan in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.1 10 20 0.0 11-Apr-13 0.000 101.460 TÜV-Nord 0.000 26.966 26.966 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 7.186 10.146 10.146 10.146 10.146 10.146 10.146 10.146 10.146 10.146 2.960

411CPA0059.49 2898-0049 CPA Nb. SCHHBG-2012-049 Asia & Pacific East Asia China Zigong in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.1 10 20 0.0 11-Apr-13 0.000 101.460 TÜV-Nord 0.000 27.190 27.190 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 7.186 10.146 10.146 10.146 10.146 10.146 10.146 10.146 10.146 10.146 2.960

412CPA0059.50 2898-0050 CPA Nb. SCHHBG-2012-050 Asia & Pacific East Asia China Luzhou in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.1 10 20 0.0 11-Apr-13 0.000 101.460 TÜV-Nord 0.000 26.966 26.966 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 7.186 10.146 10.146 10.146 10.146 10.146 10.146 10.146 10.146 10.146 2.960

413CPA0059.51 2898-0051 CPA Nb. SCHHBG-2012-051 Asia & Pacific East Asia China Luzhou in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.1 10 20 0.0 11-Apr-13 0.000 101.460 TÜV-Nord 0.000 26.966 26.966 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 7.186 10.146 10.146 10.146 10.146 10.146 10.146 10.146 10.146 10.146 2.960

414CPA0059.52 2898-0052 CPA Nb. SCHHBG-2012-052 Asia & Pacific East Asia China Dazhou in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 8.9 10 20 0.0 11-Apr-13 0.000 88.910 TÜV-Nord 0.000 23.070 23.070 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 6.298 8.891 8.891 8.891 8.891 8.891 8.891 8.891 8.891 8.891 2.593

415CPA0059.53 2898-0053 CPA Nb. SCHHBG-2012-053 Asia & Pacific East Asia China Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.1 10 20 0.0 11-Apr-13 0.000 100.860 TÜV-Nord 0.000 26.579 26.579 1 17-Oct-14 31-Dec-15 United K. (UPM) 11-Apr-13 30-Dec-99 SD Tool 9 8 1 4 6 0 No N/A MSC 7.144 10.086 10.086 10.086 10.086 10.086 10.086 10.086 10.086 10.086 2.942

416CPA0059.54 2898-0054 CPA Nb. SCHHBG-2012-054 Asia & Pacific East Asia China Luzhou in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.2 10 20 0.0 1-Feb-14 0.000 102.440 TÜV-Nord 17.375 17.375 10-Apr-18 31-Dec-15 United K. (UPM) 24-Mar-14 30-Dec-99 9 8 1 4 6 0 No N/A MSC 10.244 10.244 10.244 10.244 10.244 10.244 10.244 10.244 10.244 10.244

417CPA0059.55 2898-0055 CPA Nb. SCHHBG-2012-055 Asia & Pacific East Asia China Mianyang in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.2 10 20 0.0 1-Feb-14 0.000 102.440 TÜV-Nord 16.678 16.678 10-Apr-18 31-Dec-15 United K. (UPM) 24-Mar-14 30-Dec-99 9 8 1 4 6 0 No N/A MSC 10.244 10.244 10.244 10.244 10.244 10.244 10.244 10.244 10.244 10.244

418CPA0059.56 2898-0056 CPA Nb. SCHHBG-2012-056 Asia & Pacific East Asia China Mianyang in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.2 10 20 0.0 1-Feb-14 0.000 102.440 TÜV-Nord 16.678 16.678 10-Apr-18 31-Dec-15 United K. (UPM) 24-Mar-14 30-Dec-99 9 8 1 4 6 0 No N/A MSC 10.244 10.244 10.244 10.244 10.244 10.244 10.244 10.244 10.244 10.244

419CPA0059.57 2898-0057 CPA Nb. SCHHBG-2012-057 Asia & Pacific East Asia China Mianyang in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.2 10 20 0.0 1-Feb-14 0.000 102.440 TÜV-Nord 16.678 16.678 10-Apr-18 31-Dec-15 United K. (UPM) 24-Mar-14 30-Dec-99 9 8 1 4 6 0 No N/A MSC 10.244 10.244 10.244 10.244 10.244 10.244 10.244 10.244 10.244 10.244

420CPA0059.58 2898-0058 CPA Nb. SCHHBG-2012-058 Asia & Pacific East Asia China Mianyang in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.2 10 20 0.0 1-Feb-14 0.000 102.440 TÜV-Nord 16.678 16.678 10-Apr-18 31-Dec-15 United K. (UPM) 24-Mar-14 30-Dec-99 9 8 1 4 6 0 No N/A MSC 10.244 10.244 10.244 10.244 10.244 10.244 10.244 10.244 10.244 10.244

421CPA0059.59 2898-0059 CPA Nb. SCHHBG-2012-059 Asia & Pacific East Asia China Mianyang in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.2 10 20 0.0 1-Feb-14 0.000 102.440 TÜV-Nord 16.678 16.678 10-Apr-18 31-Dec-15 United K. (UPM) 24-Mar-14 30-Dec-99 9 8 1 4 6 0 No N/A MSC 10.244 10.244 10.244 10.244 10.244 10.244 10.244 10.244 10.244 10.244

422CPA0059.60 2898-0060 CPA Nb. SCHHBG-2012-060 Asia & Pacific East Asia China Mianyang in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.2 10 20 0.0 1-Feb-14 0.000 102.440 TÜV-Nord 16.678 16.678 10-Apr-18 31-Dec-15 United K. (UPM) 24-Mar-14 30-Dec-99 9 8 1 4 6 0 No N/A MSC 10.244 10.244 10.244 10.244 10.244 10.244 10.244 10.244 10.244 10.244

423CPA0059.61 2898-0061 CPA Nb. SCHHBG-2012-061 Asia & Pacific East Asia China Mianyang in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.2 10 20 0.0 1-Feb-14 0.000 102.440 TÜV-Nord 16.678 16.678 10-Apr-18 31-Dec-15 United K. (UPM) 24-Mar-14 30-Dec-99 9 8 1 4 6 0 No N/A MSC 10.244 10.244 10.244 10.244 10.244 10.244 10.244 10.244 10.244 10.244

424CPA0059.62 2898-0062 CPA Nb. SCHHBG-2012-062 Asia & Pacific East Asia China Mianyang in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.2 10 20 0.0 1-Feb-14 0.000 102.440 TÜV-Nord 16.678 16.678 10-Apr-18 31-Dec-15 United K. (UPM) 24-Mar-14 30-Dec-99 9 8 1 4 6 0 No N/A MSC 10.244 10.244 10.244 10.244 10.244 10.244 10.244 10.244 10.244 10.244

425CPA0059.63 2898-0063 CPA Nb. SCHHBG-2012-063 Asia & Pacific East Asia China Suining in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.2 10 20 0.0 1-Feb-14 0.000 102.440 TÜV-Nord 16.678 16.678 10-Apr-18 31-Dec-15 United K. (UPM) 24-Mar-14 30-Dec-99 9 8 1 4 6 0 No N/A MSC 10.244 10.244 10.244 10.244 10.244 10.244 10.244 10.244 10.244 10.244

426CPA0059.64 2898-0064 CPA Nb. SCHHBG-2012-064 Asia & Pacific East Asia China Neijang in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.2 10 20 0.0 1-Feb-14 0.000 102.440 TÜV-Nord 16.980 16.980 10-Apr-18 31-Dec-15 United K. (UPM) 24-Mar-14 30-Dec-99 9 8 1 4 6 0 No N/A MSC 10.244 10.244 10.244 10.244 10.244 10.244 10.244 10.244 10.244 10.244

427CPA0059.65 2898-0065 CPA Nb. SCHHBG-2012-065 Asia & Pacific East Asia China Leshan in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.2 10 20 0.0 1-Feb-14 0.000 102.440 TÜV-Nord 17.375 17.375 10-Apr-18 31-Dec-15 United K. (UPM) 24-Mar-14 30-Dec-99 9 8 1 4 6 0 No N/A MSC 10.572 10.572 10.572 10.572 10.572 10.572 10.572 10.572 10.572 10.572

428CPA0059.66 2898-0066 CPA Nb. SCHHBG-2012-066 Asia & Pacific East Asia China Yibin in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.6 10 20 0.0 1-Feb-14 0.000 105.720 TÜV-Nord 17.375 17.375 10-Apr-18 31-Dec-15 United K. (UPM) 24-Mar-14 30-Dec-99 9 8 1 4 6 0 No N/A MSC 10.572 10.572 10.572 10.572 10.572 10.572 10.572 10.572 10.572 10.572

429CPA0059.67 2898-0067 CPA Nb. SCHHBG-2012-067 Asia & Pacific East Asia China Guang'an in Sichuan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.6 10 20 0.0 1-Feb-14 0.000 105.720 TÜV-Nord 16.726 16.726 10-Apr-18 31-Dec-15 United K. (UPM) 24-Mar-14 30-Dec-99 9 8 1 4 6 0 No N/A MSC 10.572 10.572 10.572 10.572 10.572 10.572 10.572 10.572 10.572 10.572

430CPA0059.68 2898-0068 CPA Nb. SCHHBG-2012-068 Asia & Pacific East Asia China Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.2 10 20 0.0 1-Feb-14 0.000 101.540 TÜV-Nord 16.846 16.846 10-Apr-18 31-Dec-15 United K. (UPM) 24-Mar-14 30-Dec-99 9 8 1 4 6 0 No N/A MSC 10.154 10.154 10.154 10.154 10.154 10.154 10.154 10.154 10.154 10.154

431CPA0059.69 2898-0069 CPA Nb. SCHHBG-2012-069 Asia & Pacific East Asia China Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.2 10 20 0.0 1-Feb-14 0.000 102.440 TÜV-Nord 16.678 16.678 10-Apr-18 31-Dec-15 United K. (UPM) 24-Mar-14 30-Dec-99 9 8 1 4 6 0 No N/A MSC 10.244 10.244 10.244 10.244 10.244 10.244 10.244 10.244 10.244 10.244

432CPA0059.70 2898-0070 CPA Nb. SCHHBG-2012-070 Asia & Pacific East Asia China Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.2 10 20 0.0 1-Feb-14 0.000 102.440 TÜV-Nord 16.817 16.817 10-Apr-18 31-Dec-15 United K. (UPM) 24-Mar-14 30-Dec-99 9 8 1 4 6 0 No N/A MSC 10.244 10.244 10.244 10.244 10.244 10.244 10.244 10.244 10.244 10.244

433CPA0059.71 2898-0071 CPA Nb. SCHHBG-2012-071 Asia & Pacific East Asia China Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.3 10 20 0.0 1-Feb-14 0.000 102.560 TÜV-Nord 16.733 16.733 10-Apr-18 31-Dec-15 United K. (UPM) 24-Mar-14 30-Dec-99 9 8 1 4 6 0 No N/A MSC 10.256 10.256 10.256 10.256 10.256 10.256 10.256 10.256 10.256 10.256

434CPA0059.72 2898-0072 CPA Nb. SCHHBG-2012-072 Asia & Pacific East Asia China Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.4 10 20 0.0 1-Feb-14 0.000 103.950 TÜV-Nord 17.212 17.212 10-Apr-18 31-Dec-15 United K. (UPM) 24-Mar-14 30-Dec-99 9 8 1 4 6 0 No N/A MSC 10.395 10.395 10.395 10.395 10.395 10.395 10.395 10.395 10.395 10.395

435CPA0059.73 2898-0073 CPA Nb. SCHHBG-2012-073 Asia & Pacific East Asia China Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 7.6 10 20 0.0 1-Feb-14 0.000 75.650 TÜV-Nord 12.530 12.530 10-Apr-18 31-Dec-15 United K. (UPM) 24-Mar-14 30-Dec-99 9 8 1 4 6 0 No N/A MSC 7.565 7.565 7.565 7.565 7.565 7.565 7.565 7.565 7.565 7.565

436CPA0059.74 2898-0074 CPA Nb. SCHHBG-2014-074 Asia & Pacific East Asia China Yibin Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.6 10 20 0.0 1-Feb-15 0.000 105.720 TÜV-Nord 8.334 8.334 10-Apr-18 31-Dec-15 United K. (UPM) 29-Jan-15 30-Dec-99 9 8 1 4 6 0 No N/A MSC 10.572 10.572 10.572 10.572 10.572 10.572 10.572

437CPA0059.75 2898-0075 CPA Nb. SCHHBG-2014-075 Asia & Pacific East Asia China Mianyang Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.2 10 20 0.0 1-Feb-15 0.000 102.440 TÜV-Nord 7.972 7.972 10-Apr-18 31-Dec-15 United K. (UPM) 29-Jan-15 30-Dec-99 9 8 1 4 6 0 No N/A MSC 10.244 10.244 10.244 10.244 10.244 10.244 10.244

438CPA0059.76 2898-0076 CPA Nb. SCHHBG-2014-076 Asia & Pacific East Asia China Dazhou Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.2 10 20 0.0 1-Feb-15 0.000 102.440 TÜV-Nord 7.972 7.972 10-Apr-18 31-Dec-15 United K. (UPM) 29-Jan-15 30-Dec-99 9 8 1 4 6 0 No N/A MSC 10.244 10.244 10.244 10.244 10.244 10.244 10.244

439CPA0059.77 2898-0077 CPA Nb. SCHHBG-2014-077 Asia & Pacific East Asia China Ziyang Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.2 10 20 0.0 1-Feb-15 0.000 102.440 TÜV-Nord 8.334 8.334 10-Apr-18 31-Dec-15 United K. (UPM) 29-Jan-15 30-Dec-99 9 8 1 4 6 0 No N/A MSC 10.244 10.244 10.244 10.244 10.244 10.244 10.244

440CPA0059.78 2898-0078 CPA Nb. SCHHBG-2014-078 Asia & Pacific East Asia China Ziyang Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.2 10 20 0.0 1-Feb-15 0.000 102.440 TÜV-Nord 8.334 8.334 10-Apr-18 31-Dec-15 United K. (UPM) 29-Jan-15 30-Dec-99 9 8 1 4 6 0 No N/A MSC 10.244 10.244 10.244 10.244 10.244 10.244 10.244

441CPA0059.79 2898-0079 CPA Nb. SCHHBG-2014-079 Asia & Pacific East Asia China Meishan Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.2 10 20 0.0 1-Feb-15 0.000 102.440 TÜV-Nord 7.972 7.972 10-Apr-18 31-Dec-15 United K. (UPM) 29-Jan-15 30-Dec-99 9 8 1 4 6 0 No N/A MSC 10.244 10.244 10.244 10.244 10.244 10.244 10.244

442CPA0059.80 2898-0080 CPA Nb. SCHHBG-2014-080 Asia & Pacific East Asia China Neijiang Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.2 10 20 0.0 1-Feb-15 0.000 102.440 TÜV-Nord 7.972 7.972 10-Apr-18 31-Dec-15 United K. (UPM) 29-Jan-15 30-Dec-99 9 8 1 4 6 0 No N/A MSC 10.244 10.244 10.244 10.244 10.244 10.244 10.244

443CPA0059.81 2898-0081 CPA Nb. SCHHBG-2014-081 Asia & Pacific East Asia China Luzhou Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.2 10 20 0.0 1-Feb-15 0.000 102.440 TÜV-Nord 8.334 8.334 10-Apr-18 31-Dec-15 United K. (UPM) 29-Jan-15 30-Dec-99 9 8 1 4 6 0 No N/A MSC 10.244 10.244 10.244 10.244 10.244 10.244 10.244

444CPA0059.82 2898-0082 CPA Nb. SCHHBG-2014-082 Asia & Pacific East Asia China Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 8.2 10 20 0.0 1-Feb-15 0.000 81.500 TÜV-Nord 6.996 6.996 10-Apr-18 31-Dec-15 United K. (UPM) 29-Jan-15 30-Dec-99 9 8 1 4 6 0 No N/A MSC 8.150 8.150 8.150 8.150 8.150 8.150 8.150

445CPA0059.83 2898-0083 CPA Nb. SCHHBG-2014-083 Asia & Pacific East Asia China Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.6 10 20 0.0 1-Feb-15 0.000 105.530 TÜV-Nord 7.993 7.993 10-Apr-18 31-Dec-15 United K. (UPM) 29-Jan-15 30-Dec-99 9 8 1 4 6 0 No N/A MSC 10.553 10.553 10.553 10.553 10.553 10.553 10.553

446CPA0059.84 2898-0084 CPA Nb. SCHHBG-2014-084 Asia & Pacific East Asia China Leshan and Luzhou Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.2 10 20 0.0 1-Feb-15 0.000 102.440 TÜV-Nord 8.334 8.334 10-Apr-18 31-Dec-15 United K. (UPM) 29-Jan-15 30-Dec-99 9 8 1 4 6 0 No N/A MSC 10.244 10.244 10.244 10.244 10.244 10.244 10.244

447CPA0059.85 2898-0085 CPA Nb. SCHHBG-2014-085 Asia & Pacific East Asia China Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.2 10 20 0.0 1-Feb-15 0.000 102.440 TÜV-Nord 8.057 8.057 10-Apr-18 31-Dec-15 United K. (UPM) 29-Jan-15 30-Dec-99 9 8 1 4 6 0 No N/A MSC 10.244 10.244 10.244 10.244 10.244 10.244 10.244

448CPA0059.86 2898-0086 CPA Nb. SCHHBG-2014-086 Asia & Pacific East Asia China Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.3 10 20 0.0 1-Feb-15 0.000 103.120 TÜV-Nord 8.047 8.047 10-Apr-18 31-Dec-15 United K. (UPM) 29-Jan-15 30-Dec-99 9 8 1 4 6 0 No N/A MSC 10.312 10.312 10.312 10.312 10.312 10.312 10.312

449CPA0059.87 2898-0087 CPA Nb. SCHHBG-2014-087 Asia & Pacific East Asia China Registered Methane avoidance Methane avoidance Domestic manure 4,601 household biogas systems AMS-III.R.+AMS-I.I. 1 10.4 10 20 0.0 1-Feb-15 0.000 104.490 TÜV-Nord 8.334 8.334 10-Apr-18 31-Dec-15 United K. (UPM) 29-Jan-15 30-Dec-99 9 8 1 4 6 0 No N/A MSC 10.449 10.449 10.449 10.449 10.449 10.449 10.449

450PoA0060 VWRWQDZGUIHMK133RRH3TKQNTN31KL 6826 Latin America South America Peru Peru Repsol YPF Comercial del Perú Registered Fossil fuel switch Fossil fuel switch Oil to LPG AMS-III.B. 1 0.2 4-Nov-00 28 0.000 2.090 AENOR 0.000 n.a. Garrigues Medio Ambiente 4-Nov-10 30-Mar-12 PoA0269 14-Mar-11 17-Dec-12 29-Jan-13 17-Dec-12 PoA 30-Dec-99PoA 1 6 11 9 6 0 0.0 No N/A

451CPA0060.01 6826-0001 Latin America South America Peru City of Ica Repsol YPF Comercial del Perú Registered Fossil fuel switch Fossil fuel switch Oil to LPG AMS-III.B. 1 0.2 10 10 0.0 1-Mar-13 0.000 2.090 AENOR n.a. Garrigues Medio Ambiente 4-Nov-10 30-Mar-12 CPA0269.01 17-Dec-12 30-Dec-99 1 6 11 9 6 1 Mexico Italy No N/A 0.174 0.209 0.209 0.209 0.209 0.209 0.209 0.209 0.209 0.209 0.035

452PoA0061 7N1V6GU9NH6QDKUCKT07T03X74EVA9 6283 Distribution of fuel-efficient improved cooking stoves in Nigeria Africa West Africa Nigeria Nigeria C-Quest Capital Registered EE households EE households Stoves AMS-II.G. 4 168.6 1-Oct-12 28 11.679 1,686.470 DNV 0.000 60.052 60.052 1 28-Dec-15 31-Jan-16 Earthhood Netherlands (VROM), Sweden (Government of Sweden) C Quest Capital, HED Consulting 9-Nov-10 2-Feb-11 7-Nov-12 2-Jan-13 6-Jun-12 PoA 30-Dec-99PoA Gold Standard 1 6 4 8 EcoZoom USA USA 0.0

453CPA0061.01 6283-0001 Distribution of fuel-efficient improved cooking stoves in Nigeria - CPA 001 Africa West Africa Nigeria Kaduna State C-Quest Capital Registered EE households EE households Stoves AMS-II.G. 1 46.7 10 10 0.0 1-Oct-12 11.679 467.170 DNV 37.264 37.264 1 28-Dec-15 31-Jan-16 Earthhood Netherlands (VROM), Sweden (Government of Sweden) C Quest Capital, HED Consulting 9-Nov-10 6-Jun-12 30-Dec-99 1 6 4 8 0 EcoZoom USA USA No MSC 45.148 45.148 11.679 46.717 46.717 46.717 46.717 46.717 46.717 46.717 46.717 46.717 35.038

454CPA0061.02 6283-0002 Distribution of fuel-efficient improved cooking stoves in Nigeria – CPA 002 Africa West Africa Nigeria Kano State C-Quest Capital Registered EE households EE households Stoves ICS (stoves) AMS-II.G. 1 39.9 10 10 0.0 1-Feb-15 399.430 DNV 13.940 13.940 1 28-Dec-15 31-Jan-16 Earthhood C Quest Capital, HED Consulting 9-Nov-10 30-Jan-15 30-Dec-99 1 6 4 8 0 EcoZoom USA No MSC 21.022 42.045 42.045 42.045 42.045 42.045 42.045 42.045 42.045 42.045

455CPA0061.03 6283-0003 Distribution of fuel-efficient improved cooking stoves in Nigeria – CPA 003 Africa West Africa Nigeria Kaduna State C-Quest Capital Registered EE households EE households Stoves ICS (stoves) AMS-II.G. 1 39.9 10 10 0.0 1-Feb-15 399.430 DNV 8.848 8.848 1 28-Dec-15 31-Jan-16 Earthhood C Quest Capital, HED Consulting 9-Nov-10 30-Jan-15 30-Dec-99 1 6 4 8 0 EcoZoom USA No MSC 21.022 42.045 42.045 42.045 42.045 42.045 42.045 42.045 42.045 42.045

456CPA0061.04 6283-0004 Distribution of fuel-efficient improved cooking stoves in Nigeria – CPA 004 Africa West Africa Nigeria C-Quest Capital Registered EE households EE households Stoves TLC Rocket Stove AMS-II.G. 1 42.0 10 10 0.0 13-Oct-16 420.440 DNV C Quest Capital, HED Consulting 9-Nov-10 13-Oct-16 30-Dec-99 1 6 4 8 0 No MSC 42.044 42.044 42.044 42.044 42.044 42.044 42.044 42.044 42.044 42.044

457PoA0062 8M4PPYQK5DXE7Q5W6G8UMAHX9TVF14 7014 Improved Cook Stoves for East Africa (ICSEA) Africa East Africa Uganda Registered EE households EE households Stoves AMS-I.E.+AMS-II.G. 9 738.6 1-Apr-11 28 0.000 3,167.339 TÜV-Rhein 2.193 1.859 4.052 1 28-Oct-14 14-Mar-13 Germany (Commerzbank), Switzerland (Gold Standard) Uganda Carbon Bureau 11-Nov-10 26-Aug-11 17-Aug-12 30-Oct-12 17-Aug-12 CPA 30-Dec-99CPA Gold Standard 1 6 4 8 5 0.0 MSC

458CPA0062.01 7014-0001 International Lifeline Fund Uganda CPA 1 (ILFUg1) Africa East Africa Uganda Uganda Registered EE households EE households Stoves AMS-I.E.+AMS-II.G. 1 40.6 7 21 7.0 15-Sep-12 336.734 TÜV-Rhein 2.193 1.859 4.052 1 28-Oct-14 14-Mar-13 Germany (Commerzbank), Switzerland (Gold Standard) Uganda Carbon Bureau 11-Nov-10 17-Aug-12 30-Dec-99 1 6 4 8 5 0 177.5 No MSC 16.389 36.756 41.669 42.603 42.603 42.603 42.603 42.603 42.603 42.603 42.603 42.603 42.603 42.603 42.603 42.603 42.603 42.603 42.603 42.603 42.603

459CPA0062.02 7014-0002 COFFEE A CUP Uganda CPA 1 (CACUg01) Africa East Africa Uganda Uganda Registered EE households EE households Stoves AMS-I.E.+AMS-II.G. 1 80.5 7 21 0.0 1-Oct-16 342.252 TÜV-Rhein Uganda Carbon Bureau 11-Nov-10 24-Sep-16 30-Dec-99 1 6 4 8 5 0 MSC 80.491 80.491 80.491 80.491 80.491 80.491 80.491

460CPA0062.03 7014-0003 ECOTRUST Uganda CPA 1 (ECTUg01) Africa East Africa Uganda Uganda Registered EE households EE households Stoves AMS-I.E.+AMS-II.G. 1 80.5 7 21 0.0 1-Oct-16 342.252 TÜV-Rhein Uganda Carbon Bureau 11-Nov-10 24-Sep-16 30-Dec-99 1 6 4 8 5 0 MSC 80.491 80.491 80.491 80.491 80.491 80.491 80.491

461CPA0062.04 7014-0004 GCCE Uganda CPA 1 (GCCEUg01) Africa East Africa Uganda Uganda Registered EE households EE households Stoves AMS-I.E.+AMS-II.G. 1 80.5 7 21 0.0 1-Oct-16 342.252 TÜV-Rhein Uganda Carbon Bureau 11-Nov-10 24-Sep-16 30-Dec-99 1 6 4 8 5 0 MSC 80.491 80.491 80.491 80.491 80.491 80.491 80.491

462CPA0062.05 7014-0005 Solar Sister Uganda CPA 1 (SSUg01) Africa East Africa Uganda Uganda Registered EE households EE households Stoves AMS-I.E.+AMS-II.G. 1 101.8 7 21 0.0 1-Oct-16 432.710 TÜV-Rhein Uganda Carbon Bureau 11-Nov-10 24-Sep-16 30-Dec-99 1 6 4 8 5 0 MSC 101.765 101.765 101.765 101.765 101.765 101.765 101.765

463CPA0062.06 7014-0006 UGASTOVE Uganda CPA 1 (UGSUg01) Africa East Africa Uganda Uganda Registered EE households EE households Stoves AMS-I.E.+AMS-II.G. 1 115.7 7 21 0.0 1-Nov-16 482.328 TÜV-Rhein Uganda Carbon Bureau 11-Nov-10 1-Nov-16 30-Dec-99 1 6 4 8 5 0 MSC 43.598 43.598 43.598 43.598 43.598 43.598 43.598

In frastructure Development Company

Col lection and destruction of 906,250 incandescent lamps (ICLs) and subsequent replacement o f equal amount of compact flourescent lamps (CFLs)

To instal l SWH in residentia l as wel l as commercial buildings throughout Ind ia

Col lection and destruction of 906,250 incandescent lamps (ICLs) and subsequent replacement o f equal amount of compact flourescent lamps (CFLs)

Financial ;Other;Prevail ing practice;Technological

To transform fuel-e fficiency of Mexico ’s tradi tional residentia l cookingsystems by distributing up to 50,000 stoves to households each year

Distribution and capaci ty bu ild ing for the insta lla tion of 1000ONIL Stoves

Financial ;Investment;Other

Henan Province Zhoukou City Rura l Household Biogas Development Programme (2007-2010)

Zhoukou city, Henan

Zhoukou New Energy Development Co.

To set up 600,000 b iogas plants (digesters) and theirauxiliary facili ties for gas collection and gas use

Chinese Academy of Social Sciences, Beij ing Oriental Carbon Credits Environmental Technologies

The 1st CPA of Henan Province Zhoukou City Rural Household Biogas Development Programme

Wangdian Town, Huaiyang County

Zhoukou New Energy Development Co.

1021 biogas d igesters and the ir auxiliary facilities for gas collection and gas use

Chinese Academy of Social Sciences, Beij ing Oriental Carbon Credits Environmental Technologies

Investment;Technological

Vietnams Ministry of Industry and Trade

To increase the supply of electricity to the Vietnam national grid from renewable energy resources primarily hydro on a commercial ly s ustainable basis

Sweden (IBRD), Spain (Government of Spain), Norway (Norwegian Min istry o f Finance)

RCEE, Vietnams Ministry of Industry and Trade

Vietnam Renewable Energy Development Program: REDP1 - Sung Vui Hydropower Project

Nam Tien Construction Investment and Commercial Join t Stock Company

Sweden (IBRD), Spain (Government of Spain), Norway (Norwegian Min istry o f Finance)

RCEE, Vietnams Ministry of Industry and Trade

Benchmark analysis

Nam Tien Construction Investment and Commercial Join t Stock Company

Sweden (IBRD), Spain (Government of Spain), Norway (Norwegian Min istry o f Finance)

RCEE, Vietnams Ministry of Industry and Trade

Benchmark analysis

Nam Tien Construction Investment and Commercial Join t Stock Company

Sweden (IBRD), Spain (Government of Spain), Norway (Norwegian Min istry o f Finance)

RCEE, Vietnams Ministry of Industry and Trade

Benchmark analysis

Nam Tien Construction Investment and Commercial Join t Stock Company

Sweden (IBRD), Spain (Government of Spain), Norway (Norwegian Min istry o f Finance)

RCEE, Vietnams Ministry of Industry and Trade

Benchmark analysis

Nam Tien Construction Investment and Commercial Join t Stock Company

Sweden (IBRD), Spain (Government of Spain), Norway (Norwegian Min istry o f Finance)

RCEE, Vietnams Ministry of Industry and Trade

Benchmark analysis

Ministry of Industry and Trade of V ietnam (MOIT)

Sweden (IBRD), Spain (Government of Spain), Norway (Norwegian Min istry o f Finance)

General Di rectorate of Energy, Ministry of Industry and Trade (MOIT)

Benchmark analysis

Ministry of Industry and Trade of V ietnam (MOIT)

Sweden (IBRD), Spain (Government of Spain), Norway (Norwegian Min istry o f Finance)

General Di rectorate of Energy, Ministry of Industry and Trade (MOIT)

Benchmark analysis

Ministry of Industry and Trade of V ietnam (MOIT)

Sweden (IBRD), Spain (Government of Spain), Norway (Norwegian Min istry o f Finance)

General Di rectorate of Energy, Ministry of Industry and Trade (MOIT)

Benchmark analysis

Ministry of Industry and Trade of V ietnam (MOIT)

Sweden (IBRD), Spain (Government of Spain), Norway (Norwegian Min istry o f Finance)

General Di rectorate of Energy, Ministry of Industry and Trade (MOIT)

Benchmark analysis

Ministry of Industry and Trade of V ietnam (MOIT)

Sweden (IBRD), Spain (Government of Spain), Norway (Norwegian Min istry o f Finance)

General Di rectorate of Energy, Ministry of Industry and Trade (MOIT)

Benchmark analysis

Ministry of Industry and Trade of V ietnam (MOIT)

Sweden (IBRD), Spain (Government of Spain), Norway (Norwegian Min istry o f Finance)

General Di rectorate of Energy, Ministry of Industry and Trade (MOIT)

Benchmark analysis

Ministry of Industry and Trade of V ietnam (MOIT)

Sweden (IBRD), Spain (Government of Spain), Norway (Norwegian Min istry o f Finance)

General Di rectorate of Energy, Ministry of Industry and Trade (MOIT)

Benchmark analysis

Ministry of Industry and Trade of V ietnam (MOIT)

Sweden (IBRD), Spain (Government of Spain), Norway (Norwegian Min istry o f Finance)

General Di rectorate of Energy, Ministry of Industry and Trade (MOIT)

Benchmark analysis

To transform the fuel-e fficiency of Guatemala’s trad itional home cookingsystems by distributing up to 470,000 efficient stoves to households

Financial ;Investment;Other;Prevailing practice

Financial ;Investment;Other;Prevailing practice

Henan Province Shangqiu City Rura l Household Biogas Development Programme (2008-2012)

Shangqiu Ci ty, Henan

Shangqiu Fengji Biogas Technology Service Co.

To set up 225,000 b iogas digesters andthei r auxil iary facil ities for gas col lection and gas use

Beij ing Oriental Carbon Credits Environmental Technologies

Henan Province Shangqiu City Yongcheng County Mangshan Town Rural Household Biogas Development Programme activity in 2008---CPA1

Shangqiu City Yongcheng County Mangshan Town

Shangqiu Fengji Biogas Technology Service Co.

2,600 biogas digesters and thei r auxiliary facilitiesfor gas col lection and gas use

Beij ing Oriental Carbon Credits Environmental Technologies

Investment;Other;Technological

Loc al Sel f GovernmentDepartment, Rajasthan

Implementing Solid Wastecomposting in towns and urban local bodies in sta te of Rajasthan of India

Urban Sol id Waste Composting Project in Alwar city under the Rajasthan urban sol id waste composting Programme of Activity

Loc al Sel f GovernmentDepartment, Rajasthan

Facili ty for treatment of MSW through composting technology

Financial ;Other;Technological

Ministry of Agricu lture and Rura l Development (MARD)

To reduce GHG emissions from fossil fue ls used by instal ling biogas d igesters in households inVietnam

11 North-East Provinces

Investment;Prevailing practice;Technological

Biogas Micro-digester Promoting Program for Rural Farmer Households in Chongqing

Beij ing Chizi Hengyuan Huanbao Kej i

To disseminate domestic biogas micro-digesters in the Chongqing rural area through demonstrating well-establishedtechnical approaches and innovative business model u ti lizing a carbon benefi t from CDM

Biogas Micro-digester In troductions to Rura l Households in Kaixian of Chongqing, China (CPA-KX-1)

Beij ing Chizi Hengyuan Huanbao Kej i

Installations of 756 Biogas Micro-digesters and rela ted equipments

Investment;Prevailing practice;Technological

To reduce CO2 emissions in SA through the avoidance of electricity generated for the purposes of heating water for domestic use

South African Solar Water Heater (SWH) Programme SSC-CPA – Number One

Investment;Prevailing practice

Investment comparison analysis

Tecnologías Ecológicas Centroamericanas (TECSA)

To transform the energy efficiency of El Salvador‟s residential and scholar cooking stoves

Tecnologías Ecológicas Centroamericanas (TECSA)

Financial ;Investment;Prevai ling practice;Technological

Cl imate Action Response Enterprise (CARE) for Energy Efficiency in Chiller Plants

To help achieve Energy Efficiency and reduce consumption of e lectrici ty inSingapore in turn leading to a reduction in GHG emissions from burning of fossil fue ls frompower generation

Energy Efficiency in Chi ller Plant at the Galen Build ing in Singapore Science Park II (The Galen CPA)

Singapore (The CAPRICORN bui lding)

Achieving an energy efficiency coefficient of 0 .65kw/TRor better in ch iller plants of bu ild ings

To manufacture and d istribute energy efficient CFLs to rep lace or avoid usage of ILs

Manufacture and distribution of CFLs in Golloguda hamlet of Andra Pradesh in Ind ia

Investment;Prevailing practice

Solar A cademy of Sub Saharan Africa

To supply, install , and finance solar water heaters to provide hot water services for low income households in South Africa

Nelson Mandela Bay, Ekurhuleni Municipa lities

Solar A cademy of Sub Saharan Africa

59000 Low pressure vacuum tube Solar water heaters

Investment;Other;Technological

Simple cost analysis

Solar A cademy of Sub Saharan Africa

31500 Low pressure vacuum tube Solar water heaters

Investment;Other;Technological

Solar A cademy of Sub Saharan Africa

31500 Low pressure vacuum tube Solar water heaters

Solar A cademy of Sub Saharan Africa

31500 Low pressure vacuum tube Solar water heaters

Solar A cademy of Sub Saharan Africa

31500 Low pressure vacuum tube Solar water heaters

Solar A cademy of Sub Saharan Africa

31500 Low pressure vacuum tube Solar water heaters

Solar A cademy of Sub Saharan Africa

31500 Low pressure vacuum tube Solar water heaters

Department of Energy, Republic of Phil ipp ines

To improve the energy efficiency of residential lighting stock by d istributing up to13 mi llion CFLs to households

Luzon, Cagayan Valley, Central Luzon

Department of Energy, Republic of Phil ipp ines

2.228 mill ion h igh qual ity Compact Fluorescent Lamps (CFLs)

Other;P revai ling practice;Technological

Landfil l gas recovery and combustion wi th renewable energy generation from sanitary landfill si tes under Land Bank of the Phi lippines Carbon Finance Support Facili ty

To address waste regulations in the Phi lippines, by encouraging i ts compliance through participation of implementers in the program

CPA-1: Landfil l gas recovery and combustion wi th renewable energy generation from Bulacan Sanitary landfil l site under Land Bank of the Phi lippines Carbon Finance Support Facil ity

Col lection of landfill gas (LFG) and its flare and use for energy generation

Benchmark analysis

Landfil l gas recovery and combustion wi th renewable energy generation from Rizal Provincia l Sani tary Landfill Pro ject (RPSLP) site under Land Bank of the Phi lippines Carbon Finance Support Faci lity

Col lection of landfill gas (LFG) and its flare and use for energy generation

To sign ificantly contribute towards energy efficiency measures by reducing theconsumption of e lectrici ty in building cooling systems

Energy efficiency measures in cooling systems at New Tech Park, 151 Lorong Chuan, Singapore

Singapore (Lorong Chuan)

Modi fication/replacement o f one or morecomponents in the existing cooling system with more efficient components

Investment;Prevailing practice;Technological

The composition of waste heat network for environmental ly friendly industrial complex

Korea Industria l Complex Corporation (KICOX)

To make an Eco-Industria l Park targeting five reg ional industria l sites

The construction of renewable energy supply network using waste heat from dyeing complexes wastes

Korea Industria l Complex Corporation (KICOX)

Re-cycl ing waste heat water from dyeing complex and insta lla tions the heat pump

Investment;Technological

Significant reduction of GHG emiss ionscompared with what would occur in the absence of the pro ject and to promote sustainabili ty in the cattlelivestock industry, generating social , environmental and economic benefits

BR_MT – Estância Bahia_AMB001 integrated of PoA “AWMS Composting Project”

Composting plant and the use of wastewater for co-composting

Investment;Other;Prevail ing practice;Technological

Simple cost analysis

BR_MT – São Marcelo_AMB002 in tegrated of PoA “AWMS Composting Project

Composting plant and the use of wastewater for co-composting

Investment;Other;Prevail ing practice;Technological

To provide the necessary incentives to small and medium-sizedindustria l consumers of residual fue l oil to undertake a fue l switch to a low-carbon fuel : liquefiedpetro leum gas (LPG)

“Project activity to swi tch from residual fuel o il to LPG at a PRODUMAR SAC fish processing plant in Peru”.

Benchmark analysis

SWAMPA–Brazi l (Sustainable Swine Waste Management Programme of Latin America – B razil)

To help Brazil to fulfil l its goals of promoting susta inable development

Investment;Prevailing practice;Technological

Simple cost analysis

To enhance the energy efficiency of public streetlight in Korea through application of efficient LED lighting

The programme to promote efficient l ightings in loca l areas – CPA(2009-01, Gwangju ci ty)

LED (L ight Emitting Diode) lamp in streetlight

The programme to promote efficient l ightings in loca l areas – <2012-01, Gwangju>

LED (L ight Emitting Diode) lamps in streetlightsLED (L ight Emitting Diode) lamps in streetlights

The programme to promote efficient l ightings in loca l areas – <2012-01, Suncheon City Hall>

LED (L ight Emitting Diode) lamps in streetlights

The programme to promote efficient l ightings in loca l areas – <2012-01, Incheon>

LED (L ight Emitting Diode) lamps in streetlights

The programme to promote efficient l ightings in loca l areas – <2012-01, Incheon International Airport Corporation>

LED (L ight Emitting Diode) lamps in streetlightsLED (L ight Emitting Diode) lamps in streetlights

Daegu Metropoli tan City

LED (L ight Emitting Diode) lamps in streetlights

Busan Metropol itan City

LED (L ight Emitting Diode) lamps in streetlightsLED (L ight Emitting Diode) lamps in streetlights

Incheon In ternational Ai rport

LED (L ight Emitting Diode) lamps in streetlights

Yeosu Gwangyang Port

LED (L ight Emitting Diode) lamps in streetlights

Busan, Chungju, Damyang and Suwon

LED (L ight Emitting Diode) lamps in streetlights

Buk-gu, Busan In frastructure Corporation, Dong-gu, Sasang-gu, Saha-gu, Suyeong-gu,Jin-gu

LED (L ight Emitting Diode) lamps in streetlights

Fonds d ’Equipement Communal (FEC)

To avoid methane emissions from Municipal waste landfi lls in Morocco by promoting landfi ll gas (LFG) capture and flaring or util ization projects

LED (L ight Emitting Diode) lamps in streetlights

Rabat-Salé-Zemmour-Zaer

Fonds d ’Equipement Communal (FEC)

Investment;Technological

Benchmark analysis

Investment and Trade Consultancy Company (INTRACO)

To develop a p latform for overcoming insti tu tional, financial and structural hurdles for the construction of a series of small hydro projects

Investment and Trade Consultancy Company (INTRACO)

To develop a p latform for overcoming insti tu tional, financial and structural hurdles for the construction of a series of small hydro projects

Investment and Trade Consultancy Company (INTRACO)

To develop a p latform for overcoming insti tu tional, financial and structural hurdles for the construction of a series of small hydro projects

Benchmark analysis

Investment and Trade Consultancy Company (INTRACO)

To develop a p latform for overcoming insti tu tional, financial and structural hurdles for the construction of a series of small hydro projects

Investment and Trade Consultancy Company (INTRACO)

To develop a p latform for overcoming insti tu tional, financial and structural hurdles for the construction of a series of small hydro projects

Investment and Trade Consultancy Company (INTRACO)

To develop a p latform for overcoming insti tu tional, financial and structural hurdles for the construction of a series of small hydro projects

Investment and Trade Consultancy Company (INTRACO)

To develop a p latform for overcoming insti tu tional, financial and structural hurdles for the construction of a series of small hydro projects

Investment and Trade Consultancy Company (INTRACO)

To develop a p latform for overcoming insti tu tional, financial and structural hurdles for the construction of a series of small hydro projects

Investment and Trade Consultancy Company (INTRACO)

To develop a p latform for overcoming insti tu tional, financial and structural hurdles for the construction of a series of small hydro projects

Investment and Trade Consultancy Company (INTRACO)

To develop a p latform for overcoming insti tu tional, financial and structural hurdles for the construction of a series of small hydro projects

Benchmark analysis

Investment and Trade Consultancy Company (INTRACO)

To develop a p latform for overcoming insti tu tional, financial and structural hurdles for the construction of a series of small hydro projects

Benchmark analysis

Investment and Trade Consultancy Company (INTRACO)

To develop a p latform for overcoming insti tu tional, financial and structural hurdles for the construction of a series of small hydro projects

Benchmark analysis

Investment and Trade Consultancy Company (INTRACO)

To develop a p latform for overcoming insti tu tional, financial and structural hurdles for the construction of a series of small hydro projects

Benchmark analysis

Investment and Trade Consultancy Company (INTRACO)

To develop a p latform for overcoming insti tu tional, financial and structural hurdles for the construction of a series of small hydro projects

To sign ificantly contribute towards energy efficiency measures by reducing theconsumption of e lectrici ty in building lighting systems

Replacement of existing luminaires wi th LED lighting luminaires in several bu ild ings across Jurong Town, Singapore.

Replacement of existing luminai res with moreenergy efficient “L ight Emitting Diodes”

Investment;Other;Prevail ing practice;Technological

To implement the rura l household b iogas digester programme taking on board thefinancia l institutions, farmers and local NGOs

AMS-III.R.+AMS-I.E.+AMS-I.C.

CPA Latur - Methane abatement and household biogas uti lization programme in India

Biogas digester un its a t thehousehold level

AMS-III.R.+AMS-I.E.+AMS-I.C.

Investment;Other;Prevail ing practice;Technological

Caixa Econômica Federa l Solid Waste Management and Carbon Finance Project

To promote the implementation of LFG capture and combustion/energy generation/distribution systems through the CDM to mitigate the GHG emissions

Switch from fossil fue l to p iped landfil l gas

CPA-1: Landfil l gas recovery, energy generation and biogas distribution from CTR Santa Rosa

Switch from fossil fue l to p iped landfil l gas

LFG collection system with capture of biogas to generate e lec trici ty

Benchmark analysis

Chengdu Oasis Science and Technology Co.

To reduce a large amount of greenhouse gases (GHG) by facil itating the instal lationof a large number of household biogas digesters

Oasis Science and Technology Development Bei jing

SD Tool, Gold Standard

Sichuan Rural Poor-Household Biogas Development Programme, CPA Nb. SCHHBG-2010-001

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Guangan, Dazhou and Leshan in Sichuan

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Guang'an, Dazhou, Meishan, Leshan, Luzhou, Aba and Ganzi in Sichuan

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Mianyang and Meishan in Sichuan

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Mianyang and Nei jiang in Sichuan

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Yibin, Suining and Nei jiang in Sichuan

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Yibin and Ziyang in Sichuan

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Ziyang and Zigong in Sichuan

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Guangan and Dazhou

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Guangan and Leshan

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Mianyang, Meishan and Luzhou

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Yibin, Mianyang, Suin ing and Nei jiang

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Yibin, Ziyang and Zigong

Chengdu Oasis Science and Technology Co.

Oasis Science and Technology Development Bei jing

Programme of activities to switch from residual fuel o il to LPG in manufacturing industries in Peru

To provide the necessary incentives to small and medium-sizedindustria l consumers of residual fue l oil to undertake a fue l switch to a low-carbon fuel : liquefiedpetro leum gas (LPG)

Project activity to swi tch from residual fuel o il to LPG at a Agroindustrias AIB food processing p lant in Peru

Fuel swi tch from residual fuel o il to low-carbon fuel : liquefied petro leum gas(LPG).

Benchmark analysis

To introduce cleaner, more effic ient improved cooking stoves (ICS) to manyperi-urban and rural households across Nigeria

13,925 StoveTec improved cooking stoves (ICS)

Kano State and Kaduna State

Burundi, Kenya, Rwanda, Uganda

Improved Cook Stoves for East Africa (ICSEA)

To make improved cook stoves (ICS) affordable and available to low and medium income households across East Africa

Improved Cook Stoves for East Africa (ICSEA)

―Okelo Kuc‖ brand of charcoal improved cook stoves (ICS)

Financial ;Investment;Prevai ling practice

Improved Cook Stoves for East Africa (ICSEA)

This CPA shall be active in the production, marketing, distribution and sales of portable/fixed, domestic/institutional , charcoal /firewood improved cook stoves (ICS)

Improved Cook Stoves for East Africa (ICSEA)

This CPA shall in itial ly distribute the In ternational Lifel ine Fund (ILF) Rural Wood Stove (Eco Smart Wood Stove)

Improved Cook Stoves for East Africa (ICSEA)

This CPA shall be active in the production, marketing, distribution and sales of portable/fixed, domestic/institutional , charcoal /firewood improved cook stoves (ICS)

Improved Cook Stoves for East Africa (ICSEA)

This CPA shall be active in the production, marketing, distribution and sales of portable/fixed, domestic/institutional , charcoal /firewood improved cook stoves (ICS)

Improved Cook Stoves for East Africa (ICSEA)

This CPA shall be active in the production, marketing, distribution and sales of portable/fixed, domestic/institutional , charcoal /firewood improved cook stoves (ICS)

464CPA0062.07 7014-0007 RDIS Rwanda CPA 1 (RDISRw01) Africa East Africa Rwanda Rwanda Registered EE households EE households Stoves AMS-I.E.+AMS-II.G. 1 71.3 7 21 0.0 1-Nov-16 296.941 TÜV-Rhein Uganda Carbon Bureau 11-Nov-10 1-Nov-16 30-Dec-99 1 6 4 8 5 0 MSC 46.471 46.471 46.471 46.471 46.471 46.471 46.471

465CPA0062.08 7014-0008 James Finlay Kenya CPA 1 (JFKKe01) Africa East Africa Kenya Kenya Registered EE households EE households Stoves AMS-I.E.+AMS-II.G. 1 82.0 7 21 0.0 1-Nov-16 341.600 TÜV-Rhein Uganda Carbon Bureau 11-Nov-10 1-Nov-16 30-Dec-99 1 6 4 8 5 0 MSC 81.975 81.975 81.975 81.975 81.975 81.975 81.975

466CPA0062.09 7014-0009 Aid Africa Uganda CPA 1 (AAUg01) Africa East Africa Uganda Uganda Registered EE households EE households Stoves AMS-I.E.+AMS-II.G. 1 85.9 7 21 0.0 1-Feb-18 250.270 TÜV-Rhein Uganda Carbon Bureau 11-Nov-10 24-Jan-18 30-Dec-99 1 6 4 8 5 0 MSC 85.854 85.854 85.854 85.854 85.854 85.854 85.854

467PoA0063 EJUWFRLEREOEC2SSIGC8XQKTXATSDN 5067 Improved Cooking Stoves for Nigeria Programme of Activities Africa West Africa Nigeria Nigeria Registered EE households EE households Stoves AMS-II.G. 5 99.1 29-Mar-11 28 11.181 990.740 TÜV-Nord 6.561 57.929 64.490 3 5-Feb-14 30-Jun-15 Carbon Check Germany (Atmosfair) atmosfair, Lernen-Helfen-Leben 20-Nov-10 18-Dec-10 10-Nov-11 10-Nov-11 PoA 30-Dec-99PoA Gold Standard 1 6 4 8 5 9 0.0 MSC Yes

468CPA0063.01 5067-0001 CPA # 1 Improved Cooking Stoves for Nigeria Africa West Africa Nigeria Nigeria Registered EE households EE households Stoves “SAVE80” efficient cooking stoves AMS-II.G. 1 8.9 10 13 -0.5 1-Jan-12 5.780 89.120 TÜV-Nord 5.655 19.083 24.738 3 5-Feb-14 30-Jun-15 Germany (Atmosfair) atmosfair, Lernen-Helfen-Leben 20-Nov-10 10-Nov-11 30-Dec-99 1 6 4 8 5 9 1 Germany No N/A MSC 5.780 11.270 10.707 10.171 9.663 9.180 8.721 8.285 7.870 7.477

469CPA0063.02 5067-0002 CPA # 2 Improved Cooking Stoves for Nigeria Africa West Africa Nigeria Nigeria Registered EE households EE households Stoves “SAVE80” efficient cooking stoves AMS-II.G. 1 11.3 10 13 0.0 15-Jul-12 2.692 112.900 TÜV-Nord 0.611 17.737 18.348 2 7-Aug-15 30-Jun-15 atmosfair, Lernen-Helfen-Leben 11-Jul-12 30-Dec-99 1 6 4 8 5 9 1 Germany No N/A MSC Yes 2.692 11.559 11.559 11.559 11.559 11.559 11.559 11.559 11.559 11.559 11.559 6.175

470CPA0063.03 5067-0003 CPA # 3 Improved Cooking Stoves for Nigeria Africa West Africa Nigeria Nigeria Registered EE households EE households Stoves AMS-II.G. 1 11.4 10 13 0.0 15-Jul-12 2.709 113.560 TÜV-Nord 0.295 11.476 11.771 2 7-Aug-15 30-Jun-15 atmosfair, Lernen-Helfen-Leben 11-Jul-12 30-Dec-99 1 6 4 8 5 9 1 No N/A MSC Yes 2.709 11.627 11.627 11.627 11.627 11.627 11.627 11.627 11.627 11.627 11.627 6.211

471CPA0063.04 5067-0004 CPA # 4 Improved Cooking Stoves for Nigeria Africa West Africa Nigeria Nigeria Registered EE households EE households Stoves AMS-II.G. 1 33.7 10 13 0.0 1-Jun-13 0.000 336.600 TÜV-Nord 9.633 9.633 1 18-May-17 30-Jun-15 atmosfair, Lernen-Helfen-Leben 29-May-13 30-Dec-99 1 6 4 8 5 9 1 No N/A MSC 4.800 9.600 9.600 9.600 9.600 9.600 9.600 9.600 9.600 9.600

472CPA0063.05 5067-0005 CPA # 5 Improved Cooking Stoves for Nigeria Africa West Africa Nigeria Nigeria Registered EE households EE households Stoves AMS-II.G. 1 33.9 10 13 0.0 1-Jun-13 0.000 338.560 TÜV-Nord 30-Jun-15 atmosfair, Lernen-Helfen-Leben 29-May-13 30-Dec-99 1 6 4 8 5 9 1 No N/A MSC 5.625 11.250 11.250 11.250 11.250 11.250 11.250 11.250 11.250 11.250 11.250

473PoA0064 M7SPUGYM23YSP2MHCZSQJOJ9WXVS6I 5034 Malaysia Biogas Projects Asia & Pacific Southeast Asia Malaysia Malaysia GenPower Carbon Solutions Registered Methane avoidance Methane avoidance Palm oil waste AMS-III.H. 6 253.2 23-Nov-11 28 75.968 2,532.330 BV Cert 0.000 United K. (GenPower Carbon Solutions) GenPower Carbon Solutions 23-Nov-10 28-Apr-11 23-Nov-11 23-Nov-11 CPA 30-Dec-99CPA 1 3 5 11 7 8 5.0

474CPA0064.01 5034-0001 Sri Senggora Biogas Project (SS 33610255-1) Asia & Pacific Southeast Asia Malaysia GenPower Carbon Solutions Registered Methane avoidance Methane avoidance Palm oil waste AMS-III.H. 1 38.1 10 30 0.0 1-Jan-11 75.968 381.390 BV Cert United K. (GenPower Carbon Solutions) GenPower Carbon Solutions 23-Nov-10 23-Nov-11 30-Dec-99 1 3 5 11 7 8 -2 1.0 No 3 38.139 38.139 38.139 38.139 38.139 38.139 38.139 38.139 38.139 38.139

475CPA0064.02 5034-0002 SYNN Biogas Project (SYNN 45110043-2) Asia & Pacific Southeast Asia Malaysia Taiping, Perak GenPower Carbon Solutions Registered Methane avoidance Methane avoidance Palm oil waste AMS-III.H. 1 41.0 10 30 0.0 1-Feb-13 0.000 410.350 BV Cert GenPower Carbon Solutions 2-May-12 30-Dec-99 1 3 5 11 9 8 -2 0.673 No Investment 3 41.035 41.035 41.035 41.035 41.035 41.035 41.035 41.035 41.035 41.035

476CPA0064.03 5034-0003 Pontian Fico Biogas Project (PF 52511808-3) Asia & Pacific Southeast Asia Malaysia GenPower Carbon Solutions Registered Methane avoidance Methane avoidance Palm oil waste AMS-III.H. 1 52.2 10 30 0.0 1-Feb-13 0.000 522.260 BV Cert GenPower Carbon Solutions 2-May-12 30-Dec-99 1 3 5 11 7 8 -2 2.0 2960 0.800 No Investment 3 52.226 52.226 52.226 52.226 52.226 52.226 52.226 52.226 52.226 52.226

477CPA0064.04 5034-0004 Ayer Item Biogas Project (Ayer Item 15110312-4) Asia & Pacific Southeast Asia Malaysia Ayer Hitam, Johor GenPower Carbon Solutions Registered Methane avoidance Methane avoidance Palm oil waste AMS-III.H. 1 23.6 10 30 0.0 1-Feb-13 0.000 235.760 BV Cert GenPower Carbon Solutions 2-May-12 30-Dec-99 1 3 5 11 7 8 -2 1.0 0.673 No Investment 3 23.576 23.576 23.576 23.576 23.576 23.576 23.576 23.576 23.576 23.576

478CPA0064.05 5034-0005 Wealth Houses Biogas Project (WH 22311121-5) Asia & Pacific Southeast Asia Malaysia Bruit, Sarawak GenPower Carbon Solutions Registered Methane avoidance Methane avoidance Palm oil waste AMS-III.H. 1 55.7 10 30 0.0 1-Feb-13 0.000 557.060 BV Cert GenPower Carbon Solutions 2-May-12 30-Dec-99 1 3 5 11 9 8 -2 No Investment 3 55.706 55.706 55.706 55.706 55.706 55.706 55.706 55.706 55.706 55.706

479CPA0064.06 5034-0006 Yee Lee Biogas Project (YL 451016-6) Asia & Pacific Southeast Asia Malaysia Bidor, Perak GenPower Carbon Solutions Registered Methane avoidance Methane avoidance Palm oil waste AMS-III.H. 1 42.6 10 30 0.4 1-Feb-13 0.000 425.510 BV Cert GenPower Carbon Solutions 2-May-12 30-Dec-99 1 3 5 11 9 8 -2 1.0 5753 0.672 No Investment 3 55.706 55.706 55.706 55.706 55.706 55.706 55.706 55.706 55.706 55.706

480PoA0065 KJVJROEXMWH1PNCXAFMAE2EJNCJQVC 5033 Fuel Efficient Stoves in Zambia Africa Southern Africa Zambia Zambia 3 Rocks Ltd. Rejected EE households EE households Stoves AMS-II.G. 1 58.8 22-Dec-10 7 72.047 543.022 TÜV-SÜD 0.000 n.a. 3 Rocks Ltd. 24-Nov-10 15-Apr-11 7-Sep-11 2 PoA 30-Dec-99PoA 4 3 1 6 8 5 0.0

481CPA0065.01 5033-0001 Fuel Efficient Stoves in Zambia (3RL CPA No.01) Africa Southern Africa Zambia Eastern Province 3 Rocks Ltd. Rejected EE households EE households Stoves AMS-II.G. 1 58.8 7 21 0.0 10-Oct-11 72.047 543.022 TÜV-SÜD n.a. 3 Rocks Ltd. 24-Nov-10 2 30-Dec-99 4 3 1 6 8 5 1 3 Rocks Ltd United K. No 58.814 58.814 58.814 58.814 58.814 58.814 58.814

482PoA0066 7U0F9AW4TMZKOP3YRJMR5CVWOYGYN0 6299 Green Brick Development Programme of Activities Managed by INTRACO Asia & Pacific Southeast Asia Vietnam Vietnam Registered EE industry EE industry Building materials AMS-III.Z. 1 29.5 11-Dec-10 28 14.744 294.880 TÜV-Rhein 0.000 United K. (Eneco energy+EnBW) INTRACO 10-Dec-10 16-May-11 29-May-12 31-May-12 CPA 31-Dec-99Both 4 2 1 5 9 8 0.0

483CPA0066.01 6299-0001 Khang Minh Brick Project Asia & Pacific Southeast Asia Vietnam Ha Nam Registered EE industry EE industry Building materials Unburnt brick production AMS-III.Z. 1 29.5 10 30 0.0 1-Jul-12 14.744 294.880 TÜV-Rhein United K. (Eneco energy+EnBW) INTRACO 10-Dec-10 31-May-12 30-Dec-99 4 2 1 5 9 8 0 No 55.946 55.946 55.946 55.946 55.946 55.946 55.946 55.946 55.946 55.946

484PoA0067 H7RIZQKCN0Z8NZ4A9Y0EJ6O5CCAILA 8024 Pakistan Domestic Biogas Programme, CDM Programme of Activities Asia & Pacific Southern Asia Pakistan Pakistan Registered Methane avoidance Methane avoidance Domestic manure AMS-I.E. 1 27.9 13-Dec-10 28 2.320 223.277 DNV 0.000 n.a. Winrock 11-Dec-10 7-Mar-11 5-Nov-12 25-Jan-13 13-Nov-12 PoA 30-Dec-99CPA 1 6 8 4 5 0.0 Plist

485CPA0067.01 8024-0001 Asia & Pacific Southern Asia Pakistan Punjab Registered Methane avoidance Methane avoidance Domestic manure Digesters with energy production AMS-I.E. 1 27.9 7 20 0.0 30-Dec-12 2.320 223.277 DNV n.a. Winrock 11-Dec-10 13-Nov-12 30-Dec-99 1 6 8 4 5 0 Yes Plist 13.351 30.039 15.510 34.898 46.530 46.530 46.530 46.530 46.530 46.530 46.530 46.530 46.530 46.530 46.530 46.530 46.530 46.530 46.530 46.530 46.530 46.530 46.530 46.530 46.530 46.530 46.530 46.530 46.530

486PoA0068 I0P69ZLWTD2RK1K8MTKSO3LPR4H5Q7 Mexican Housing Commission Sustainable Housing Program of Activities Latin America North America Mexico Mexico At Validation EE households EE households Lighting & Insulation & Solar AMS-III.AE.+AMS-I.C. 1 10.1 24-Apr-09 28 20.134 100.670 DNV 0.000 n.a. Sigea Carbon 11-Dec-10 3-Apr-12 CPA 30-Dec-99PoA 4 9 0.0

487CPA0068.01 Latin America North America Mexico Many At Validation EE households EE households Lighting & Insulation & Solar AMS-III.AE.+AMS-I.C. 1 10.1 10 10 0.0 1-Jan-11 20.134 100.670 DNV n.a. Sigea Carbon 11-Dec-10 3-Apr-12 30-Dec-99 4 9 0 Yes 10.067 10.067 10.067 10.067 10.067 10.067 10.067 10.067 10.067 10.067

488PoA0069 OSYTPN7C6MAN44H2V53WA1OGJHXSV5 7078 LED’s kick-off Africa Southern Africa South Africa South Africa Lemnis Lighting Registered EE service EE service Lighting in service AMS-II.C. 1 48.4 2-Sep-10 28 8.072 484.340 SQS 0.000 Netherlands (Mabanaft+Do-inc.) n.a. 24-Dec-10 22-Feb-12 9-Dec-12 18-Jan-13 5-Dec-12 PoA 30-Dec-99PoA 4 9 2 7 11 5 0.0

489CPA0069.01 7078-0001 CPA0001 “Mining retrofit” Africa Southern Africa South Africa South Africa Lemnis Lighting Registered EE service EE service Lighting in service AMS-II.C. 1 48.4 10 10 -0.5 30-Oct-12 8.072 484.340 SQS Netherlands (Mabanaft+Do-inc.) n.a. 24-Dec-10 5-Dec-12 30-Dec-99 4 9 2 7 11 5 3 China USA Netherlands 79.9 No Financial;Investment 50.934 50.424 49.920 49.421 48.927 48.437 47.953 47.473 46.999 46.529

490PoA0070 UACW6CORMHEQTOAUBR5T6EVBL3E9L3 5336 Efficient Cook Stove Programme: Kenya Africa East Africa Kenya Kenya co2balance UK Registered EE households EE households Stoves Fuel-efficient cooking stoves AMS-II.G. 2 99.0 21-Mar-12 28 42.132 824.130 BV Cert 13.415 4.922 18.337 1 26-Nov-14 20-Mar-13 3.903 United K. (CO2Balance) CO2Balance 25-Dec-10 13-Oct-11 12-Nov-11 21-Mar-12 CPA 30-Dec-99CPA 4 8 1 6 9 7 0.0

491CPA0070.01 5336-0001 Africa East Africa Kenya Rift Valley co2balance UK Registered EE households EE households Stoves Fuel-efficient cooking stoves AMS-II.G. 1 50.8 7 7 0.0 21-Mar-12 42.132 446.001 BV Cert 13.415 3.793 17.208 1 26-Nov-14 20-Mar-13 United K. (CO2Balance) CO2Balance 25-Dec-10 21-Mar-12 30-Dec-99 4 8 1 6 9 7 -5 No 43.724 43.724 43.724 43.724 43.724 43.724 43.724 43.724 43.724 43.724 43.724 43.724 43.724 43.724 43.724 43.724 43.724 43.724 43.724 43.724 43.724

492CPA0070.02 5336-0002 CPA No. 2 Mathira East District co2balance UK Ltd Africa East Africa Kenya Mathira East co2balance UK Registered EE households EE households Stoves Fuel-efficient cooking stoves AMS-II.G. 1 48.2 7 7 0.0 1-Mar-13 0.000 378.129 BV Cert 0.000 1.129 1.129 1 26-Nov-14 20-Mar-13 CO2Balance 31-Jan-13 30-Dec-99 4 8 1 6 9 7 -5 No 48.224 48.224 48.224 48.224 48.224 48.224 48.224

493PoA0071 COOOTTMCPBQF4QCUASJDRIX65NCDI6 5588 First Solar PoA in India by SENES Consultants Asia & Pacific Southern Asia India India SENES Consultants Registered Solar Solar Solar PV AMS-I.D. 9 147.7 4-Feb-11 28 16.000 1,105.363 DNV 0.000 Switzerland (Standard Bank) SENES Consultants, KYOTOenergy 30-Dec-10 20-Sep-11 28-Mar-12 28-Mar-12 PoA 30-Dec-99PoA 5 8 4 107.7

494CPA0071.01 5588-0001 Asia & Pacific Southern Asia India India SENES Consultants Registered Solar Solar Solar PV AMS-I.D. 1 22.8 7 25 0.0 28-Mar-12 16.000 199.557 DNV Switzerland (Standard Bank) SENES Consultants, KYOTOenergy 30-Dec-10 28-Mar-12 30-Dec-99 5 8 4 0 15.0 24966 0.923 No 23.031 23.031 23.031 23.031 23.031 23.031 23.031 23.031 23.031 23.031 23.031 23.031 23.031 23.031 23.031 23.031 23.031 23.031 23.031 23.031 23.031

495CPA0071.02 5588-0002 28082012 Fourth CPA on Grid Connected Solar Power Project in India Asia & Pacific Southern Asia India Rajasthan SENES Consultants Registered Solar Solar Solar PV AMS-I.D. 1 7.7 7 25 0.0 1-Jan-13 0.000 61.437 DNV SENES Consultants 26-Dec-12 30-Dec-99 5 8 4 0 5.0 8322 0.923 No 7.677 7.677 7.677 7.677 7.677 7.677 7.677

496CPA0071.03 5588-0003 06062012 Second Bundled CPA on Grid Connected Solar Power Project in India Asia & Pacific Southern Asia India Rajasthan SENES Consultants Registered Solar Solar Solar PV AMS-I.D. 1 15.4 7 25 0.0 1-Feb-13 0.000 121.570 DNV SENES Consultants 17-Jan-13 30-Dec-99 5 8 4 0 10.0 16644 0.923 No 14.075 15.354 15.354 15.354 15.354 15.354 15.354 1.280

497CPA0071.04 5588-0004 Asia & Pacific Southern Asia India India SENES Consultants Registered Solar Solar Solar PV AMS-I.D. 1 21.6 7 25 0.0 1-Feb-13 0.000 170.787 DNV SENES Consultants 17-Jan-13 30-Dec-99 5 8 4 0 14.0 23302 0.923 No 19.772 21.570 21.570 21.570 21.570 21.570 21.570 1.798

498CPA0071.05 5588-0005 24092012 Fifth CPA on Grid Connected Solar Power Project in India Asia & Pacific Southern Asia India Jharkhand SENES Consultants Registered Solar Solar Solar PV AMS-I.D. 1 7 25 0.0 1-Feb-13 0.000 0.000 DNV SENES Consultants 17-Jan-13 30-Dec-99 5 8 4 0 14.0 233016 0.923 No 19.704 21.495 21.495 21.495 21.495 21.495 21.495 1.791

499CPA0071.06 5588-0006 31082012 Sixth CPA on Grid Connected Solar Power Project in India Asia & Pacific Southern Asia India Rajasthan SENES Consultants Registered Solar Solar Solar PV AMS-I.D. 1 23.0 7 25 0.0 1-Feb-13 0.000 182.355 DNV SENES Consultants 17-Jan-13 30-Dec-99 5 8 4 0 15.0 24966 0.923 No 21.112 23.031 23.031 23.031 23.031 23.031 23.031 1.919

500CPA0071.07 5588-0007 16012013 Seventh CPA on Grid Connected Solar Power Project in India Asia & Pacific Southern Asia India Rajasthan SENES Consultants Registered Solar Solar Solar PV AMS-I.D. 1 21.6 7 25 0.0 7-Nov-13 0.000 154.864 DNV SENES Consultants 7-Nov-13 30-Dec-99 5 8 4 0 14.1 23468 0.923 No 21.649 21.649 21.649 21.649 21.649 21.649 21.649

501CPA0071.08 5588-0008 22052013 Eighth CPA on Grid Connected Solar Power Project in India Asia & Pacific Southern Asia India SENES Consultants Registered Solar Solar Solar PV AMS-I.D. 1 22.3 7 25 0.0 6-Feb-14 0.000 153.706 DNV SENES Consultants 6-Feb-14 30-Dec-99 5 8 4 0 14.5 24134 0.923 No 22.263 22.263 22.263 22.263 22.263 22.263 22.263

502CPA0071.09 5588-0009 05052013 Ninth CPA on Grid Connected Solar Power Project in India Asia & Pacific Southern Asia India SENES Consultants Registered Solar Solar Solar PV AMS-I.D. 1 13.4 7 25 0.0 6-Jun-16 0.000 61.085 DNV SENES Consultants 3-Jun-16 30-Dec-99 5 8 4 0 6.1 10152 0.934 No n.a. 9.497 9.497 9.497 9.497 9.497 9.497 9.497

503PoA0072 DU4107N5GBVZQL0T5R03K6YFEFKTUJ Asia & Pacific East Asia China Jiangxi At Validation EE households EE households Lighting AMS-II.J. 1 35.8 1-Jan-11 28 65.000 346.262 LRQA 0.000 Japan (Mitsubishi UFJ Securities) 18-Jan-11 17-Jan-13 PoA 30-Dec-99PoA 4 1 5 0.0

504CPA0072.01 Asia & Pacific East Asia China Nanchang City At Validation EE households EE households Lighting Distrubution of 1,100,000CFLs AMS-II.J. 1 35.8 7 8 -3.0 1-May-11 65.000 346.262 LRQA Japan (Mitsubishi UFJ Securities) 18-Jan-11 20-Sep-11 28-Mar-12 30-Dec-99 4 1 5 0 325.0 No Investment 4 44.993 41.923 38.853 35.783 32.713 29,643.000 26.573 0.000 0.000 0.000

505PoA0073 SU4WR58PN82E99YM6HXV2MB22V5O3Q 5272 CFL Distribution Programme in Jiangsu Province Asia & Pacific East Asia China Jiangsu Registered EE households EE households Lighting AMS-II.J. 1 30.0 20-Jul-12 28 17.480 299.700 BV Cert 0.000 n.a. SinoCarbon Innovation & Investment 19-Jan-11 1-Aug-11 15-Jun-12 19-Jun-12 15-Jun-12 PoA 30-Dec-99CPA 4 9 7 0.0

506CPA0073.01 5272-0001 Asia & Pacific East Asia China Registered EE households EE households Lighting Distribution of 1039545 CFLs AMS-II.J. 1 30.0 10 8 -3.0 1-May-12 17.480 299.700 BV Cert n.a. SinoCarbon Innovation & Investment 19-Jan-11 15-Jun-12 30-Dec-99 4 9 7 0 0.769 24.0 No Investment 4 41.629 38.789 35.948 33.108 30.267 27.427 24.586 18.462 0.000 0.000

507PoA0074 HC7SLUPA2SQI2NOJAUDTFVSCNJF878 7654 China Coal Mine Ventilation Air Methane Oxidization Programme Asia & Pacific East Asia China China Registered Coal bed/mine methane Coal bed/mine methane CMM & Ventilation Air Methane ACM8 1 413.2 28-Jan-11 28 0.000 4,132.190 DNV 0.000 Japan (Carbon Capital Management) PEAR Carbon Offset Initiative 28-Jan-11 1-Dec-11 21-Dec-12 21-Mar-13 CPA 31-Dec-99CPA 1 3 5 9 4.5

508CPA0074.01 7654-0001 Asia & Pacific East Asia China Shaanxi Registered Coal bed/mine methane Coal bed/mine methane CMM & Ventilation Air Methane VAM oxidizers for destruction of VAM ACM8 1 413.2 10 18 0.0 1-Jan-13 0.000 4,132.190 DNV Japan (Carbon Capital Management) PEAR Carbon Offset Initiative 28-Jan-11 21-Mar-13 30-Dec-99 1 3 5 9 0 4.5 32000 0.841 No Investment 3 413.219 413.219 413.219 413.219 413.219 413.219 413.219 413.219 413.219 413.219

509PoA0075 9OH8JX23RMBJDG7DP0B5Q29I5DFTAJ Asia & Pacific Southern Asia Sri Lanka Sri Lanka Validation Terminated Biomass energy Biomass energy Gasification of biomass AMS-I.C. 1 6.2 1-May-11 28 6.222 62.220 DNV 0.000 Japan (EX Corporation) EX Corporation 29-Jan-11 Both 30-Dec-99Both 10 9 8 5 1 12 0.0

510CPA0075.01 Asia & Pacific Southern Asia Sri Lanka Validation Terminated Biomass energy Biomass energy Gasification of biomass AMS-I.C. 1 6.2 10 15 0.0 1-Jan-11 6.222 62.220 DNV Japan (EX Corporation) EX Corporation 29-Jan-11 30-Dec-99 10 8 9 5 1 12 0 0.698 No 6.222 6.222 6.222 6.222 6.222 6.222 6.222 6.222 6.222 6.222

511PoA0076 L5R0TMVTFQCYAKGX0XJYDUG2QG3SJI Asia & Pacific Southern Asia Bangladesh Bangladesh Grameen Shakti At Validation Methane avoidance Methane avoidance Biogas from MSW AMS-III.AO.+AMS-I.E. 1 3.5 1-Jul-11 28 1.758 35.160 BV Cert 0.000 Japan (PEAR Carbon Offset Initiative) PEAR Carbon Offset Initiative 29-Jan-11 CPA 31-Dec-99CPA 4 1 8 6 0.0

512CPA0076.01 Asia & Pacific Southern Asia Bangladesh Faridpur Grameen Shakti At Validation Methane avoidance Methane avoidance Biogas from MSW AMS-III.AO.+AMS-I.E. 1 3.5 10 25 0.0 1-Jul-11 1.758 35.160 BV Cert Japan (PEAR Carbon Offset Initiative) PEAR Carbon Offset Initiative 29-Jan-11 30-Dec-99 4 1 8 6 0 0.584 No 3 2.931 3.204 3.388 3.512 3.595 3.651 3.688 3.714 3.731 3.742

513PoA0077 LXMKWBDZ54V0LSAO0NSN3CNT7LH0G3 Standard Bank Low Pressure Solar water heater Programme for South Africa Africa Southern Africa South Africa South Africa Standard Bank Solar Solar Solar water heating AMS-I.C. 2-May-12 28 JCI United K. (Standard Bank) International Carbon 3-Feb-11 7-May-11 3-Apr-12 22-Jun-12 24-Apr-12 PoA 30-Dec-99PoA 5 7 8 10

514CPA0077.01 Africa Southern Africa South Africa KwaZulu-Natal Standard Bank Solar Solar Solar water heating Solar water heaters AMS-I.C. 1 400.0 10 15 0.0 2-May-12 200.000 4,000.000 JCI United K. (Standard Bank) International Carbon 3-Feb-11 7-May-11 24-Apr-12 30-Dec-99 5 7 8 10 0 No Financial;Other 2.047 20.881 35.569 41.762 41.762 41.762 41.762 41.762 41.762 41.762 34.801

515PoA0078 KZE3NDBSH9K5EBH3NZQTTIDYQXCQ6W Africa East Africa Tanzania Tanzania Standard Bank At Validation Solar EE households Solar lamps AMS-III.AR. 1 49.6 1-Jul-11 28 34.915 471.552 JCI 0.000 United K. (Frontier Carbon) 8-Feb-11 CPA 30-Dec-99CPA 8 9 5 7 6 0.0

516CPA0078.01 Solar Lamp Project: East Tanzania Africa East Africa Tanzania Standard Bank At Validation Solar EE households Solar lamps AMS-III.AR. 1 49.6 7 28 20.0 1-Jul-11 34.915 471.552 JCI United K. (Frontier Carbon) 8-Feb-11 30-Dec-99 8 9 5 7 6 0 No 3.908 31.007 56.499 59.324 62.290 65.404 68.675 68.675 68.675 68.675 68.675 68.675 68.675 68.675 68.675 68.675 68.675 68.675 68.675 68.675 68.675

517PoA0079 LXJZOCC9OM503YD0PDZPGBAWG2PSSW The programme to introduce renewable energy system into Seoul Asia & Pacific East Asia South Korea South Korea Seoul Metropolitan Government Replaced At Validation Solar Solar Solar water heating AMS-I.F.+AMS-I.C. 7-Jun-10 28 KSA n.a. Seoul Metropolitan Government 22-Feb-11 26-Mar-11 CPA 30-Dec-99CPA 8 9

518CPA0079.01 Asia & Pacific East Asia South Korea Seoul Seoul Metropolitan Government Replaced At Validation Solar Solar Solar water heating AMS-I.F.+AMS-I.C. 1 0.6 10 10 0.0 1-Jun-11 0.809 5.629 KSA n.a. Seoul Metropolitan Government 22-Feb-11 26-Mar-11 30-Dec-99 8 9 0 0.5 714 No 539.170 539.170 539.170 539.170 539.170 539.170 539.170 539.170 539.170 539.170

519PoA0080 SYPEE63VG57ZIB75B5QPY6UJ71F1UI Promoting Efficient Stove Dissemination and Use in West Africa Africa West Africa Togo E+Carbon Replaced At Validation EE households EE households Stoves AMS-II.G. 1-Jan-11 28 DNV n.a. E+Carbon 24-Feb-11 28-Jan-12 24-Jun-13 CPA 30-Dec-99CPA 8 1 4 6

520CPA0080.01 Africa West Africa Togo Lomé E+Carbon Replaced At Validation EE households EE households Stoves AMS-II.G. 1 45.2 7 7 0.0 1-Jul-11 67.788 429.767 DNV n.a. E+Carbon 24-Feb-11 28-Jan-12 24-Jun-13 30-Dec-99 8 1 4 6 1 Ghana Yes 19.080 45.869 45.869 45.869 45.869 45.869 45.346 45.346 45.346 45.346 45.346 45.346 45.346 45.346 45.346 45.346 45.346 45.346 45.346 45.346 45.346

521PoA0081 19ATQDEFC5RPDASZCXHCKR9II2EKGY Green Steam Low Pressure Solar Water Heater Programme for South Africa Africa Southern Africa South Africa South Africa CME At Validation Solar Solar Solar water heating AMS-I.C. 1 13.0 1-Mar-11 28 23.114 130.000 JCI 0.000 n.a. CDM Africa Climate Solutions 18-Mar-11 PoA 30-Dec-99CPA 4 5 10 7 8 9 0.0

522CPA0081.01 Africa Southern Africa South Africa CME At Validation Solar Solar Solar water heating AMS-I.C. 1 13.0 10 10 0.0 22-Mar-11 23.114 130.000 JCI n.a. CDM Africa Climate Solutions 18-Mar-11 30-Dec-99 4 5 10 7 8 9 0 0.990 No 13.000 13.000 13.000 13.000 13.000 13.000 13.000 13.000 13.000 13.000

523PoA0082 LWY2JFU4UHI9VMM4QOZ0326OTE6W7X 8526 Renewable energy utilization in the new and exiting buildings in Henan Province Asia & Pacific East Asia China Henan Registered Geothermal Geothermal Geothermal heating AMS-II.C.+AMS-I.C. 1 0.9 2-Jan-11 28 0.000 7.168 TÜV-Rhein 0.000 United K. (Deutsche Bank) Environomist 24-Mar-11 1-Apr-12 4-Dec-12 19-Jan-13 4-Dec-12 CPA 31-Dec-99PoA 1 8 5 7 0.0 MSC

524CPA0082.01 8526-0001 Asia & Pacific East Asia China Hebi City Registered Geothermal Geothermal Geothermal heating AMS-II.C.+AMS-I.C. 1 0.9 7 25 0.0 2-Jan-13 0.000 7.168 TÜV-Rhein United K. (Deutsche Bank) Environomist 24-Mar-11 4-Dec-12 30-Dec-99 1 8 5 7 0 1.087 18.0 No MSC 3.873 3.873 3.873 3.873 3.873 3.873 3.873 3.873 3.873 3.873 3.873 3.873 3.873 3.873 3.873 3.873 3.873 3.873 3.873 3.873 3.873

525PoA0083 L4GKXH1FTNAMON2GR2TOXPIGK08XT4 Guacamaya Small Scale Hydropower Programme of Activities Latin America Central America Honduras Anaconda Carbon Replaced At Validation Hydro Hydro Run of river AMS-I.D. 1-Jun-11 28 TÜV-Rhein Netherlands (Mabanaft Carbon) Anaconda Carbon 13-Apr-11 20-Oct-11 CPA 31-Dec-99CPA 5 9 10 11 8

526CPA0083.01 Rio Quilio Hydroelectric Project Latin America Central America Honduras Ocotepeque Anaconda Carbon Replaced At Validation Hydro Hydro Run of river 1.34 MW run of rover hudropower plant AMS-I.D. 1 4.9 7 25 0.0 1-Jul-11 9.872 46.939 TÜV-Rhein Netherlands (Mabanaft Carbon) Anaconda Carbon 13-Apr-11 20-Oct-11 30-Dec-99 5 9 10 11 8 0 1.3 7800 0.633 No 4.936 4.936 4.936 4.936 4.936 4.936 4.936 4.936 4.936 4.936 4.936 4.936 4.936 4.936

527PoA0084 KBA65GGUAZIG8983YLL9QM7S97EZ0N 6584 The programme to introduce renewable energy system into Jeju Island Asia & Pacific East Asia South Korea Jeju Registered Hybrid renewables Hybrid renewables Solar & wind & other AMS-I.D.+AMS-I.F. 1 0.9 2-May-11 28 0.000 8.630 Keco 0.000 n.a. Ecoeye 15-Apr-11 30-May-12 4-Jul-12 24-Aug-12 4-Jul-12 PoA 30-Dec-99PoA 9 5.2

528CPA0084.01 6584-0001 Asia & Pacific East Asia South Korea Jeju Registered Solar Solar Solar PV AMS-I.D.+AMS-I.F. 1 0.9 10 10 0.0 1-Jan-13 0.000 8.630 Keco n.a. Ecoeye 15-Apr-11 4-Jul-12 30-Dec-99 9 0 5.2 10608 0.683 No Investment 7,232.590 7,232.590 7,232.590 7,232.590 7,232.590 7,232.590 7,232.590 7,232.590 7,232.590 7,232.590

529PoA0085 GTXCLPCVFATNFXPEY4BCF3RUU1N5GK 7237 Municipal Waste Compost Programme in Sri Lanka Asia & Pacific Southern Asia Sri Lanka Sri Lanka Korea Environment Corporation Registered Landfill gas Landfill gas Landfill composting AMS-III.F. 2 7.0 24-Feb-11 28 0.905 55.804 KSA 0.000 n.a. Ecoeye 16-Apr-11 5-Mar-12 9-Sep-12 9-Nov-12 9-Sep-12 CPA 31-Dec-99CPA 1 9 2 3 0.0

530CPA0085.01 7237-0001 Karadeyana Municipal Waste Compost Project in Sri Lanka Asia & Pacific Southern Asia Sri Lanka Western Korea Environment Corporation Registered Landfill gas Landfill gas Landfill composting Aerobic composting facility AMS-III.F. 1 6.1 7 20 1.5 9-Sep-12 0.453 50.547 KSA n.a. Ecoeye 16-Apr-11 9-Sep-12 30-Dec-99 1 9 2 3 0 No Investment 4 2.205 4.921 6.918 8.411 9.545 10.422 11.111 11.111 11.111 11.111 11.111 11.111 11.111 11.111

531CPA0085.02 7237-0002 Municipal Waste Compost Programme in Sri Lanka Asia & Pacific Southern Asia Sri Lanka Central Korea Environment Corporation Registered Landfill gas Landfill gas Landfill composting Aerobic composting facility AMS-III.F. 1 0.9 7 20 1.5 17-Jun-15 0.453 5.257 KSA Ecoeye 16-Apr-11 17-Jun-15 30-Dec-99 1 9 2 3 0 No Investment 4 0.228 0.644 0.887 1.056 1.175 1.260 1.322

532PoA0086 I06DE6UCRK368XWLQWEYH35LWQMDAF 8088 Biomass Power Development programme in Thailand Asia & Pacific Southeast Asia Thailand Thailand Registered Biomass energy Biomass energy Forest residues: other AMS-I.D. 1 37.9 21-Sep-11 28 0.000 379.410 TÜV-Rhein 0.000 n.a. 22-Apr-11 7-Oct-11 9-Nov-12 3-Jan-13 19-Nov-12 Both 30-Dec-99Both 5 8 9 12 2 1 9.9

533CPA0086.01 8088-0001 Biomass Power Development Programme in Thailand CPA 1 Asia & Pacific Southeast Asia Thailand Roi Et Registered Biomass energy Biomass energy Forest residues: other 9.9MW biomass power plant AMS-I.D. 1 37.9 10 25 0.0 8-Dec-12 379.410 TÜV-Rhein n.a. 22-Apr-11 19-Nov-12 30-Dec-99 5 8 9 12 2 1 0 9.9 65280 0.581 No Investment 3 37,941.000 37.941 37.941 37.941 37.941 37.941 37.941 37.941 37.941 37.941

534PoA0087 DWV289YR53DJS9VRU4XGT69SVVE5ZQ 7883 Hydro Alliance Programme of Activities Latin America Central America Guatemala Registered Hydro Hydro Run of river AMS-I.D. 6 50.2 4-May-11 28 0.000 240.255 AENOR 0.000 Switzerland (South Pole Carbon Asset Management) South Pole Carbon Asset Management 4-May-11 17-Nov-11 30-Oct-12 29-Dec-12 30-Oct-12 CPA 31-Dec-99CPA 3 4 5 9 10 11 16.8

535CPA0087.01 7883-0001 El Ixtalito Hydroelectric Project, San Marcos, Guatemala (SSC-CPA El Ixtalito) Latin America Central America Guatemala San Marcos Registered Hydro Hydro Run of river 1.473 MW run of river plant AMS-I.D. 1 3.6 7 25 0.0 15-Jan-13 0.000 29.006 AENOR Switzerland (South Pole Carbon Asset Management) South Pole Carbon Asset Management 4-May-11 30-Oct-12 30-Dec-99 3 4 5 9 10 11 0 1.5 6000 0.393 No N/A MSC SUZ N/A 2.532 3.642 3.642 3.642 3.642 3.642 3.642 0.150

536CPA0087.02 7883-0002 Latin America Central America Guatemala n.a. Registered Hydro Hydro Run of river 0.601 MW run of river plant AMS-I.D. 1 1.4 7 25 0.0 1-Dec-15 0.000 7.352 AENOR Switzerland (South Pole Carbon Asset Management) South Pole Carbon Asset Management 4-May-11 25-Nov-15 30-Dec-99 3 4 5 9 10 11 0 0.6 2690 0.538 No N/A 1.455 1.455 1.455 1.455 1.455 1.455 1.455

537CPA0087.03 7883-0003 Latin America Central America Guatemala n.a. Registered Hydro Hydro Run of river 5 MW run of river plant AMS-I.D. 1 13.9 7 25 0.0 1-Dec-15 0.000 70.831 AENOR Switzerland (South Pole Carbon Asset Management) South Pole Carbon Asset Management 4-May-11 25-Nov-15 30-Dec-99 3 4 5 9 10 11 0 5.0 25902 0.538 No N/A 13.922 13.922 13.922 13.922 13.922 13.922 13.922

538CPA0087.04 7883-0004 Latin America Central America Guatemala n.a. Registered Hydro Hydro Run of river 5.22 MW run of river plant AMS-I.D. 1 16.3 7 25 0.0 16-Nov-16 0.000 67.287 AENOR Switzerland (South Pole Carbon Asset Management) South Pole Carbon Asset Management 4-May-11 16-Nov-16 31-Dec-99 3 4 5 9 10 11 0 5.2 30342 0.538 No N/A 16.308 16.308 16.308 16.308 16.308 16.308 16.308

539CPA0087.05 7883-0005 Latin America Central America El Salvador Juayúa municipality Registered Hydro Hydro Run of river 2.458 MW run of river plant AMS-I.D. 1 10.5 7 25 0.0 1-Aug-16 0.000 46.450 AENOR Switzerland (South Pole Carbon Asset Management) South Pole Carbon Asset Management 4-May-11 18-Dec-16 31-Dec-99 3 4 5 9 10 11 0 2.5 7096 0.603 No N/A 10.511 10.511 10.511 10.511 10.511 10.511 10.511

540CPA0087.06 7883-0006 Hidroaguná Hydroelectric Project, Escuintla, Guatemala (SSC-CPA Aguná) Latin America Central America Guatemala Registered Hydro Hydro Run of river 2.0385 MW run of river plant AMS-I.D. 1 4.4 7 25 0.0 1-Aug-16 19.329 AENOR Switzerland (South Pole Carbon Asset Management) South Pole Carbon Asset Management 4-May-11 18-Dec-16 30-Dec-99 3 4 5 9 10 11 0 2.0 8138 0.538 No N/A 4.374 4.374 4.374 4.374 4.374 4.374 4.374

541PoA0088 D5R7QWCYAQWBCRWHPK75NEHJ3SYSSQ 7811 The National CFL Project, Pakistan Asia & Pacific Southern Asia Pakistan Pakistan Registered EE households EE households Lighting AMS-II.J. 53 557.1 9-Dec-10 28 0.334 5,570.520 DNV 0.000 n.a. ADB CDM Facility 7-May-11 26-Jan-12 20-Dec-12 29-Jan-13 23-Oct-12 PoA 30-Dec-99PoA 11 9 4 0.0

542CPA0088.01 7811-0001 National CFL Project, Pakistan-IESCO- Islamabad - 1-4-1-0-0 Asia & Pacific Southern Asia Pakistan Islamabad Registered EE households EE households Lighting Distribution of 388,616 CFLs AMS-II.J. 1 4.0 10 8 -0.5 30-Nov-12 0.334 40.110 DNV n.a. ADB CDM Facility 7-May-11 23-Oct-12 30-Dec-99 11 9 4 0 0.480 15.0 Yes 3 6.648 6.161 4.011 4.011 4.011 4.011 4.011 4.011 4.011 3.677

543CPA0088.02 7811-0002 National CFL Project, Pakistan - FESCO - Faisalabad I - 2-3-1-0-0 Asia & Pacific Southern Asia Pakistan Faisalabad Registered EE households EE households Lighting Distribution of 875,000 CFLs AMS-II.J. 1 12.7 10 8 -1.6 1-May-14 126.790 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 47.5 Yes 22.775 21.221 19.667 18.113 16.559 15.005 13.451

544CPA0088.03 7811-0003 National CFL Project, Pakistan - FESCO - Faisalabad II - 2-3-2-0-0 Asia & Pacific Southern Asia Pakistan Faisalabad Registered EE households EE households Lighting Distribution of 875,000 CFLs AMS-II.J. 1 12.7 10 8 -1.6 1-May-14 126.790 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 47.5 Yes 22.775 21.221 19.667 18.113 16.559 15.005 13.451

545CPA0088.04 7811-0004 National CFL Project, Pakistan - FESCO - Jhang I - 2-3-3-1-0 Asia & Pacific Southern Asia Pakistan Jhang Registered EE households EE households Lighting Distribution of 899,408 CFLs AMS-II.J. 1 13.0 10 8 -1.6 1-May-14 130.330 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 48.9 Yes 23.410 21.813 20.215 18.618 17.021 15.423 13.826

546CPA0088.05 7811-0005 National CFL Project, Pakistan - FESCO - Jhang II - 2-3-3-2-0 Asia & Pacific Southern Asia Pakistan Jhang Registered EE households EE households Lighting Distribution of 650,592 CFLs AMS-II.J. 1 9.4 10 8 -1.2 1-May-14 94.270 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 35.3 Yes 16.934 15.778 14.623 13.467 12.312 11.157 10.001

547CPA0088.06 7811-0006 National CFL Project, Pakistan - FESCO - Sargodha - 2-3-4-0-0 Asia & Pacific Southern Asia Pakistan Sargodha Registered EE households EE households Lighting Distribution of 900,000 CFLs AMS-II.J. 1 13.0 10 8 -1.6 1-May-14 130.410 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 48.9 Yes 23.426 21.827 20.229 18.630 17.032 15.434 13.835

548CPA0088.07 7811-0007 National CFL Project, Pakistan - GEPCO - Gujranwala City - 3-2-1-0-0 Asia & Pacific Southern Asia Pakistan Gujranwala Registered EE households EE households Lighting Distribution of 615,000 CFLs AMS-II.J. 1 12.1 10 8 -1.5 1-May-14 120.620 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 45.2 Yes 21.666 20.188 18.709 17.231 15.753 14.274 12.796

549CPA0088.08 7811-0008 National CFL Project, Pakistan - GEPCO - Gujranwala Cantt - 3-2-2-0-0 Asia & Pacific Southern Asia Pakistan Gujranwala Registered EE households EE households Lighting Distribution of 759,000 CFLs AMS-II.J. 1 14.9 10 8 -1.8 1-May-14 148.860 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 55.8 Yes 26.739 24.915 23.090 21.266 19.441 17.617 15.792

550CPA0088.09 7811-0009 National CFL Project, Pakistan - GEPCO - Sialkot I - 3-2-3-1-0 Asia & Pacific Southern Asia Pakistan Sialkot Registered EE households EE households Lighting Distribution of 515,400 CFLs AMS-II.J. 1 10.1 10 8 -1.1 1-May-14 101.080 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 37.9 Yes 18.157 16.918 15.679 14.440 13.201 11.963 11.963

551CPA0088.10 7811-0010 National CFL Project, Pakistan - GEPCO - Sialkot II - 3-2-3-2-0 Asia & Pacific Southern Asia Pakistan Sialkot Registered EE households EE households Lighting Distribution of 630,600 CFLs AMS-II.J. 1 12.4 10 8 -1.4 1-May-14 123.670 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 37.9 Yes 22.216 20.700 19.184 17.668 16.152 14.636 14.636

552CPA0088.11 7811-0011 National CFL Project, Pakistan - GEPCO - Gujrat I - 3-2-4-1-0 Asia & Pacific Southern Asia Pakistan Gujrat Registered EE households EE households Lighting Distribution of 474,000 CFLs AMS-II.J. 1 9.3 10 8 -1.1 1-May-14 92.960 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 34.8 Yes 16.669 15.559 14.420 13.280 12.141 11.002 9.862

553CPA0088.12 7811-0012 National CFL Project, Pakistan - GEPCO - Gujrat II - 3-2-4-2-0 Asia & Pacific Southern Asia Pakistan Gujrat Registered EE households EE households Lighting Distribution of 606,000 CFLs AMS-II.J. 1 11.9 10 8 -1.5 1-May-14 118.850 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 44.6 Yes 21.349 19.892 18.436 16.979 15.522 14.065 12.609

554CPA0088.13 7811-0013 National CFL Project, Pakistan - IESCO - Attock - 1-4-2-0-0 Asia & Pacific Southern Asia Pakistan Attock Registered EE households EE households Lighting Distribution of 600,000 CFLs AMS-II.J. 1 6.2 10 8 -0.8 1-May-14 61.930 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 23.2 Yes 11.125 10.366 9.607 8.848 8.089 7.330 6.570

555CPA0088.14 7811-0014 National CFL Project, Pakistan - IESCO - Rawalpindi - 1-4-3-0-0 Asia & Pacific Southern Asia Pakistan Rawalpindi Registered EE households EE households Lighting Distribution of 1,029,904 CFLs AMS-II.J. 1 10.6 10 8 -1.3 1-May-14 106.310 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 39.9 Yes 19.096 17.793 16.490 15.187 13.884 12.581 11.278

556CPA0088.15 7811-0015 National CFL Project, Pakistan - IESCO - Jehlum - 1-4-4-0-0 Asia & Pacific Southern Asia Pakistan Jehlum Registered EE households EE households Lighting Distribution of 360,000 CFLs AMS-II.J. 1 3.7 10 8 -0.5 1-May-14 37.160 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 13.9 Yes 6.675 6.220 5.764 5.309 4.853 4.398 3.942

557CPA0088.16 7811-0016 National CFL Project, Pakistan - IESCO - Chakwal - 1-4-5-0-0 Asia & Pacific Southern Asia Pakistan Chakwal Registered EE households EE households Lighting Distribution of 600,000 CFLs AMS-II.J. 1 6.2 10 8 -0.8 1-May-14 61.930 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 23.2 Yes 11.125 10.366 9.607 8.848 8.089 7.330 6.570

558CPA0088.17 7811-0017 National CFL Project, Pakistan - MEPCO - Multan-I - 7-5-1-1-0 Asia & Pacific Southern Asia Pakistan Multan Registered EE households EE households Lighting Distribution of 662,718 CFLs AMS-II.J. 1 13.4 10 8 -1.6 1-May-14 133.590 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 50.1 Yes 23.997 22.359 20.722 19.084 17.447 15.810 14.172

559CPA0088.18 7811-0018 National CFL Project, Pakistan - MEPCO - Multan-II - 7-5-1-2-0 Asia & Pacific Southern Asia Pakistan Multan Registered EE households EE households Lighting Distribution of 637,282 CFLs AMS-II.J. 1 12.8 10 8 -1.6 1-May-14 128.460 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 48.2 Yes 23.076 21.501 19.926 18.352 16.777 15.203 13.628

560CPA0088.19 7811-0019 National CFL Project, Pakistan - MEPCO - Dera Ghazi Khan - 7-5-2-0-0 Asia & Pacific Southern Asia Pakistan Dera Ghazi Khan Registered EE households EE households Lighting Distribution of 459,758 CFLs AMS-II.J. 1 9.3 10 8 -1.1 1-May-14 92.680 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 34.7 Yes 16.648 15.512 14.376 13.240 12.104 10.968 9.832

561CPA0088.20 7811-0020 National CFL Project, Pakistan - MEPCO - Vehari - 7-5-3-0-0 Asia & Pacific Southern Asia Pakistan Vehari Registered EE households EE households Lighting Distribution of 650,000 CFLs AMS-II.J. 1 13.1 10 8 -1.6 1-May-14 131.030 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 49.1 Yes 23.536 21.930 20.324 18.718 17.112 15.506 13.900

562CPA0088.21 7811-0021 National CFL Project, Pakistan - MEPCO - Bahawalpur - 7-5-4-0-0 Asia & Pacific Southern Asia Pakistan Bahawalpur Registered EE households EE households Lighting Distribution of 675,000 CFLs AMS-II.J. 1 13.6 10 8 -1.7 1-May-14 136.070 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 51.0 Yes 24.441 22.774 21.106 19.438 17.770 16.103 14.435

563CPA0088.22 7811-0022 National CFL Project, Pakistan - MEPCO - Sahiwal - 7-5-5-0-0 Asia & Pacific Southern Asia Pakistan Sahiwal Registered EE households EE households Lighting Distribution of 640,242 CLFs AMS-II.J. 1 12.9 10 8 -1.6 1-May-14 129.060 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 48.4 Yes 23.183 21.601 20.019 18.437 16.855 15.274 13.692

564CPA0088.23 7811-0023 National CFL Project, Pakistan - MEPCO - Rahim Yar Khan - 7-5-6-0-0 Asia & Pacific Southern Asia Pakistan Rahim Yar Khan Registered EE households EE households Lighting Distribution of 650,000 CFLs AMS-II.J. 1 13.1 10 8 -1.6 1-May-14 131.030 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 49.1 Yes 23.536 21.930 20.324 18.718 17.112 15.506 13.900

565CPA0088.24 7811-0024 National CFL Project, Pakistan - MEPCO - Muzzafargarh - 7-5-7-0-0 Asia & Pacific Southern Asia Pakistan Muzzafargarh Registered EE households EE households Lighting Distribution of 675,000 CFLs AMS-II.J. 1 13.6 10 8 -1.7 1-May-14 136.070 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 51.0 Yes 24.441 22.774 21.106 19.438 17.770 16.103 14.435

566CPA0088.25 7811-0025 National CFL Project, Pakistan - MEPCO - Bahawalnagar - 7-5-8-0-0 Asia & Pacific Southern Asia Pakistan Bahawalnagar Registered EE households EE households Lighting Distribution of 650,000 CFLs AMS-II.J. 1 13.1 10 8 -1.6 1-May-14 131.030 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 49.1 Yes 23.536 21.930 20.324 18.718 17.112 15.506 13.900

567CPA0088.26 7811-0026 National CFL Project, Pakistan - PESCO - Peshawar - 8-6-1-0-0 Asia & Pacific Southern Asia Pakistan Peshawar Registered EE households EE households Lighting Distribution of 543,998 CFLs AMS-II.J. 1 13.4 10 8 -1.6 1-May-14 133.630 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 50.1 Yes 24.003 22.365 20.727 19.090 17.452 15.814 14.176

568CPA0088.27 7811-0027 National CFL Project, Pakistan - PESCO - Khyber - 8-6-2-0-0 Asia & Pacific Southern Asia Pakistan Khyber Registered EE households EE households Lighting Distribution of 527,780 CFLs AMS-II.J. 1 13.0 10 8 -1.6 1-May-14 129.640 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 48.6 Yes 23.287 21.698 20.109 18.520 16.931 15.342 13.754

569CPA0088.28 7811-0028 National CFL Project, Pakistan - PESCO - Mardan - 8-6-3-0-0 Asia & Pacific Southern Asia Pakistan Mardan Registered EE households EE households Lighting Distribution of 552,058 CFLs AMS-II.J. 1 13.6 10 8 -1.7 1-May-14 135.610 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 50.8 Yes 24.359 22.697 21.034 19.372 17.710 16.048 14.386

570CPA0088.29 7811-0029 National CFL Project, Pakistan - PESCO - Hazara-I - 8-6-4-1-0 Asia & Pacific Southern Asia Pakistan Hazara Registered EE households EE households Lighting Distribution of 221,328 CFLs AMS-II.J. 1 5.4 10 8 -0.7 1-May-14 54.370 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 20.4 Yes 9.766 9.099 8.433 7.767 7.100 6.434 5.768

571CPA0088.30 7811-0030 National CFL Project, Pakistan - PESCO - Hazara-II - 8-6-4-2-0 Asia & Pacific Southern Asia Pakistan Hazara Registered EE households EE households Lighting Distribution of 465,380 CFLs AMS-II.J. 1 11.4 10 8 -2.6 1-May-14 114.320 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 42.9 Yes 20.534 19.133 17.732 16.331 14.930 13.529 12.127

572CPA0088.31 7811-0031 National CFL Project, Pakistan - PESCO - Hazara-III - 8-6-4-3-0 Asia & Pacific Southern Asia Pakistan Hazara Registered EE households EE households Lighting Distribution of 319,412 CFLs AMS-II.J. 1 7.8 10 8 -1.0 1-May-14 78.460 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 42.9 Yes 14.093 13.132 12.170 11.209 10.247 9.285 8.324

573CPA0088.32 7811-0032 National CFL Project, Pakistan - PESCO - Swat-I - 8-6-5-1-0 Asia & Pacific Southern Asia Pakistan Swat Registered EE households EE households Lighting Distribution of 549,494 CFLs AMS-II.J. 1 13.5 10 8 -1.7 1-May-14 134.980 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 50.6 Yes 24.245 22.591 20.937 19.282 17.628 15.974 14.319

574CPA0088.33 7811-0033 National CFL Project, Pakistan - PESCO - Swat-II - 8-6-5-2-0 Asia & Pacific Southern Asia Pakistan Swat Registered EE households EE households Lighting Distribution of 255,286 CFLs AMS-II.J. 1 6.3 10 8 -0.8 1-May-14 62.710 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 23.5 Yes 11.264 10.495 9.727 8.958 8.190 7.421 6.635

575CPA0088.34 7811-0034 National CFL Project, Pakistan - PESCO - Bannu - 8-6-6-0-0 Asia & Pacific Southern Asia Pakistan Bannu Registered EE households EE households Lighting Distribution of 465,264 CFLs AMS-II.J. 1 11.4 10 8 -1.4 1-May-14 114.290 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 42.8 Yes 20.529 19.128 17.727 16.327 14.926 13.525 12.124

576CPA0088.35 7811-0035 National CFL Project, Pakistan - LESCO - Northern - 6-1-1-0-0 Asia & Pacific Southern Asia Pakistan Northern Registered EE households EE households Lighting Distribution of 600,000 CFLs AMS-II.J. 1 12.0 10 8 -1.5 1-May-14 120.070 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 45.0 Yes 21.567 20.096 18.624 17.152 15.681 14.209 12.738

577CPA0088.36 7811-0036 National CFL Project, Pakistan - LESCO - Central - 6-1-2-0-0 Asia & Pacific Southern Asia Pakistan Central Registered EE households EE households Lighting Distribution of 600,000 CFLs AMS-II.J. 1 12.0 10 8 -1.5 1-May-14 120.070 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 45.0 Yes 21.567 20.096 18.624 17.152 15.681 14.209 12.738

578CPA0088.37 7811-0037 National CFL Project, Pakistan - LESCO - Eastern - 6-1-3-0-0 Asia & Pacific Southern Asia Pakistan Eastern Registered EE households EE households Lighting Distribution of 500,000 CFLs AMS-II.J. 1 10.0 10 8 -1.2 1-May-14 100.060 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 37.5 Yes 17.973 16.746 15.520 14.294 13.067 11.841 10.615

579CPA0088.38 7811-0038 National CFL Project, Pakistan - LESCO - Okara - 6-1-4-0-0 Asia & Pacific Southern Asia Pakistan Okara Registered EE households EE households Lighting Distribution of 600,000 CFLs AMS-II.J. 1 12.0 10 8 -1.5 1-May-14 120.070 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 45.0 Yes 21.567 20.096 18.624 17.152 15.681 14.209 12.738

580CPA0088.39 7811-0039 National CFL Project, Pakistan - LESCO - Southern - 6-1-5-0-0 Asia & Pacific Southern Asia Pakistan Southern Registered EE households EE households Lighting Distribution of 600,000 CFLs AMS-II.J. 1 12.0 10 8 -1.5 1-May-14 120.070 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 45.0 Yes 21.567 20.096 18.624 17.152 15.681 14.209 12.738

581CPA0088.40 7811-0040 National CFL Project, Pakistan - LESCO - Sheikhupura - 6-1-6-0-0 Asia & Pacific Southern Asia Pakistan Sheikhupura Registered EE households EE households Lighting Distribution of 700,000 CFLs AMS-II.J. 1 14.0 10 8 -1.7 1-May-14 140.080 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 52.5 Yes 25.162 23.445 21.728 20.011 18.294 16.577 14.860

582CPA0088.41 7811-0041 National CFL Project, Pakistan - LESCO - Kasoor - 6-1-7-0-0 Asia & Pacific Southern Asia Pakistan Kasoor Registered EE households EE households Lighting Distribution of 600,000 CFLs AMS-II.J. 1 12.0 10 8 -1.5 1-May-14 120.070 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 45.0 Yes 21.567 20.096 18.624 17.152 15.681 14.209 12.738

583CPA0088.42 7811-0042 National CFL Project, Pakistan-HESCO- Hyderabad I - 4-7-1-0-0 Asia & Pacific Southern Asia Pakistan Hyderabad Registered EE households EE households Lighting Distribution of 573,000 CFLs AMS-II.J. 1 13.6 10 8 -1.7 1-May-14 135.860 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 50.9 Yes 24.403 22.738 21.073 19.408 17.743 16.078 14.413

584CPA0088.43 7811-0043 National CFL Project, Pakistan-HESCO- Hyderabad II - 4-7-2-0-0 Asia & Pacific Southern Asia Pakistan Hyderabad Registered EE households EE households Lighting Distribution of 222,000 CFLs AMS-II.J. 1 5.3 10 8 -0.6 1-May-14 52.640 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 19.7 Yes 9.455 8.810 8.164 7.519 6.874 6.229 5.584

585CPA0088.44 7811-0044 National CFL Project, Pakistan-HESCO- Nawabshah - 4-7-3-0-0 Asia & Pacific Southern Asia Pakistan Nawabshah Registered EE households EE households Lighting Distribution of 390,000 CFLs AMS-II.J. 1 9.2 10 8 -1.1 1-May-14 92.470 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 34.7 Yes 16.610 15.476 14.343 13.210 12.076 10.943 9.810

586CPA0088.45 7811-0045 National CFL Project, Pakistan - KESC - Region-I - 0-9-1-0-0 Asia & Pacific Southern Asia Pakistan Region I Registered EE households EE households Lighting Distribution of 551,368 CFLs AMS-II.J. 1 11.6 10 8 -1.4 1-May-14 116.190 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 43.6 Yes 20.870 19.446 18.022 16.598 15.174 13.750 12.326

587CPA0088.46 7811-0046 National CFL Project, Pakistan - KESC - Region-II - 0-9-2-0-0 Asia & Pacific Southern Asia Pakistan Region II Registered EE households EE households Lighting Distribution of 638,774 CFLs AMS-II.J. 1 13.5 10 8 -1.7 1-May-14 134.600 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 50.5 Yes 24.178 22.529 20.879 19.229 17.579 15.930 14.280

588CPA0088.47 7811-0047 National CFL Project, Pakistan - KESC - Region-III - 0-9-3-0-0 Asia & Pacific Southern Asia Pakistan Region III Registered EE households EE households Lighting Distribution of 713,312 CFLs AMS-II.J. 1 15.0 10 8 -1.8 1-May-14 150.310 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 56.3 Yes 27.000 25.158 23.315 21.473 19.631 17.788 15.946

589CPA0088.48 7811-0048 National CFL Project, Pakistan - KESC - Region-IV (A) - 0-9-4-1-0 Asia & Pacific Southern Asia Pakistan Region IV Registered EE households EE households Lighting Distribution of 398,274 CFLs AMS-II.J. 1 8.4 10 8 -1.0 1-May-14 83.930 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 31.5 Yes 15.075 14.047 13.018 11.989 10.961 9.932 8.903

590CPA0088.49 7811-0049 National CFL Project, Pakistan - KESC - Region-IV (B) - 0-9-4-2-0 Asia & Pacific Southern Asia Pakistan Region IV Registered EE households EE households Lighting Distribution of 398,272 CFLs AMS-II.J. 1 8.4 10 8 -1.0 1-May-14 83.930 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 31.5 Yes 15.075 14.046 13.018 11.989 10.961 9.932 8.903

591CPA0088.50 7811-0050 National CFL Project, Pakistan - QESCO - Central - 9-8-1-0-0 Asia & Pacific Southern Asia Pakistan Central Registered EE households EE households Lighting Distribution of 348,586 CFLs AMS-II.J. 1 8.8 10 8 -1.1 1-May-14 87.730 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 32.9 Yes 15.759 14.684 13.609 12.533 11.458 10.383 9.307

592CPA0088.51 7811-0051 National CFL Project, Pakistan - QESCO - Loralai - 9-8-2-0-0 Asia & Pacific Southern Asia Pakistan Loralai Registered EE households EE households Lighting Distribution of 60,000 CFLs AMS-II.J. 1 1.5 10 8 -0.2 1-May-14 15.100 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 5.7 Yes 2.713 2.527 2.342 2.157 1.972 1.787 1.602

593CPA0088.52 7811-0052 National CFL Project, Pakistan - QESCO - Khuzdar - 9-8-3-0-0 Asia & Pacific Southern Asia Pakistan Khuzdar Registered EE households EE households Lighting Distribution of 135,414 CFLs AMS-II.J. 1 3.4 10 8 -0.4 1-May-14 34.080 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 12.8 Yes 6.122 5.704 5.286 4.869 4.451 4.033 3.616

594CPA0088.53 7811-0053 National CFL Project, Pakistan - QESCO - Sibbi - 9-8-4-0-0 Asia & Pacific Southern Asia Pakistan Sibbi Registered EE households EE households Lighting Distribution of 56,000 CFLs AMS-II.J. 1 1.4 10 8 -0.2 1-May-14 14.090 DNV ADB CDM Facility 7-May-11 11-Sep-14 30-Dec-99 11 9 4 0 0.485 5.3 Yes 2.532 2.359 2.186 2.013 1.841 1.668 1.495

595PoA0089 GNA745N1O5RLC5R2KS4FTSUHORT304 8019 Asia & Pacific East Asia China Hebei Hebei Green Agriculture Co. Registered Methane avoidance Methane avoidance Manure 1 21.9 30-May-11 28 17.522 218.820 BV Cert 0.000 n.a. 11-May-11 1-Mar-12 23-Jan-13 21-Aug-13 25-Jan-13 CPA 31-Dec-99PoA 1 3 6 5 9 11 0.0

596CPA0089.01 8019-0001 Asia & Pacific East Asia China Baoding Hebei Green Agriculture Co. Registered Methane avoidance Methane avoidance Manure 1 21.9 10 20 0.0 1-Jan-12 17.522 218.820 BV Cert n.a. 11-May-11 25-Jan-13 30-Dec-99 1 3 6 5 9 11 0 ### 17,522.000 17,522.000 17,522.000 17,522.000 17,522.000 17,522.000 17,522.000 ### ###

597PoA0090 70BN4UMGGZBS2KK0RO9JCXJ98VHH4H Asia & Pacific Southeast Asia Singapore Singapore Climate Resources Exchange Replaced At Validation EE service EE service EE commercial buildings AMS-II.E. 6-Apr-10 28 BV Cert United K. (Standard Bank) Climate Resources Exchange 20-Aug-11 15-Dec-11 CPA 30-Dec-99PoA 9 4 5 7

598CPA0090.01 Asia & Pacific Southeast Asia Singapore Climate Resources Exchange Replaced At Validation EE service EE service EE commercial buildings AMS-II.E. 1 1.0 10 10 0.0 1-Jan-12 0.960 9.590 BV Cert United K. (Standard Bank) Climate Resources Exchange 20-Aug-11 15-Dec-11 30-Dec-99 9 4 5 7 0 0.451 2.1 No Other;Prevailing practice 0.960 0.960 0.960 0.960 0.960 0.960 0.960 0.960 0.960 0.960

599PoA0091 TM0LRZ3YPNDDYIOTOPWKX3NWFIKZ2P 5758 Malaysia Biomass Power Plant Project Asia & Pacific Southeast Asia Malaysia Malaysia GenPower Carbon Solutions Registered Biomass energy Biomass energy Palm oil solid waste ACM18 1 123.4 18-May-11 28 0.000 1,234.490 BV Cert 0.000 United K. (GenPower Carbon Solutions) GenPower Carbon Solutions 18-May-11 5-Jul-12 12-Dec-12 30-Jan-13 12-Dec-12 CPA 30-Dec-99CPA 9 4 1 5 8 10 10.0 3.000 3.000 3.000

600CPA0091.01 5758-0001 Bera 10MW Biomass Power Plant, Bera, Pahang (3.2750;102.5508 – PoA1) Asia & Pacific Southeast Asia Malaysia Pahang GenPower Carbon Solutions Registered Biomass energy Biomass energy Palm oil solid waste ACM18 1 123.4 10 21 20.0 1-Jun-13 0.000 1,234.490 BV Cert United K. (GenPower Carbon Solutions) GenPower Carbon Solutions 18-May-11 12-Dec-12 30-Dec-99 9 4 1 5 8 10 0 10.0 78840 0.672 No 3 91.772 87.630 102.353 114.775 125.255 134.096 141.556 147.849 153.158 157.637

601PoA0092 VT6JX7YYU1IMXM4VG3PCR7R56S22CF 9423 Asia & Pacific East Asia China Registered Hydro Hydro Run of river AMS-I.E. 1 0.8 20-Apr-11 28 1.570 8.480 JCI 0.000 Japan (PEAR Carbon Offset Initiative) PEAR Carbon Offset Initiative 25-May-11 1-Nov-12 17-Jan-14 7-Mar-14 17-Jan-14 CPA 31-Dec-99CPA 4 10 6 8 0.4

602CPA0092.01 9423-0001 Asia & Pacific East Asia China Sichuan Registered Hydro Hydro Run of river AMS-I.E. 1 0.8 10 10 0.0 20-Apr-11 1.570 8.480 JCI Japan (PEAR Carbon Offset Initiative) PEAR Carbon Offset Initiative 25-May-11 17-Jan-14 30-Dec-99 4 10 6 8 0 0.4 No N/A MSC 0.924 0.924 0.924 0.924 0.924 0.924 0.924 0.924 0.924 0.924

603PoA0093 9ZFN805XALDV0VFIGKN6GJ07EQSLMB Thailand small scale biomass power generation Asia & Pacific Southeast Asia Thailand PEA ENCOM Validation Terminated Biomass energy Biomass energy Gasification of biomass AMS-I.D. 1 3.2 3-Jun-11 28 4.267 32.080 AENOR 0.000 Spain (Government of Spain) WB-CF 3-Jun-11 CPA 30-Dec-99CPA 8 9 5 1 3 11 1.0

604CPA0093.01 Thailand small scale biomass power generation at Mae Lee Forest Plantation Asia & Pacific Southeast Asia Thailand Lamphun PEA ENCOM Validation Terminated Biomass energy Biomass energy Gasification of biomass AMS-I.D. 1 3.2 10 20 0.0 1-Sep-11 4.267 32.080 AENOR Spain (Government of Spain) WB-CF 3-Jun-11 30-Dec-99 8 9 5 1 3 11 -2 1.0 5519 0.581 Yes Investment 3 3.208 3.208 3.208 3.208 3.208 3.208 3.208 3.208 3.208 3.208

605PoA0094 NG0HESBBVUVT8RTRNQ4BUZIIZJULJS 2900 Solarwave water purification Africa East Africa Tanzania Tanzania Providing purified water to people Registered Solar Solar Solar PV water disinfection AMS-III.AV. 1 5.2 1-May-12 28 3.025 51.840 TÜV-Nord 0.000 Sweden (Tricorona Carbon Asset Management Sweden) 4-Jun-11 22-Feb-12 12-Jun-12 16-Jun-12 12-Jun-12 PoA 30-Dec-99CPA 3 8 6 0.0 Yes

606CPA0094.01 2900-0001 Solarwave water purification CPA 1 Africa East Africa Tanzania Tanzania Registered Solar Solar Solar PV water disinfection AMS-III.AV. 1 5.2 10 10 0.0 1-Jan-12 3.025 51.840 TÜV-Nord Sweden (Tricorona Carbon Asset Management Sweden) 4-Jun-11 12-Jun-12 30-Dec-99 3 8 6 0 No N/A MSC Yes 1.960 1.960 1.960 1.960 1.960 1.960 1.960 1.960 1.960 1.960

607PoA0095 H58B9JPB2EBQZ9E04FHXCQA873PBG4 Latin America South America Colombia Colombia GenPower Carbon Solutions Validation Terminated EE service EE service EE commercial buildings AMS-II.C. 1 0.4 29-Jun-11 28 0.529 3.916 BV Cert 0.000 United K. (GenPower Carbon Solutions) Optim Consult 29-Jun-11 PoA 30-Dec-99PoA 4 9 11 5 7 8 0.0

608CPA0095.01 Latin America South America Colombia Bogota GenPower Carbon Solutions Validation Terminated EE service EE service EE commercial buildings AMS-II.C. 1 0.4 7 21 0.0 1-Oct-11 0.529 3.916 BV Cert United K. (GenPower Carbon Solutions) Optim Consult 29-Jun-11 30-Dec-99 4 9 11 5 7 8 0 0.398 0.3 No 0.423 0.423 0.423 0.423 0.423 0.423 0.423 0.423 0.423 0.423 0.423 0.423 0.423 0.423 0.423 0.423 0.423 0.423 0.423 0.423 0.423

609PoA0096 L5CV5I7GGT09G4UV10NELEXQ4DZG63 Efficient Cook Stove Programme: Uganda Africa East Africa Uganda Uganda CZUGA At Validation EE households EE households Stoves AMS-II.G. 1 44.2 1-Sep-11 28 58.830 413.124 DNV 0.000 n.a. CO2Balance 29-Jun-11 19-Oct-11 PoA 30-Dec-99CPA 1 4 3 8 6 7 0.0

610CPA0096.01 CPA 1: Kanungu Improved Cook Stove Projects Africa East Africa Uganda Western CZUGA At Validation EE households EE households Stoves Fule efficient stoves AMS-II.G. 1 44.2 7 7 0.0 1-Sep-11 58.830 413.124 DNV n.a. CO2Balance 29-Jun-11 19-Oct-11 30-Dec-99 1 4 3 8 6 7 -5 No 44.233 44.233 44.233 44.233 44.233 44.233 44.233

611PoA0097 JUXOCEZ61GHILHF5F1YIXRA06HKH18 8055 Thailand energy efficiency improvement for street lightings Asia & Pacific Southeast Asia Thailand PEA ENCOM Registered EE service EE service Street lighting AMS-II.L. 5 4.6 16-Jun-11 28 0.000 45.950 AENOR 0.000 Sweden (Government of Sweden) WB-CF 30-Jun-11 19-Oct-12 6-Nov-12 29-Dec-12 11-Jun-12 PoA 30-Dec-99PoA 12 9 8 5 11 4 0.0

612CPA0097.01 8055-0001 Asia & Pacific Southeast Asia Thailand PEA ENCOM Registered EE service EE service Street lighting AMS-II.L. 1 0.0 10 8 0.0 1-May-13 0.000 0.230 AENOR Sweden (Government of Sweden) WB-CF 30-Jun-11 11-Jun-12 30-Dec-99 12 9 8 5 11 4 3 2.8 Yes Investment 3 0.023 0.023 0.023 0.023 0.023 0.023 0.023 0.023 0.023 0.023 0.023 0.023 0.008

613CPA0097.02 8055-0002 Asia & Pacific Southeast Asia Thailand PEA ENCOM Registered EE service EE service Street lighting AMS-II.L. 1 1.1 10 8 0.0 1-Jul-14 0.000 11.430 AENOR WB-CF 30-Jun-11 11-Jun-14 30-Dec-99 12 9 8 5 11 4 3 2.5 Yes Investment 3 0.571 1.143 1.143 1.143 1.143 1.143 1.143 1.143 1.143 1.143

614CPA0097.03 8055-0003 Asia & Pacific Southeast Asia Thailand PEA ENCOM Registered EE service EE service Street lighting AMS-II.L. 1 1.1 10 11 0.0 1-Jan-15 11.430 AENOR WB-CF 30-Jun-11 7-Nov-14 30-Dec-99 12 9 8 5 11 4 3 2.4 No Investment 3 1.143 1.143 1.143 1.143 1.143 1.143 1.143 1.143 1.143 1.143

615CPA0097.04 8055-0004 Asia & Pacific Southeast Asia Thailand PEA ENCOM Registered EE service EE service Street lighting AMS-II.L. 1 1.1 10 11 0.0 1-Jan-15 11.430 AENOR WB-CF 30-Jun-11 7-Nov-14 30-Dec-99 12 9 8 5 11 4 3 2.4 No Investment 3 1.143 1.143 1.143 1.143 1.143 1.143 1.143 1.143 1.143 1.143

616CPA0097.05 8055-0005 Asia & Pacific Southeast Asia Thailand PEA ENCOM Registered EE service EE service Street lighting AMS-II.L. 1 1.1 10 11 0.0 1-Jan-15 11.430 AENOR WB-CF 30-Jun-11 7-Nov-14 30-Dec-99 12 9 8 5 11 4 3 2.4 No Investment 3 1.143 1.143 1.143 1.143 1.143 1.143 1.143 1.143 1.143 1.143

617PoA0098 2MJW8CICWDNRL1F72DM11M3M8A6Q8M 6511 Asia & Pacific Southeast Asia Indonesia Indonesia PT.Carbon Agro Indo Registered Methane avoidance Methane avoidance Composting AMS-III.F. 1 10.1 4-Jul-11 28 0.000 81.068 DNV 0.000 n.a. Carbon Conservation 1-Jul-11 6-Mar-12 29-Jun-12 28-Aug-12 29-Jun-12 CPA 30-Dec-99CPA 7 1 6 3 5 9 0.0

618CPA0098.01 6511-0001 Socfindo EFB plus POME Co-composting Project Asia & Pacific Southeast Asia Indonesia North Sumatra PT.Carbon Agro Indo Registered Methane avoidance Methane avoidance Composting AMS-III.F. 1 10.1 7 20 2.0 1-Jan-13 0.000 81.068 DNV n.a. Carbon Conservation 1-Jul-11 29-Jun-12 30-Dec-99 7 1 6 3 5 9 -2 No Financial 3 11.973 14.493 16.618 18.411 19.924 19.924 22.276 22.276 22.276 22.276 22.276 22.276 22.276 22.276 22.276 22.276 22.276 22.276 22.276 22.276 22.276

619PoA0099 QJO11TO97AW4ND0APXYL7XVNUCSMU4 LED‘s save energy Asia & Pacific Southern Asia India India Mabanaft Replaced At Validation EE service EE service Lighting in service AMS-II.C. 1-Sep-11 28 SQS Netherlands (Mabanaft+Do-inc.) Do-inc. 1-Jul-11 20-Dec-11 PoA 30-Dec-99PoA 2 9 12 7 11

620CPA0099.01 LED‘s save energy – CPA-001 Asia & Pacific Southern Asia India India Mabanaft Replaced At Validation EE service EE service Lighting in service Installation of LED lighting equipment AMS-II.C. 1 67.1 10 10 3.0 1-Mar-12 56.089 670.920 SQS Netherlands (Mabanaft+Do-inc.) Do-inc. 1-Jul-11 20-Dec-11 30-Dec-99 2 9 12 7 11 -2 0.897 No 38.058 56.517 74.602 73.856 73.118 72.386 71.662 70.946 70.236 69.534

621PoA0100 D1W68MA7FK8E5CH1BG05BNM8R8V36Y 6198 Tunki Small Scale Hydropower Program of Activities Latin America South America Peru Peru EcoRessources Registered Hydro Hydro Run of river AMS-I.D. 4 95.0 23-Aug-11 28 0.000 513.795 SQS 41.948 41.948 1 28-Dec-15 31-Oct-16 Germany (Carbonbay), Sweden (Government of Sweden) Netherlands (Mabanaft) EcoRessources 7-Jul-11 7-Nov-11 28-Jun-12 14-Aug-12 28-Jun-12 CPA 30-Dec-99CPA 5 9 12 10 11 23.5

622CPA0100.01 6198-0001 Coelvihidro 1, Quipico Hydro Power Plant – Tunki PoA CPA # 1 Latin America South America Peru Lima EcoRessources Registered Hydro Hydro Run of river 1.68 MW run of river hydropower plant AMS-I.D. 1 8.6 7 40 0.0 1-Apr-13 0.000 66.967 SQS 13.015 13.015 1 28-Dec-15 31-Oct-16 AENOR Germany (Carbonbay), Sweden (Government of Sweden) EcoRessources 7-Jul-11 28-Jun-12 30-Dec-99 5 9 12 10 11 -2 1.7 12170 0.567 No Investment 3 6.897 6.897 6.897 6.897 6.897 6.897 6.897

623CPA0100.02 6198-0002 Canchayllo Hydro Power Plant, Pachacayo – Tunki PoA CPA #2 Latin America South America Peru Junin Province EcoRessources Registered Hydro Hydro Run of river AMS-I.D. 1 28.1 7 30 0.0 1-Oct-14 175.860 SQS 28.933 28.933 27-Sep-16 31-Oct-16 AENOR EcoRessources 7-Jul-11 13-Dec-14 30-Dec-99 5 9 12 10 11 -2 5.3 46112 0.610 No Investment 3 9.372 28.116 28.116 28.116 28.116 28.116 28.116 18.744

624CPA0100.03 6198-0003 Latin America South America Peru Canas Province EcoRessources Registered Hydro Hydro Run of river 3.39 MW Run of river hydropower plant AMS-I.D. 1 8.9 7 30 0.0 15-Feb-14 61.117 SQS 0.000 0.000 29-Aug-17 31-Oct-16 AENOR EcoRessources 7-Jul-11 13-Dec-14 30-Dec-99 5 9 12 10 11 -2 3.4 17027 0.610 No Investment 7.033 8.884 8.884 8.884 8.884 8.884 8.884 1.850

625CPA0100.04 6198-0004 Zaña Hydro Power Plant, Monte Seco1 – Tunki PoA CPA #3 Latin America South America Peru Lima Carbonbay GmbH & Co. KG Registered Hydro Hydro Run of river 13.2 MW Run of river hydropower plant AMS-I.D. 1 49.4 7 30 0.0 1-Oct-16 209.852 SQS 0.000 Carbonbay GmbH & Co. KG 7-Jul-11 30-Oct-15 30-Dec-99 5 9 12 10 11 -2 13.2 81760 0.610 No Investment 12.338 49.354 49.354 49.354 49.354 49.354 49.354 37.015

626PoA0101 QRDHOSYSAZFTTMGDJ9T4SOHAXK4DV3 6159 ETA Solar Water Heater Programme in South Africa Africa Southern Africa South Africa South Africa ETA Energy Registered Solar Solar Solar water heating AMS-I.J. 1 20.4 24-Feb-10 28 6.783 203.700 JCI 0.000 Finland (GreenStream Network) CarbonStream Africa 9-Jul-11 1-Mar-12 7-May-12 14-Sep-12 25-Jul-12 PoA 30-Dec-99CPA 1 3 4 5 8 7 0.0 MSC

627CPA0101.01 6159-0001 Africa Southern Africa South Africa Kwazulu-Natal ETA Energy Registered Solar Solar Solar water heating AMS-I.J. 1 20.4 10 15 3.0 1-Sep-12 6.783 203.700 JCI Finland (GreenStream Network) CarbonStream Africa 9-Jul-11 25-Jul-12 30-Dec-99 1 3 4 5 8 7 0 0.980 23.0 No MSC 6.988 16.771 25.157 27.952 27.952 27.952 27.952 27.952 27.952 27.952

628PoA0102 M9OTRG957HGPY1SQ7K4EQ6PCV1SALV 9437 Cogeneration and/or trigeneration at commercial sites. Africa Southern Africa South Africa South Africa Promethium Carbon Registered EE supply side EE supply side Cogeneration AMS-II.K. 1 4.7 1-Feb-13 28 0.000 47.420 Carbon Check 0.000 n.a. Promethium Carbon 12-Jul-11 31-Oct-12 31-Dec-12 12-Jul-13 31-Dec-12 CPA 30-Dec-99CPA 1 3 10 11 5 2.1

629CPA0102.01 9437-0001 Cogeneration and/or trigeneration at commercial sites, number 001, Centurion. Africa Southern Africa South Africa Pretoria Promethium Carbon Registered EE supply side EE supply side Cogeneration AMS-II.K. 1 4.7 10 10 0.0 1-Jan-14 0.000 47.420 Carbon Check n.a. Promethium Carbon 12-Jul-11 31-Dec-12 30-Dec-99 1 3 10 11 5 3 2.1 18642 0.900 No 4.742 4.742 4.742 4.742 4.742 4.742 4.742 4.742 4.742 4.742

630PoA0103 L69OFXPQFJEJZXA25MQDM6CJ7NGMDV Philippines – Chiller Energy Efficiency Programme (PCEEP) Asia & Pacific Southeast Asia Philippines Philippines Validation Terminated EE service EE service Air conditioning AM60 1 0.1 12-Jul-11 28 0.060 0.630 TÜV-SÜD 0.000 Germany (KfW) 12-Jul-11 CPA 30-Dec-99PoA 9 4 1 0.0

631CPA0103.01 Philippines –Chiller Energy Efficiency Program: CPA 1 Manila Peninsula Hotel Asia & Pacific Southeast Asia Philippines Manila Validation Terminated EE service EE service Air conditioning AM60 1 0.1 10 7 0.0 1-Feb-12 0.060 0.630 TÜV-SÜD Germany (KfW) 12-Jul-11 30-Dec-99 9 4 1 0 0.484 Yes 0.083 0.061 0.061 0.061 0.061 0.061 0.061 0.061 0.061 0.061

632PoA0104 KGHGC1KOOSFUZWO7K5EZBAFSG28M2A 8383 Asia & Pacific Southeast Asia Papua New Guinea Papua New Guinea PNG Power Registered Hydro Hydro Run of river 2 34.8 30-Sep-12 28 0.000 178.341 TÜV-SÜD 0.000 Sweden (Government of Sweden) ADB CDM Facility 12-Jul-11 21-Aug-12 23-Nov-12 25-Jan-13 23-Nov-12 CPA 30-Dec-99CPA 9 8 10 6.3

633CPA0104.01 8383-0001 Divune Hydropower Project, Oro Province, Papua New Guniea Asia & Pacific Southeast Asia Papua New Guinea Oro PNG Power Registered Hydro Hydro Run of river 3 MW run of river plant 1 15.7 7 30 0.0 30-Aug-14 0.000 99.729 TÜV-SÜD Sweden (Government of Sweden) ADB CDM Facility 12-Jul-11 23-Nov-12 30-Dec-99 9 8 10 0 3.3 26000 0.800 No N/A MSC 20.800 15.724 15.724 15.724 15.724 15.724 15.724 20.800 15.724 15.724 15.724 15.724 15.724 20.800 15.724 15.724 15.724 15.724 15.724 15.724 15.724 15.724 14-Jan-00 14-Jan-00 14-Jan-00 14-Jan-00 14-Jan-00 14-Jan-00

634CPA0104.02 8383-0002 Asia & Pacific Southeast Asia Papua New Guinea Bougainville PNG Power Registered Hydro Hydro Run of river 3 MW run of river plant 1 19.0 7 30 0.0 15-Nov-16 0.000 78.612 TÜV-SÜD ADB CDM Facility 12-Jul-11 31-Dec-13 30-Dec-99 9 8 10 0 3.0 23800 0.800 No N/A MSC 19.040 19.040 19.040 19.040 19.040 19.040 19.040

635PoA0105 TGKZ5U20I84R7UPZ2Q2FNJJWVVLC7T 6119 CFL Distribution Programme in Anhui Province Asia & Pacific East Asia China Anhui Registered EE households EE households Lighting AMS-II.J. 1 16.5 1-Nov-11 28 0.000 164.930 CEC 0.000 n.a. SinoCarbon Innovation & Investment 16-Jul-11 1-Nov-11 4-Sep-12 26-Oct-12 4-Sep-12 PoA 30-Dec-99CPA 4 9 0.0

636CPA0105.01 6119-0001 “CFL Distribution Programme in Anhui Province” CPA 001 Asia & Pacific East Asia China Registered EE households EE households Lighting Distribution of CFLs AMS-II.J. 1 16.5 10 8 -3.0 4-Oct-12 0.000 164.930 CEC n.a. SinoCarbon Innovation & Investment 16-Jul-11 4-Sep-12 30-Dec-99 4 9 0 0.769 45.0 No Investment 4 45.668 42.552 39.435 36.319 33.203 30.087 26.971 20.253 0.000 0.000

637PoA0106 DV2KE3HA21Y7XW6W4UIBSVZ25375N6 7398 Standard Bank Energy Efficient Commercial Lighting Programme of Activities Africa Southern Africa South Africa Standard Bank of South Africa Registered EE service EE service Lighting in service AMS-II.C. 1 2.4 19-Jul-11 28 0.012 24.220 BV Cert 0.000 n.a. United K. (Standard Bank) 19-Jul-11 11-Apr-12 31-Dec-12 28-Jun-13 5-Aug-13 2 PoA 30-Dec-99PoA 9 5 11 1 0.0

638CPA0106.01 7398-0001 Africa Southern Africa South Africa Johannesburg Standard Bank of South Africa Registered EE service EE service Lighting in service AMS-II.C. 1 2.4 10 10 0.0 28-Dec-12 0.012 24.220 BV Cert n.a. United K. (Standard Bank) 19-Jul-11 5-Aug-132 30-Dec-99 9 5 11 1 3 1.010 No Financial;Technological 2.423 2.423 2.423 2.423 2.423 2.423 2.423 2.423 2.423 2.423

639PoA0107 HHW7HMV2JLVMTVK3UHM6XW9VFJK07O Asia & Pacific East Asia South Korea South Korea Korea Environment Corporation Validation Terminated Methane avoidance Methane avoidance Industrial solid waste AMS-I.C. 1 2.6 30-Nov-10 28 1.515 25.980 TÜV-SÜD 0.000 n.a. n.a. 23-Jul-11 CPA 31-Dec-99CPA 1 9 11 0.6

640CPA0107.01 Asia & Pacific East Asia South Korea Ulsan Korea Environment Corporation Validation Terminated Methane avoidance Methane avoidance Industrial solid waste AMS-I.C. 1 2.6 10 0.0 1-Jun-12 1.515 25.980 TÜV-SÜD n.a. n.a. 23-Jul-11 30-Dec-99 1 9 11 0 0.6 330 0.556 No Investment 3 2.598 2.598 2.598 2.598 2.598 2.598 2.598 2.598 2.598 2.598

641PoA0108 1HJL7L33S8ZXZFFWFL4U62FD855UN8 9020 CFL Distribution Programme in Sichuan Province Asia & Pacific East Asia China Sichuan Registered EE households EE households Lighting AMS-II.J. 1 30.8 31-Jan-13 28 0.000 308.180 BV Cert 0.000 n.a. SinoCarbon Innovation & Investment 27-Jul-11 1-Dec-11 28-Dec-12 29-Mar-13 28-Dec-12 PoA 30-Dec-99CPA 4 9 0.0 Plist

642CPA0108.01 9020-0001 “CFL Distribution Programme in Sichuan Province” CPA 001 Asia & Pacific East Asia China Jiange County Registered EE households EE households Lighting Distribution of CFLs AMS-II.J. 1 30.8 10 8 -3.0 31-Jan-13 0.000 308.180 BV Cert n.a. SinoCarbon Innovation & Investment 27-Jul-11 28-Dec-12 30-Dec-99 4 9 0 0.771 45.0 No Investment Plist 4 40.144 37.405 34.665 31.926 29.187 26.448 23.709 17.741 0.000 0.000

643PoA0109 MGV8ZMW0TLTCC04FT77WU7848AC6A4 5962 International water purification programme Africa East Africa Uganda Registered EE service EE service Water purification AMS-III.AV. 22 947.9 19-Nov-12 28 0.000 4,191.820 GLC 34.665 22-Apr-16 31-May-16 South Pole Carbon Asset Management 29-Jul-11 6-Jan-12 16-Nov-12 21-Dec-12 16-Nov-12 PoA 30-Dec-99CPA 8 9 6 1 5 3 0.0

644CPA0109.01 5962-0001 Gravity Driven Membrane Filters in Uganda - CPA 1 Africa East Africa Uganda Central Registered EE service EE service Water purification AMS-III.AV. 1 6.3 7 10 2.7 1-Jan-13 0.000 50.049 GLC South Pole Carbon Asset Management 29-Jul-11 16-Nov-12 30-Dec-99 8 9 6 1 5 3 0 No N/A MSC 2.110 4.221 8.441 12.662 18.992 18.992 18.992 18.992 18.992 18.992 18.992 18.992 18.992 18.992 18.992 18.992 18.992 18.992 18.992 18.992 18.992

645CPA0109.02 5962-0002 Chlorine Dispensers in Uganda – CPA 2 Africa East Africa Uganda Eastern Uganda Registered EE service EE service Water purification AMS-III.AV. 1 58.3 7 5 0.0 19-Aug-14 0.000 371.434 GLC 31.072 31.072 22-Apr-16 31-May-16 South Pole Carbon Asset Management 29-Jul-11 17-Jul-14 30-Dec-99 8 9 6 1 5 3 0 Yes N/A MSC 52.434 59.261 59.261 59.261 59.261 59.261 59.261

646CPA0109.03 5962-0003 Chlorine Dispensers in Uganda – CPA 3 Africa East Africa Uganda Eastern Uganda Registered EE service EE service Water purification AMS-III.AV. 1 44.7 7 5 0.0 10-Apr-15 256.439 GLC 3.593 3.593 9-Mar-18 31-May-16 South Pole Carbon Asset Management 29-Jul-11 15-Apr-15 30-Dec-99 8 9 6 1 5 3 0 Yes N/A MSC 44.742 44.742 44.742 44.742 44.742 44.742 44.742

647CPA0109.04 5962-0004 Chlorine Dispensers in Malawi – CPA 5 Africa Southeast Africa Malawi Malawi Registered EE service EE service Water purification AMS-III.AV. 1 6.3 7 5 0.0 17-Nov-15 32.058 GLC South Pole Carbon Asset Management 29-Jul-11 19-Nov-15 30-Dec-99 8 9 6 1 5 3 0 Yes N/A MSC 48.066 53.914 53.914 53.914 53.914 53.914 53.914

648CPA0109.05 5962-0005 Chlorine Dispensers in Kenya - CPA 6 Africa East Africa Kenya Busia County Pure Water Ltd. Registered EE service EE service Water purification AMS-III.AV. 1 59.9 7 5 0.0 21-Jan-16 296.342 GLC South Pole Carbon Asset Management 29-Jul-11 21-Jan-16 30-Dec-99 8 9 6 1 5 3 0 Yes N/A 54.394 59.892 59.892 59.892 59.892 59.892 59.892

649CPA0109.06 5962-0006 Chlorine Dispensers in Kenya - CPA 7 Africa East Africa Kenya Pure Water Ltd. Registered EE service EE service Water purification AMS-III.AV. 1 41.9 7 5 0.0 21-Jan-16 207.561 GLC South Pole Carbon Asset Management 29-Jul-11 21-Jan-16 30-Dec-99 8 9 6 1 5 3 0 Yes N/A 24.879 44.794 44.794 44.794 44.794 44.794 44.794

650CPA0109.07 5962-0007 Chlorine Dispensers in Malawi - CPA 8 Africa Southeast Africa Malawi Pure Water Ltd. Registered EE service EE service Water purification AMS-III.AV. 1 49.0 7 5 0.0 21-Jan-16 242.459 GLC South Pole Carbon Asset Management 29-Jul-11 21-Jan-16 30-Dec-99 8 9 6 1 5 3 0 Yes N/A 40.888 50.355 50.355 50.355 50.355 50.355 50.355

651CPA0109.08 5962-0008 Chlorine Dispensers in Uganda - CPA 9 Africa East Africa Uganda Pure Water Ltd. Registered EE service EE service Water purification AMS-III.AV. 1 59.3 7 5 0.0 13-Sep-16 255.239 GLC South Pole Carbon Asset Management 29-Jul-11 13-Sep-16 30-Dec-99 8 9 6 1 5 3 0 Yes N/A 57.663 59.619 59.619 59.619 59.619 59.619 59.619

652CPA0109.09 5962-0009 Chlorine Dispensers in Uganda - CPA 10 Africa East Africa Uganda Pallisa District Pure Water Ltd. Registered EE service EE service Water purification AMS-III.AV. 1 57.5 7 5 0.0 13-Sep-16 247.290 GLC South Pole Carbon Asset Management 29-Jul-11 13-Sep-16 30-Dec-99 8 9 6 1 5 3 0 Yes N/A 56.340 57.491 57.491 57.491 57.491 57.491 57.491

653CPA0109.10 5962-0010 Chlorine Dispensers in Malawi - CPA 11 Africa Southeast Africa Malawi Zomba district Pure Water Ltd. Registered EE service EE service Water purification AMS-III.AV. 1 44.2 7 5 0.0 13-Sep-16 190.185 GLC South Pole Carbon Asset Management 29-Jul-11 13-Sep-16 30-Dec-99 8 9 6 1 5 3 0 Yes N/A 38.142 45.228 45.228 45.228 45.228 45.228 45.228

654CPA0109.11 5962-0011 Chlorine Dispensers in Kenya - CPA 12 Africa East Africa Kenya Siaya County Pure Water Ltd. Registered EE service EE service Water purification AMS-III.AV. 1 52.5 7 5 0.0 13-Sep-16 225.714 GLC South Pole Carbon Asset Management 29-Jul-11 13-Sep-16 30-Dec-99 8 9 6 1 5 3 0 Yes N/A 48.495 53.138 53.138 53.138 53.138 53.138 53.138

655CPA0109.12 5962-0012 Chlorine Dispensers in Kenya - CPA 13 Africa East Africa Kenya Siaya County Pure Water Ltd. Registered EE service EE service Water purification AMS-III.AV. 1 58.7 7 5 0.0 13-Sep-16 252.370 GLC South Pole Carbon Asset Management 29-Jul-11 13-Sep-16 30-Dec-99 8 9 6 1 5 3 0 Yes N/A 56.129 58.672 58.672 58.672 58.672 58.672 58.672

656CPA0109.13 5962-0013 Chlorine Dispensers in Kenya - CPA 14 Africa East Africa Kenya Migori County Pure Water Ltd. Registered EE service EE service Water purification AMS-III.AV. 1 48.7 7 5 0.0 13-Sep-16 209.666 GLC South Pole Carbon Asset Management 29-Jul-11 13-Sep-16 30-Dec-99 8 9 6 1 5 3 0 Yes N/A 45.295 49.319 49.319 49.319 49.319 49.319 49.319

657CPA0109.14 5962-0014 Water Kiosks in Cambodia – CPA 4 Asia & Pacific Southeast Asia Cambodia Cambodia Pure Water Ltd. Registered EE service EE service Water purification AMS-III.AV. 1 7.3 7 21 0.0 1-Jan-17 29.284 GLC South Pole Carbon Asset Management 29-Jul-11 5-Dec-16 30-Dec-99 8 9 6 1 5 3 0 Yes N/A 4.257 5.509 6.761 8.681 8.681 8.681 8.681

658CPA0109.15 5962-0015 Chlorine Dispensers in Kenya – CPA 15 Africa East Africa Kenya Pure Water Ltd. Registered EE service EE service Water purification AMS-III.AV. 1 35.8 7 21 0.0 1-Feb-17 140.308 GLC South Pole Carbon Asset Management 29-Jul-11 1-Feb-17 30-Dec-99 8 9 6 1 5 3 0 Yes N/A 32.211 36.443 36.443 36.443 36.443 36.443 36.443

659CPA0109.16 5962-0016 Chlorine Dispensers in Kenya – CPA 20 Africa East Africa Kenya Pure Water Ltd. Registered EE service EE service Water purification AMS-III.AV. 1 33.7 7 21 0.0 1-Feb-17 131.793 GLC South Pole Carbon Asset Management 29-Jul-11 1-Feb-17 30-Dec-99 8 9 6 1 5 3 0 Yes N/A 18.188 36.242 36.242 36.242 36.242 36.242 36.242

660CPA0109.17 5962-0017 Chlorine Dispensers in Uganda – CPA 21 Africa East Africa Uganda Butaleja District Pure Water Ltd. Registered EE service EE service Water purification AMS-III.AV. 1 59.5 7 21 0.0 1-Feb-17 233.021 GLC South Pole Carbon Asset Management 29-Jul-11 1-Feb-17 30-Dec-99 8 9 6 1 5 3 0 Yes N/A 59.519 59.519 59.519 59.519 59.519 59.519 59.519

661CPA0109.18 5962-0018 Chlorine Dispensers in Uganda – CPA 22 Africa East Africa Uganda Busia District Pure Water Ltd. Registered EE service EE service Water purification AMS-III.AV. 1 56.7 7 21 0.0 1-Feb-17 221.914 GLC South Pole Carbon Asset Management 29-Jul-11 1-Feb-17 30-Dec-99 8 9 6 1 5 3 0 Yes N/A 37.787 59.831 59.831 59.831 59.831 59.831 59.831

662CPA0109.19 5962-0019 Chlorine Dispensers in Kenya - CPA 16 Africa East Africa Kenya Pure Water Ltd. Registered EE service EE service Water purification AMS-III.AV. 1 43.5 7 21 0.0 6-Jun-17 155.505 GLC South Pole Carbon Asset Management 29-Jul-11 6-Jun-17 30-Dec-99 8 9 6 1 5 3 0 Yes N/A 40.324 44.061 44.061 44.061 44.061 44.061 44.061

663CPA0109.20 5962-0020 Chlorine Dispensers in Kenya - CPA 17 Africa East Africa Kenya Pure Water Ltd. Registered EE service EE service Water purification AMS-III.AV. 1 38.8 7 21 0.0 6-Jun-17 138.456 GLC South Pole Carbon Asset Management 29-Jul-11 6-Jun-17 30-Dec-99 8 9 6 1 5 3 0 Yes N/A 34.058 39.538 39.538 39.538 39.538 39.538 39.538

664CPA0109.21 5962-0021 Chlorine Dispensers in Kenya - CPA 18 Africa East Africa Kenya Kakamega County Pure Water Ltd. Registered EE service EE service Water purification AMS-III.AV. 1 47.1 7 21 0.0 6-Jun-17 168.202 GLC South Pole Carbon Asset Management 29-Jul-11 6-Jun-17 30-Dec-99 8 9 6 1 5 3 0 Yes N/A 43.877 47.615 47.615 47.615 47.615 47.615 47.615

665CPA0109.22 5962-0022 Chlorine Dispensers in Kenya - CPA 19 Africa East Africa Kenya Kakamega County Pure Water Ltd. Registered EE service EE service Water purification AMS-III.AV. 1 38.2 7 21 0.0 6-Jun-17 136.531 GLC South Pole Carbon Asset Management 29-Jul-11 6-Jun-17 30-Dec-99 8 9 6 1 5 3 0 Yes N/A 36.140 38.562 38.562 38.562 38.562 38.562 38.562

666PoA0110 XYW5W4UWUNTM08R3ESTELV32OY0ET6 9956 Up Energy Improved Cookstove Programme, Uganda Africa East Africa Uganda Uganda Up Energy Group USA Registered EE households EE households Stoves AMS-II.G. 12 539.7 27-Jun-11 28 17.181 2,541.480 DNV 50.158 50.158 16-Sep-16 10-Dec-15 Earthhood Sweden (Government of Sweden) CIRCODU 2-Aug-11 13-May-13 7-Jul-14 23-Sep-14 22-Jul-14 PoA 30-Dec-99PoA 4 1 8 9 6 0.0

667CPA0110.01 9956-0001 Wood Improved Cookstoves Carbon Project Activity 1 Africa East Africa Uganda Uganda Up Energy Group USA Registered EE households EE households Stoves AMS-II.G. 1 44.9 7 21 6.0 1-Jan-11 17.181 448.986 DNV 20.729 20.729 16-Sep-16 10-Dec-15 Earthhood Sweden (Government of Sweden) CIRCODU 2-Aug-11 22-Jul-14 30-Dec-99 4 1 8 9 6 0 No Prevailing practice 17.181 41.181 47.215 44.518 40.592 35.868 30.957 36.787 36.787 36.787 36.787 36.787 36.787 36.787 36.787 36.787 36.787 36.787 36.787 36.787 36.787

Improved Cook Stoves for East Africa (ICSEA)

This CPA shall be active in the production, marketing, distribution and sales of portable/fixed, domestic/institutional , charcoal /firewood improved cook stoves (ICS)

Improved Cook Stoves for East Africa (ICSEA)

This CPA shall be active in the production, marketing, distribution and sales of portable/fixed, domestic/institutional , charcoal /firewood improved cook stoves (ICS)

Improved Cook Stoves for East Africa (ICSEA)

This CPA shall be active in the production, marketing, distribution and sales of portable/fixed, domestic/institutional , charcoal /firewood improved cook stoves (ICS)

Developmenta l Association for Renewable Energ ies

To enhance the penetration of efficient cookstoves by offering cost-effective efficient stoves

Developmenta l Association for Renewable Energ iesDevelopmenta l Association for Renewable Energ iesDevelopmenta l Association for Renewable Energ ies

Enviro fit G3300 and possiblyalso the M5000 cooking stoves

Developmenta l Association for Renewable Energ ies

Enviro fit G3300 and possiblyalso the M5000 cooking stoves

Developmenta l Association for Renewable Energ ies

Enviro fit G3300 and possiblyalso the M5000 cooking stoves

To reduce a sign ificant amount of GHG emiss ions from the palm oilmills in Malaysia

(Pahang) Sri Senggora Palm Oil Mil l

High Efficiency Wastewater Fermentation System with biogas recovery

Investment;Prevailing practice;Technological

Benchmark analysis

High Efficiency Wastewater Fermentation System

Simple cost analysis

Kinabatangan, Sabah

High Efficiency Wastewater Fermentation System with biogas recovery

Benchmark analysis

High Efficiency Wastewater Fermentation System

Benchmark analysis

High Efficiency Wastewater Fermentation System

Benchmark analysis

High Efficiency Wastewater Fermentation System

Benchmark analysis

To instal l fuel efficient cooking stoves throughout Zambia

15,939 domestic fuel-e fficient stoves by 3 Rocks Ltd

Simple cost analysis

Investment and Trade Consultancy Company (INTRACO)

To develop a p latform to overcome insti tu tional, financial and structuralhurdles for the construction of a series of new unburnt brick plants

Investment and Trade Consultancy Company (INTRACO)

Other;P revai ling practice;Technological

Rura l Support Programmes Network

To improve the quality of l ife of rural farmers, particu larly women, and their live lihoods in Pakistanthrough exploi ting the market and non-market benefits of domestic b iogas

Pakistan Domestic Biogas Programme (PDBP), Central Punjab CDM Programme Activity (CPA-1)

Rura l Support Programmes Network

Investment;Technological

Mexican National Housing Commission (Conavi)

Promoting sustainable development by reducing GHG emissions throughthe implementation of technologies and design measures which will improve the energyperformance and reduce e lectrici ty and/or gas use in new residences

Mexican Housing Commission S ustainable Housing Program of Activities – 10.10-11.03.dry temperate

Mexican National Housing Commission (Conavi)

EE and RE generation for residence build ings

Investment;Other;Prevail ing practice

To contribute to the sustainable development of South Africa and to transform theenergy efficiency of South Africa’s installed base of l ighting applications.

Light Emitting Diode (LED) lighting devices in mining and petrochemical plant activities

To construct and d istribute approximate ly 300,000 efficient cooking stoves free-of-chargeto rural households cooking with fi rewood in Kenya

CPA 1: Eldoret East and Keiyo Districts (Efficient Cook Stove Programme: Kenya)

Financial ;Investment;Prevai ling practice;Technological

Financial ;Investment;Prevai ling practice

To develop a p latform for overcoming insti tu tional, financial and structural hurdles for the construction of a series of small sc ale grid connected so lar power pro jects in India

15122010 Fi rs t Bundled CPA on Grid Connected Solar Power Pro ject in India by SENES consultants

PV power of 15 MW - through grid connected so lar PV based energy generation units o f 1 MW

Investment;Technological

A grid connected solar PV based energy generation unit o f 5MW capacity

Investment;Prevailing practice

Benchmark analysis

2 grid connected solar PV based energy generation units each of 5MW capacity

Investment;Prevailing practice

Benchmark analysis

11062012 Third Bundled CPA on Grid Connected Solar Power Pro ject in India by SENES consultants

2 grid connected solar PV based energy generation units each of 12MW and 2 MW capacity

Investment;Prevailing practice

Benchmark analysis

A grid connected solar PV based energy generation unit o f 14MW capacity

Investment;Prevailing practice

Benchmark analysis

A grid connected solar PV based energy generation unit o f 15MW capacity

Investment;Prevailing practice

Benchmark analysis

Install Solar PV at 13 locations, wi th at to tal capacity of 14.10MW

Investment;Prevailing practice

Benchmark analysis

Severa l sta tes in India

Install Solar PV at 11 locations, wi th a to tal capacity of 14.5MW

Investment;Prevailing practice

Benchmark analysis

Severa l sta tes in India

The CPA consti tu tes of 5 Solar PV based power generation units.

Programme of Activities for adoption of se lf-bal lasted compact fluorescent lamps (CFLs) to replace incandescent lamps (ICLs) in Jiangxi Province, China

Jiangxi Gaoxin Clean Energy dev elopment Co.

Efficient use of electricity through adoption of CFLs in residential applications

Jiangxi Gaoxin Clean Energy development Co.

Programme of Activities for adoption of se lf-bal lasted compact fluorescent lamps (CFLs) to replace incandescent lamps (ICLs) in Jiangxi Province, China CPA -001

Jiangxi Gaoxin Clean Energy dev elopment Co.

Jiangxi Gaoxin Clean Energy development Co.

Investment comparison analysis

Zhenjiang Qiangling Energy-saving Light Source Co., Ltd. (QL)

To distribute around 30 mi llion CFLs mainly covering the rural area of Jiangsu Province.

CFL Distribution Programme in Jiangsu Province” in Chuzhou District, Huaian City, Jiangsu Province, China

Huaian City in Jiangsu Province

Zhenjiang Qiangling Energy-saving Light Source Co., Ltd. (QL)

Investment comparison analysis

Shaanxi Binchang New Energy Co.

To reduce GHG emission by destroying methane conta ined in Ventila tion Air Methane (VAM) emitted from coal mines in China

Dafosi Coal Mine Ventilation Ai r Methane Power Generation Project (CPA-CVAM-1)

Shaanxi Binchang New Energy Co.

Benchmark analysis

Programmatic CDM of Industrial Thermal Energy Generation by Ind igenous Renewable Fuel Wood in Sri Lanka

Bio Energy Association of Sri Lanka (BEASL)

To “co-benefit” both the g lobal environmental a im to reduce greenhouse gas(hereafter, “GHG”) emissions, as wel l as the local socio-economic needs through implementation ofrenewable b iomass thermal energy generation

Programmatic CDM of Industrial Thermal Energy Generation by Ind igenous Renewable Fuel Wood for the L ion Brewery Ceylon Limi ted. in Sri Lanka

Western (Gampala district)

Bio Energy Association of Sri Lanka (BEASL)

Utilization of Gli ricid ia that has not beenutilized and has been left to decay in fields for thermal power generation

Financial ;P revai ling practice

Biogas Util ity Programme to Households by Grameen Shakti in Municipal ities of Bangladesh

To contribute to lessen deforestation and improve environment of target ruralmunicipaal ities and households through consuming municipa l wastes and improving household indoor airquali ty

Biogas Util ity Programme to Households by Grameen Shakti in Faridpur o f Bangladesh- CPA-[Far]-[01]

Commercial b iogas digesters to supply biogas for thermal usage

Investment;Prevailing practice

Benchmark analysis

To supply, install , and finance solar water heaters to provide hotwater services for low income households in South Africa

Replaced Val idation terminated

Standard Bank Low Pressure Solar Water Heater Programme for South Africa – CPA-001

Replaced Val idation terminated

Li ft-off! The Illumination Pro ject to Replace Kerosene lamps with Solar LED Lamps

To replace kerosene-based lighting with purpose designed so lar lamps inTanzania

Frontier Carbon, Illumination Headquarters

Arusha & Manyara & Ki limanjaro & Tanga

Series of LEDs (“Light Emi tting Diode”), with a rechargeable battery and a photovoltaic panel

Frontier Carbon, Illumination Headquarters

Investment;Prevailing practice;Technological

Simple cost analysis

Supplying natural renewable energy system to publ ic sector.

The programme to in troduce renewable energy system in to Seoul – CPA (2011, Seoul)

Photovoltaic systems and solar water heating systems to public bu ild ings

Investment;Methodological ;Prevail ing practice;Technological

Senegal, Gambia, Burkina Faso, Togo

To reduce greenhouse gases emissions by disseminating fue lefficientcharcoal and wood stoves throughout West Africa

Promoting Efficient Stove Dissemination and Use in West Africa – CPA 001 Togo

26,979 EE “Toyola Asuto” charcoal stove to households

Toyola Energy

Financial ;Other;Prevail ing practice;Technological

Simple cost analysis

To transform the energy efficiency of South Africa ’s low income residential households by d istributing low pressure gravity feed solar water heaters to the households

Green Steam Low Pressure Solar Water Heater Programme for South Africa CPA001

Johannesburg Cosmo City

Installation of low pressure vacuum tube so lar water heaters in 7000 households

Financial ;P revai ling practice;Technological

Henan Provincial Academy of Building Research

To abate a signi ficant amount of GHG emiss ion from the new and existing build ings byemploying geothermal technology based space heating and/or cooling systembuild ings by employing renewable energy technologies

Renewable energy util ization in Tianyuanjiacheng Phase I (CPA identification number:2011_F_CDM_0001)

Henan Provincial Academy of Building Research

Water source geothermal pump based space heating and/or cooling system

Honduras, Costa Risca, Guatamala

To develop a p latform for overcoming insti tu tional, financial and structuralhurdles for the construction of a series of small hydro projects

Financial ;Other;Prevail ing practice

Jeju S pecial Sel f-Governing Province

Supplying renewable energy system to Jeju Island

The programme to in troduce renewable energy system in to Je ju Island – SSC-CPA (2011, JGP)

Jeju S pecial Sel f-Governing Province

Photovoltaic systems, windpower plants and small hydro power plants

To construct MSW(Municipal Solid Waste)-based compost production faci lities mainly in Western Province and produce bio-compost to be appl ied in the agricul tural farms

Benchmark analysisBenchmark analysis

Advance Carbon Securities Ventures (ACSV)

To develop at least 100 MW of b iomass power in Thailand during i ts28 years of l ifetime

Advance Carbon Securities Ventures (ACSV)

Advance Carbon Securities Ventures (ACSV)

Advance Carbon Securities Ventures (ACSV)

Benchmark analysis

Guatemala, El Salvador

Negocios Energeticos de Occidente

To develop a p latform that can support the development of sustainable, small hydropower pro jects in the reg ion

Negocios Energeticos de Occidente

Peña Flor-Los Sisitos Smal l Scale Central Hydroelectric Project, Suchitepéquez, Guatemala (SSC-CPA Peña Flor-Los Sisitos)

Negocios Energeticos de Occidente

Pacayas Small Scale Central Hydroelectric Project, Alta Verapaz, Guatemala (SSC-CPA Pacayas)

Negocios Energeticos de Occidente

Los Patos S mall Scale Central Hydroelectric Project, San Marcos, Guatemala (SSC-CPA Los Patos)

Negocios Energeticos de Occidente

Juayúa Central Hydroelectric Project, Sonsonante, El Salvador (SSC-CPA Juayúa)

Negocios Energeticos de Occidente

Santa Lucia Cotzumalguapa, Escuintla

Negocios Energeticos de Occidente

Pakistan Electric Power Company

Deployment of energy efficient lighting systems in the households and p lanned market transformation leading to climate mitigation in a sustainable manner

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Benchmark analysis

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Pakistan Electric Power Company

Investment;Other;Prevail ing practice

Hebei Animal Manure Management System (AMMS) GHG Mitigation Programme

To establ ish a sustainable livestock waste management model that would significantly improve rural environment and reduce greenhouse gas emissions

AMS-III.D.+AMS-I.C.+AMS-I.F.

WB-CF, Chinese Academy of Agricu ltura l Sciences

Hebei Animal Manure Management System (AMMS) GHG Mitigation Programme (CPA No.001)

Biogas digester util izing biogas to generate e lectrici ty and heat energy

AMS-III.D.+AMS-I.C.+AMS-I.F.

WB-CF, Chinese Academy of Agricu ltura l Sciences

Cl imate Action Response Enterprise (CARE) for Energy Efficiency in Chiller Plants.

To help achieve Energy Efficiency and reduce consumption of e lectrici ty inSingapore

Energy Efficiency in Chi ller Plant at the CAPRICORN Bui lding located at 1 Science Park Road, The Capricorn, Singapore Science Park II, Singapore 117528 (CAPRICORN CPA)

The CAPRICORN at 1 Science Park Road Science Park II

Upgrading the existing a ir-cooled chil ler plant and enhancing its efficiencyto a energy efficient coefficient of 0.59KW/TR

To increase renewable energy generation in the energy mix in Malaysia by promotingbiomass residue (co-)fi red power-only plants, e ither for power utilization or grid connection

Biomass-residue-fuelled power-only plant of 13 MW

Investment;Prevailing practice;Technological

Benchmark analysis

Micro Hydro Power Plant Promotion Programme in Regions on the Upper Reaches of the Yangtze River,China

Sichuan, Qinghai , Yunnan, Shanxi, Chongqing, Xizang Tibet

Sichuan Kangmei Community Development and Market Company

To reduce de-forestation, as the renewable energy will be used to replace nonrenewablebiomasses consumed in the households and also to improve indoor a ir quali ty

Micro Hydro Power Plant Promotion Programme in Yuexi County, Sichuan Province on the Upper Reaches of the Yangtze River, China (CPA-01)

Sichuan Kangmei Community Development and Market Company

120 micro hydro power generators (capacity of each is 3kW)

Thailand (North & North East & Centra l & South Regions)

To develop small-sca le biomass power plants in communities by using wood residues from FIO‟s plantations and available agricu ltural residues in the pro ject area as fue l

Gasification based power pro ject with an installed capacity of 1 MW

Benchmark analysis

Tricorona Carbon Asset Management Sweden

Tricorona Carbon Asset Management Sweden

Tricorona Carbon Asset Management Sweden

Solarwave solar water puri fication equipment

Tricorona Carbon Asset Management Sweden

Demand-side energy efficiency through the adoption of energy-efficient technologies in Colombia

To achieve energy efficiency through the rep lacement of equipment a t commercial ,industria l and publ ic bui ldings and in frastructure in Colombia

Demand-side energy efficiency through the adoption of specific energy efficient technologies at AVIANCA, in Colombia

Energy efficient lamps and vo ltage regulators

Investment;Prevailing practice

Simple cost analysis

To construct and d istribute approximate ly 300,000 efficient cooking stoves free-ofchargeto rural households cooking with fi rewood in Uganda

Financial ;Investment;Prevai ling practice;Technological

Thailand (North & North East & Centra l & South Regions)

To promote energy efficient street lighting in Thailand

Thai land energy efficiency improvement for street l ightings in central region (sub region 1: Ayuttaya, Chonburi , and Nakhon Pathom provinces)

Ayuttaya, Chonburi,Nakhon Pathom

Installation of Light Emitting Diode (LED) lamps

Benchmark analysis

CPA-02: Thailand energy efficiency improvement for street lightings in North reg ion (sub region: Chiang Mai, Nakhon Sawan and Lampang provinces) phase 1

Chiang Mai, Nakhon Sawan, Lampang

Installation of Light Emitting Diode (LED) lamps

Benchmark analysis

CPA-03: Thailand energy efficiency improvement for street lightings in North-East region (subregion: Nakhon Ratchasima province) phase 1

Nakhon Ratchasima Province

Installation of Light Emitting Diode (LED) lamps

Benchmark analysis

CPA-04: Thailand energy efficiency improvement for street lightings in Central reg ion (sub reg ion:

pathum Thani Province

Installation of Light Emitting Diode (LED) lamps

Benchmark analysis

Thai land energy efficiency improvement for street l ightings in South reg ion (sub region: Phuket,Surat Thani provinces) phase 1

Phuket and Surat Thani Provinces

Installation of Light Emitting Diode (LED) lamps

Benchmark analysis

Co-composting and Composting Program of Activities for Palm Oi l Mills in Indonesia

To facili ta te commercia l crude palm mil l and plantation owners and managers to adopt and implement more susta inable practices at the ir Crude Palm Oil Mil ls

Aerated Bunker Co-composting (ABC) plant

Benchmark analysis

Creating a p latform for supporting the usage increase of high qual ity LED lighting equipment

Investment;Technological

To develop a p latform for overcoming insti tu tional, financial and structural hurdles for the construction of a series of small hydroelectric power p lants pro jects

Benchmark analysis

5.264 MW Run of river hydropower plant

Benchmark analysis

Langui II Hydro Power Plant, Hercca - Tunki PoA CP A #4– Tunki PoA CPA #4

Benchmark analysisBenchmark analysis

Increasing the use of s olar water heaters (SWH) inresidential and commercial applications throughout the Republ ic of South Africa

Nelson Mandela Bay Municipal ity Solar Water Heating Pro ject – NMBM CPA - 001

Solar water heaters (SWH) systems for hot water productionin residential households

Investment;Other;Prevail ing practice;Technological

To improve the energy efficiency of commercial sites across South Africa and in o ther develop ing countries.

On site trigeneration facili ty wi th production of e lectrici ty and cooling and heating from methane-rich natura l gas

Investment;Other;Prevail ing practice;Technological

Foreign-Assisted and Specia l Projects Office of the Department of Environment and Natura l Resources (DENR-FASPO)

To reduce greenhouse gas (GHG) emiss ions while simul taneously supporting the completion of the phase-out of consumption of CFCs

Environmental Management Bureau (EMB-DENR)

Foreign-Assisted and Specia l Projects Office of the Department of Environment and Natura l Resources (DENR-FASPO)

Replacement of energy-inefficient, large-size chil lers

Environmental Management Bureau (EMB-DENR)

Investment;Technological

Programme of Activities (PoA) for Sustainable Renewable Energy Power Generation in Papua New Guinea (PNG)

To support development and implementation of smal l renewable energypro jects in PNG

AMS-I.F.+AMS-I.D.+AMS-I.A.

AMS-I.F.+AMS-I.D.+AMS-I.A.

Ramazon Hydropower P ro ject, Autonomous Region of Bougainville, Papua New Guinea

AMS-I.F.+AMS-I.D.+AMS-I.A.

Zhenjiang Qiangling Energy-saving Light Source Co.

To distribute around 50 mi llion CFLs, rep lacing low efficient ICLs

Chuzhou City in Lai ’an County

Zhenjiang Qiangling Energy-saving Light Source Co.

Simple cost analysis

South Africa, Botswana, Rwanda

Scal ing up the instal lation of energy efficient l ighting technologies andsystems in non-residential, commercial and public bu ild ings across South Africa, Botswana and Rwanda

RAMP Carbon, Standard Bank of South Africa

Standard Bank of South Africa – Head Office l ighting refurb ishment (SBSA-EECL-CPA-0001)

Lighting systems upgrades wi th rep lacement of over 30,000 lamps

RAMP Carbon, Standard Bank of South Africa

Waste to Energy projects through anaerobic treatment o f biodegradable waste in Korea

To encourage methane recovery from biodegradable waste to insta ll new anaerobic treatment system.

Ulsan Ci ty Waste to Energy project through anaerobic treatment o f biodegradable waste [CPA 01]

Steam generation through anaerobic treatment of biodegradable waste

Benchmark analysis

Zhenjiang Qiangling Energy-saving Light Source Co.

To distribute around 50 mi llion CFLs, rep lacing low efficient ICLs, main ly covering the rural area of Sichuan Province and to reduce the electricity consumed by local residents

Zhenjiang Qiangling Energy-saving Light Source Co.

Simple cost analysis

Chi le, Egypt, El Salvador, Eth iop ia, Gambia, Iran, Kenya, Madagascar, Malawi, Mexico, Nicaragua, South Africa, Uganda

Swiss Federal Institute of Aquatic Science and Technology

To further the access of households and communities to clean and safe drinking water,by promoting low greenhous e gas emi tting water purification technologies

Switzerland (Swiss Carbon Asset+Climate Cent Foundation+Pure Water)

SD Tool, Gold Standard

Swiss Federal Institute of Aquatic Science and Technology

Gravity-Driven ultra fi ltra tion Membranes (GDM)

Switzerland (Swiss Carbon Asset+Climate Cent Foundation+Pure Water)

Swiss Federal Institute of Aquatic Science and Technology

Distribution and installation of ch lorine dispensers

Swiss Federal Institute of Aquatic Science and Technology

Distribution and installation of ch lorine dispensers

Swiss Federal Institute of Aquatic Science and Technology

Distribution and installation of ch lorine dispensers

Distribution and installation of ch lorine dispensers

Bungoma North, Trans Nzoia and Uasin Gishu

Distribution and installation of ch lorine dispensers

Zomba District (Thondwe and Mayaka Heal th Cluster)

Distribution and installation of ch lorine dispensers

Budadiri East and Budadiri West in Sironko District

Distribution and installation of ch lorine dispensers

Distribution and installation of ch lorine dispensersDistribution and installation of ch lorine dispensersDistribution and installation of ch lorine dispensersDistribution and installation of ch lorine dispensersDistribution and installation of ch lorine dispensersDistribution and installation of ch lorine dispensers

Migori and Homaba County

Distribution and installation of ch lorine dispensers

Rachuonyo South sub-county and Rangwe sub-county

Distribution and installation of ch lorine dispensers

Distribution and installation of ch lorine dispensersDistribution and installation of ch lorine dispensers

Kakamega County and Vihiga County

Distribution and installation of ch lorine dispensers

Busia County and Bungoma County

Distribution and installation of ch lorine dispensersDistribution and installation of ch lorine dispensersDistribution and installation of ch lorine dispensers

To facili ta te the transition away from inefficient tradi tional biomass fi red stoves, by providing high-efficiency and clean burning ICS that reduce wood and charcoal consumption

Efficient biomass cook stoves for household, commercial , and institu tional use

668CPA0110.02 9956-0002 Up Energy Improved Cookstoves Programme, Uganda – CPA No 002 Africa East Africa Uganda Uganda Up Energy Group USA Registered EE households EE households Stoves AMS-II.G. 1 45.0 7 21 0.0 17-Mar-15 260.761 DNV 18.311 18.311 16-Sep-16 10-Dec-15 Earthhood Sweden (Government of Sweden) CIRCODU 2-Aug-11 17-Mar-15 30-Dec-99 4 1 8 9 6 0 No Prevailing practice 44.980 44.980 44.980 44.980 44.980 44.980 44.980

669CPA0110.03 9956-0003 Africa East Africa Uganda Uganda Up Energy Group USA Registered EE households EE households Stoves AMS-II.G. 1 45.0 7 21 0.0 17-Apr-15 256.941 DNV 10.497 10.497 16-Sep-16 10-Dec-15 Earthhood Sweden (Government of Sweden) CIRCODU 2-Aug-11 17-Apr-15 30-Dec-99 4 1 8 9 6 0 No Prevailing practice 44.980 44.980 44.980 44.980 44.980 44.980 44.980

670CPA0110.04 9956-0004 Africa East Africa Uganda Uganda Up Energy Group USA Registered EE households EE households Stoves AMS-II.G. 1 45.0 7 21 0.0 17-Apr-15 256.941 DNV 0.621 0.621 16-Sep-16 10-Dec-15 Earthhood Sweden (Government of Sweden) CIRCODU 2-Aug-11 17-Apr-15 30-Dec-99 4 1 8 9 6 0 No Prevailing practice 44.980 44.980 44.980 44.980 44.980 44.980 44.980

671CPA0110.05 9956-0005 Up Energy Improved Cookstoves Programme, Uganda - CPA No 005 Africa East Africa Uganda Uganda Up Energy Group USA Registered EE households EE households Stoves AMS-II.G. 1 45.0 7 21 0.0 1-Jan-17 179.920 DNV Sweden (Government of Sweden) CIRCODU 2-Aug-11 28-Nov-16 30-Dec-99 4 1 8 9 6 0 No Prevailing practice 44.980 44.980 44.980 44.980 44.980 44.980 44.980

672CPA0110.06 9956-0006 Up Energy Improved Cookstoves Programme, Uganda - CPA No 006 Africa East Africa Uganda Uganda Up Energy Group USA Registered EE households EE households Stoves AMS-II.G. 1 45.0 7 21 0.0 1-Jan-17 179.920 DNV Sweden (Government of Sweden) CIRCODU 2-Aug-11 28-Nov-16 30-Dec-99 4 1 8 9 6 0 No Prevailing practice 44.980 44.980 44.980 44.980 44.980 44.980 44.980

673CPA0110.07 9956-0007 Up Energy Improved Cookstoves Programme, Uganda - CPA No 007 Africa East Africa Uganda Uganda Up Energy Group USA Registered EE households EE households Stoves AMS-II.G. 1 45.0 7 21 0.0 1-Jan-17 179.920 DNV Sweden (Government of Sweden) CIRCODU 2-Aug-11 28-Nov-16 30-Dec-99 4 1 8 9 6 0 No Prevailing practice 44.980 44.980 44.980 44.980 44.980 44.980 44.980

674CPA0110.08 9956-0008 Up Energy Improved Cookstoves Programme, Uganda - CPA No 008 Africa East Africa Uganda Uganda Up Energy Group USA Registered EE households EE households Stoves AMS-II.G. 1 45.0 7 21 0.0 1-Jan-17 179.920 DNV Sweden (Government of Sweden) CIRCODU 2-Aug-11 28-Nov-16 30-Dec-99 4 1 8 9 6 0 No Prevailing practice 44.980 44.980 44.980 44.980 44.980 44.980 44.980

675CPA0110.09 9956-0009 Up Energy Improved Cookstoves Programme, Uganda - CPA No 009 Africa East Africa Uganda Uganda Up Energy Group USA Registered EE households EE households Stoves AMS-II.G. 1 45.0 7 21 0.0 15-Jul-17 155.890 DNV Sweden (Government of Sweden) CIRCODU 2-Aug-11 31-May-17 30-Dec-99 4 1 8 9 6 0 No Prevailing practice 44.980 44.980 44.980 44.980 44.980 44.980 44.980

676CPA0110.10 9956-0010 Up Energy Improved Cookstoves Programme, Uganda - CPA No 010 Africa East Africa Uganda Uganda Up Energy Group USA Registered EE households EE households Stoves AMS-II.G. 1 45.0 7 21 0.0 20-Aug-17 151.453 DNV Sweden (Government of Sweden) CIRCODU 2-Aug-11 31-May-17 30-Dec-99 4 1 8 9 6 0 No Prevailing practice 44.980 44.980 44.980 44.980 44.980 44.980 44.980

677CPA0110.11 9956-0011 Up Energy Improved Cookstoves Programme, Uganda - CPA No 011 Africa East Africa Uganda Uganda Up Energy Group USA Registered EE households EE households Stoves AMS-II.G. 1 45.0 7 21 0.0 25-Sep-17 147.017 DNV Sweden (Government of Sweden) CIRCODU 2-Aug-11 31-May-17 30-Dec-99 4 1 8 9 6 0 No Prevailing practice 44.980 44.980 44.980 44.980 44.980 44.980 44.980

678CPA0110.12 9956-0012 Up Energy Improved Cookstoves Programme, Uganda - CPA No 012 Africa East Africa Uganda Uganda Up Energy Group USA Registered EE households EE households Stoves AMS-II.G. 1 45.0 7 21 0.0 21-Oct-17 143.813 DNV Sweden (Government of Sweden) CIRCODU 2-Aug-11 31-May-17 30-Dec-99 4 1 8 9 6 0 No Prevailing practice 44.980 44.980 44.980 44.980 44.980 44.980 44.980

679PoA0111 SPPZ63JEGZACHUPDY6QXN3XIBS9IFO Southern African Solar Electrical Energy Programme (SASEE) Africa Southern Africa South Africa EcoMetrix Solar Ventures At Validation Solar Solar Solar PV AMS-I.F. 1 26.8 15-Aug-11 28 26.823 241.554 BV Cert 0.000 n.a. EcoMetrix Africa 3-Aug-11 CPA 30-Dec-99CPA 1 10 9 0.0

680CPA0111.01 Africa Southern Africa South Africa Gauteng EcoMetrix Solar Ventures At Validation Solar Solar Solar PV Solar photovoltaic electrical systems AMS-I.F. 1 26.8 7 21 0.0 1-Jan-12 26.823 241.554 BV Cert n.a. EcoMetrix Africa 3-Aug-11 30-Dec-99 1 10 9 0 No 10.344 20.689 31.346 31.346 31.346 31.346 31.346 31.346 31.346 31.346 31.346 31.346 31.346 31.346

681PoA0112 L056L9FZ8EAX89INYMLJLSV5VCVLW8 7885 Southern Africa Solar Thermal Energy (SASTE) Programme Africa Southern Africa South Africa EcoMetrix Solar Ventures Registered Solar Solar Solar water heating AMS-I.C. 1 26.4 15-Aug-11 28 77.654 253.462 BV Cert 0.000 n.a. EcoMetrix Africa 3-Aug-11 28-Aug-12 15-May-13 3-Oct-13 15-May-13 CPA 30-Dec-99CPA 9 7 4 0.0

682CPA0112.01 7885-0001 Africa Southern Africa South Africa Gauteng EcoMetrix Solar Ventures Registered Solar Solar Solar water heating A group of solar water heaters AMS-I.C. 1 26.4 7 0.0 3-Jun-11 77.654 253.462 BV Cert n.a. EcoMetrix Africa 3-Aug-11 15-May-13 30-Dec-99 9 7 4 0 1.030 51.0 No 51.769 51.769 51.769 51.769 51.769 51.769 51.769 51.769 51.769 51.769 51.769 51.769 51.769 51.769

683PoA0113 4JC41AXZ5ILYZPGNBRU4MLPLR7KEDP 7479 Sustainability CFL Replacement Programme of Activities in South Africa Africa Southern Africa South Africa South Africa Eskom Registered EE households EE households Lighting AMS-II.J. 1 29.5 10-Oct-11 28 0.000 295.180 DNV 0.000 France (BNP Paribas) RAMP Carbon, Eskom, BNP Paribas 6-Aug-11 24-Apr-12 19-Dec-12 19-Apr-13 19-Dec-12 PoA 30-Dec-99PoA Gold Standard 9 4 7 8 5 4 0.0 Plist

684CPA0113.01 7479-0001 CLF Replacement Project Western Cape - CPA-01 Africa Southern Africa South Africa Western Cape Eskom Registered EE households EE households Lighting AMS-II.J. 1 29.5 10 8 -4.0 19-Dec-12 0.000 295.180 DNV France (BNP Paribas) RAMP Carbon, Eskom, BNP Paribas 6-Aug-11 19-Dec-12 30-Dec-99 9 4 7 8 5 4 1 China No Plist 3 53.022 49.404 45.786 42.168 38.550 34.932 31.314 0.000 0.000 0.000

685PoA0114 KQS5ZZJI6ISC4Q0MVSMOBJEIORGJSD 9387 Asia & Pacific Southern Asia India India Registered EE Industry EE Industry Iron & steel AMS-II.D. 1 3.0 20-Jul-11 28 0.000 30.060 DNV 0.000 n.a. South Pole Carbon Asset Management 11-Aug-11 3-Apr-12 29-Dec-12 14-Jun-13 29-Dec-12 CPA 30-Dec-99CPA 1 8 6 9 0.0

686CPA0114.01 9387-0001 Asia & Pacific Southern Asia India Rajasthan Registered EE Industry EE Industry Iron & steel AMS-II.D. 1 3.0 10 15 1-Mar-13 0.000 30.060 DNV n.a. South Pole Carbon Asset Management 11-Aug-11 29-Dec-12 30-Dec-99 1 8 6 9 0 0.6 No N/A MSC 2.505 3.006 3.006 3.006 3.006 3.006 3.006 3.006 3.006 3.006 0.501

687PoA0115 REKUSXC1LPW3KEK8RG3GSAJBOO6P10 6749 South East Asia Biogas Programme of Activities Asia & Pacific Southeast Asia Indonesia PT Biogas Program International Registered Methane avoidance Methane avoidance Waste water AMS-III.H.+AMS.I.D. 1 19.3 1-Aug-12 28 0.000 149.461 GLC 0.000 South Pole Carbon Asset Management 11-Aug-11 19-Dec-11 25-Jul-12 19-Sep-12 27-Jul-12 CPA 30-Dec-99CPA 1 9 5 7 11 2.1

688CPA0115.01 6749-0001 Bahari Biogas to Electricity Project Asia & Pacific Southeast Asia Indonesia Aceh PT Biogas Program International Registered Methane avoidance Methane avoidance Waste water AMS-III.H.+AMS-I.D. 1 19.3 7 20 0.0 1-Apr-13 0.000 149.461 GLC South Pole Carbon Asset Management 11-Aug-11 27-Jul-12 30-Dec-99 1 9 5 7 11 0 2.1 7535 0.743 No Investment 3 26.829 26.829 26.829 26.829 26.829 26.829 26.829 26.829 26.829 26.829 26.829 26.829 26.829 26.829

689PoA0116 Y3G1KXGDHHKJUOF8PYGCH3LIJXMMBX Chilean Small Hydroelectric Power Plants Programme of Activities Latin America South America Chile Replaced At Validation Hydro Hydro Run of river AMS-I.D. 17-May-11 28 TÜV-SÜD Germany (KfW) Bridge Builders 12-Aug-11 15-Dec-11 CPA 31-Dec-99CPA 9 10

690CPA0116.01 Las Flores Hydroelectric Project Latin America South America Chile Region X Replaced At Validation Hydro Hydro Run of river 1.5 MW run of river hydropower plant AMS-I.D. 1 8.1 7 20 0.0 1-Jan-13 0.000 64.878 TÜV-SÜD Germany (KfW) Bridge Builders 12-Aug-11 15-Dec-11 30-Dec-99 9 10 0 1.5 12350 0.656 No Investment MSC 3 8.107 8.107 8.107 8.107 8.107 8.107 8.107 8.107 8.107 8.107 8.107 8.107 8.107 8.107

691PoA0117 C0ITW72RQN0J51Z79ATZMI5C6AENCS 6161 Renewable Energy PoA in India Asia & Pacific Southern Asia India India Emission Reduction Services Registered Hybrid renewables Hybrid renewables Solar & wind & hydro AMS-I.D. 2 21.8 30-Mar-11 28 1.083 96.919 TÜV-SÜD 0.000 South Pole Carbon Asset Management 26-Aug-11 19-Jun-12 24-Sep-12 23-Nov-12 24-Sep-12 CPA 31-Dec-99CPA 2 4 5 9 10 8 17.0

692CPA0117.01 6161-0001 2.00 MWp Grid Interactive Solar Photovoltaic Power Project at Jhansi Asia & Pacific Southern Asia India Uttar Pradesh Emission Reduction Services Registered Solar Solar Solar PV AMS-I.D. 1 3.3 7 25 0.0 1-Sep-12 1.083 27.104 TÜV-SÜD South Pole Carbon Asset Management 26-Aug-11 24-Sep-12 30-Dec-99 2 4 5 9 10 8 1 2.0 3459 0.940 No 3 3.251 3.251 3.251 3.251 3.251 3.251 3.251 3.251 3.251 3.251 3.251 3.251 3.251 3.251

693CPA0117.02 6161-0002 DMRC Solar PV Project Asia & Pacific Southern Asia India Emission Reduction Services Registered Solar Solar Solar PV AMS-I.D. 1 18.5 7 25 0.0 25-Mar-17 0.000 69.816 TÜV-SÜD South Pole Carbon Asset Management 26-Aug-11 25-Mar-17 30-Dec-99 2 4 5 9 10 8 1 15.0 19687 0.940 No 18.506 18.506 18.506 18.506 18.506 18.506 18.506

694PoA0118 1QJW5NPCBSEPQD5D3KDWG8BDC6CEFR 6606 KTDA Small Hydro Programme of Activities Africa East Africa Kenya Kenya Kenya Tea Development Agency Registered Hydro Hydro Run of river AMS-I.D. 1 24.3 27-Aug-11 28 0.000 180.456 AENOR 0.000 n.a. Kenya Tea Development Agency 27-Aug-11 3-Sep-12 13-Sep-12 16-Nov-12 14-Sep-12 CPA 31-Dec-99CPA 5 9 8 10 11 5.0 MSC DNA

695CPA0118.01 6606-0001 Gura small hydro power project Africa East Africa Kenya Central Kenya Tea Development Agency Registered Hydro Hydro Run of river 5 MW run of river hydropower plant AMS-I.D. 1 24.3 7 25 0.0 31-Jul-13 0.000 180.456 AENOR n.a. Kenya Tea Development Agency 27-Aug-11 14-Sep-12 30-Dec-99 5 9 8 10 11 0 5.0 38427 0.633 No Prevailing practice MSC DNA 24.306 24.306 24.306 24.306 24.306 24.306 24.306 24.306 24.306 24.306 24.306 24.306 24.306 24.306

696PoA0119 UBTT98OBEM08JI1F293WCT5SVTN6J2 6209 Indonesia Biogas Projects Asia & Pacific Southeast Asia Indonesia Indonesia GenPower Carbon Solutions Registered Methane avoidance Methane avoidance Waste water AMS-III.H. 1 51.9 1-Apr-10 28 15.261 519.470 BV Cert 0.000 United K. (GenPower Carbon Solutions) GenPower Carbon Solutions 28-Aug-11 6-Mar-12 5-Sep-12 9-Nov-12 5-Sep-12 CPA 30-Dec-99CPA 3 1 6 5 9 7 1.0

697CPA0119.01 6209-0001 Negeri Lama I & II Biogas Project (NL 22110002-1). Asia & Pacific Southeast Asia Indonesia Riau GenPower Carbon Solutions Registered Methane avoidance Methane avoidance Waste water AMS-III.H. 1 51.9 10 25 0.0 15-Sep-12 15.261 519.470 BV Cert United K. (GenPower Carbon Solutions) GenPower Carbon Solutions 28-Aug-11 5-Sep-12 30-Dec-99 3 1 6 5 9 7 -2 1.0 5209 No 3 48.392 52.262 52.262 52.262 52.262 52.262 52.262 52.262 52.262 52.262

698PoA0120 E7UHQBUNNTIJF6BDL5S9DQX85S2A11 6142 Latin America North America Mexico Mexico Financiera Rural Registered Methane avoidance Methane avoidance Manure 1 1.6 1-Sep-11 28 0.000 12.652 DNV 0.000 n.a. Financiera Rural 30-Aug-11 12-Oct-11 29-Dec-12 8-Jun-13 28-Dec-12 CPA 30-Dec-99PoA 1 6 3 5 9 7 0.1

699CPA0120.01 6142-0001 Latin America North America Mexico Guanajuato Financiera Rural Registered Methane avoidance Methane avoidance Manure 1 1.6 7 10 0.0 1-Jan-13 0.000 12.652 DNV n.a. Financiera Rural 30-Aug-11 28-Dec-12 30-Dec-99 1 6 3 5 9 7 0 0.1 185 0.484 No 4 1.581 1.581 1.581 1.581 1.581 1.581 1.581

700PoA0121 1KMR7SJ9HEA1O41V0VZ38UB5F30G64 Asia & Pacific Southern Asia India India Zero Emissions Technologies At Validation EE households EE households Stoves AMS-II.G. 1 67.0 1-Sep-11 28 66.986 669.860 KBS 0.000 Spain (Zero Emissions Technologies) n.a. 30-Aug-11 PoA 30-Dec-99CPA 4 6 8 5 9 11 0.0

701CPA0121.01 Asia & Pacific Southern Asia India Rajasthan Zero Emissions Technologies At Validation EE households EE households Stoves 20,000 energy efficient cook stoves AMS-II.G. 1 67.0 10 10 0.0 1-Jan-12 66.986 669.860 KBS Spain (Zero Emissions Technologies) n.a. 30-Aug-11 30-Dec-99 4 6 8 5 9 11 0 No Investment;Other 4 66.986 66.986 66.986 66.986 66.986 66.986 66.986 66.986 66.986 66.986

702PoA0122 9BIVV08J7JY27UJMG1P9ITLYZ9Q2I8 Asia & Pacific East Asia South Korea South Korea LH Corporation Replaced At Validation Solar Solar Solar PV AMS-I.F.+AMS-I.C. 1-Sep-11 28 KSA n.a. Ecoeye 1-Sep-11 15-Feb-12 CPA 31-Dec-99CPA 4

703CPA0122.01 Asia & Pacific East Asia South Korea South Korea LH Corporation Replaced At Validation Solar Solar Solar PV AMS-I.F.+AMS-I.C. 1 1.3 7 20 0.0 1-Feb-13 0.000 10.499 KSA n.a. Ecoeye 1-Sep-11 15-Feb-12 30-Dec-99 4 0 1.5 1953 0.683 No 1.724 1.724 1.724 1.724 1.724 1.724 1.724

704PoA0123 12188VOVRN5JELDX2E97NK1FS9I44X Animal Manure Treatment Programme in Hubei Province Asia & Pacific East Asia China Hubei At Validation Methane avoidance Methane avoidance Manure AMS-I.C.+AMS-III.D. 1 3.9 1-Apr-12 28 6.917 38.509 TÜV-Nord 0.000 United K. (A&T Carbon Asset Co.) A&T Carbon Asset Co. 2-Sep-11 CPA 31-Dec-99PoA 5 6 1 8 9 11 0.0

705CPA0123.01 Animal Manure Treatment Programme in Hubei Province--CPA - 0001 Asia & Pacific East Asia China Hubei At Validation Methane avoidance Methane avoidance Manure AMS-I.C.+AMS-III.D. 1 3.9 7 15 0.0 1-Apr-11 6.917 38.509 TÜV-Nord United K. (A&T Carbon Asset Co.) A&T Carbon Asset Co. 2-Sep-11 30-Dec-99 5 6 1 8 9 11 -1 0.771 No N/A MSC 3 2.970 3.946 3.946 3.946 3.946 3.946 3.946 0.976

706PoA0124 TMH1UNP2QEHLYMZ71NF7IGHQX1EQTX 6328 National Solar Power Development Programme, India Asia & Pacific Southern Asia India India Emergent Ventures Registered Solar Solar Solar PV AMS-I.D. 10 118.5 21-Oct-10 28 3.113 738.040 BV Cert 0.000 n.a. Emergent Ventures 6-Sep-11 3-Apr-12 6-Jun-12 27-Jul-12 6-Jun-12 PoA 30-Dec-99CPA 10 7 5 9 4 72.9

707CPA0124.01 6328-0001 “5 MW Solar PV power project, Patan District, Gujarat, India" Asia & Pacific Southern Asia India Gujarat Emergent Ventures Registered Solar Solar Solar PV AMS-I.D. 1 6.7 7 25 -0.1 15-Jul-12 3.113 56.595 BV Cert n.a. Emergent Ventures 6-Sep-11 6-Jun-12 30-Dec-99 10 7 5 9 4 0 5.0 7008 0.949 No N/A Plist 6.648 6.582 6.516 6.451 6.386 6.323 6.259

708CPA0124.02 6328-0002 CPA - 002: 5 MW Solar PV power project, Sabarkantha District, Gujarat, India Asia & Pacific Southern Asia India Gujarat Emergent Ventures Registered Solar Solar Solar PV AMS-I.D. 1 7.7 7 25 0.0 31-Jan-13 0.000 61.155 BV Cert Emergent Ventures 6-Sep-11 31-Jan-13 30-Dec-99 10 7 5 9 4 0 5.0 8103 0.953 No N/A Plist 7.721 7.721 7.721 7.721 7.721 7.721 7.721

709CPA0124.03 6328-0003 CPA - 003: 5 MW Solar PV power project, Jodhpur District, Rajasthan, India Asia & Pacific Southern Asia India Rajasthan Emergent Ventures Registered Solar Solar Solar PV AMS-I.D. 1 9.6 7 25 -0.0 1-May-13 0.000 73.701 BV Cert Emergent Ventures 6-Sep-11 1-May-13 30-Dec-99 10 7 5 9 4 0 5.0 9374 0.953 No N/A Plist 9.119 9.074 9.028 8.983 8.983 8.983 8.983

710CPA0124.04 6328-0004 Asia & Pacific Southern Asia India Gujarat Emergent Ventures Registered Solar Solar Solar PV AMS-I.D. 1 9.0 7 25 -0.2 1-May-13 0.000 68.935 BV Cert Emergent Ventures 6-Sep-11 1-May-13 30-Dec-99 10 7 5 9 4 0 6.0 10022 0.953 No N/A Plist 9.604 7.721 7.721 7.721 7.721 7.721 7.721

711CPA0124.05 6328-0005 CPA - 005: 5 MW Solar PV power project, Kutch, Gujarat, India Asia & Pacific Southern Asia India Gujarat Emergent Ventures Registered Solar Solar Solar PV AMS-I.D. 1 8.0 7 25 0.0 15-Jun-13 0.000 60.730 BV Cert Emergent Ventures 6-Sep-11 27-Jun-13 30-Dec-99 10 7 5 9 4 0 5.0 8393 0.953 No N/A Plist 8.043 8.043 8.043 8.043 8.043 8.043 8.043

712CPA0124.06 6328-0006 CPA - 006: 5 MW Solar PV power project, Surendranagar, Gujarat, India Asia & Pacific Southern Asia India Gujarat Emergent Ventures Registered Solar Solar Solar PV AMS-I.D. 1 8.0 7 25 0.1 9-Jul-13 0.000 59.655 BV Cert Emergent Ventures 6-Sep-11 9-Jul-13 30-Dec-99 10 7 5 9 4 0 5.1 8317 0.953 No N/A Plist 3.653 7.970 7.970 7.970 7.970 7.970 7.970 4.317

713CPA0124.07 6328-0007 CPA - 007: 5 MW Solar PV power project, Bikaner, Rajasthan, India Asia & Pacific Southern Asia India Rajasthan Emergent Ventures Registered Solar Solar Solar PV AMS-I.D. 1 8.7 7 25 -0.1 5-Mar-14 0.000 59.511 BV Cert Emergent Ventures 6-Sep-11 28-Feb-14 30-Dec-99 10 7 5 9 4 0 5.0 9093 0.953 No N/A Plist 8.925 8.853 8.783 8.712 8.643 8.573 8.505

714CPA0124.08 6328-0008 Asia & Pacific Southern Asia India Madhya Pradesh Emergent Ventures Registered Solar Solar Solar PV AMS-I.D. 1 19.5 7 25 0.0 1-Apr-15 112.326 BV Cert Emergent Ventures 6-Sep-11 23-Mar-15 30-Dec-99 10 7 5 9 4 0 11.3 15490 0.977 No N/A Plist 19.514 19.514 19.514 19.514 19.514 19.514 19.514

715CPA0124.09 6328-0009 Asia & Pacific Southern Asia India Madhya Pradesh Emergent Ventures Registered Solar Solar Solar PV AMS-I.D. 1 19.0 7 25 0.0 1-Apr-15 109.189 BV Cert Emergent Ventures 6-Sep-11 1-Apr-15 30-Dec-99 10 7 5 9 4 0 10.5 19416 0.977 No N/A Plist 18.969 18.969 18.969 18.969 18.969 18.969 18.969

716CPA0124.10 6328-0010 CPA – 010: 15 MW Solar PV Power Project, Singrauli, Madhya Pradesh, India Asia & Pacific Southern Asia India Madhya Pradesh Emergent Ventures Registered Solar Solar Solar PV AMS-I.D. 1 22.3 7 25 0.0 1-Aug-17 76.244 BV Cert Emergent Ventures 6-Sep-11 31-Jul-17 30-Dec-99 10 7 5 9 4 0 15.0 23103 0.977 No N/A Plist 22.299 22.299 22.299 22.299 22.299 22.299 22.299

717PoA0125 EFMA7J16GK626K8BWY91GJGPLLOFHT 7067 Sustainable Deployment of the LifeStraw® Family in rural Indonesia Asia & Pacific Southeast Asia Indonesia Indonesia Vestergaard Frandsen Group Registered EE service EE service Water purification AMS-III.AV. 1 52.7 6-Sep-11 28 0.000 526.740 DNV 0.000 Switzerland (Vestergaard Frandsen Group) Vestergaard Frandsen Group 6-Sep-11 6-Mar-12 30-Dec-12 3-Jul-13 30-Dec-12 PoA 30-Dec-99PoA 3 6 8 9 5 0.0

718CPA0125.01 7067-0001 Asia & Pacific Southeast Asia Indonesia Lampung Vestergaard Frandsen Group Registered EE service EE service Water purification 49,600 LifeStraw® Family units AMS-III.AV. 1 52.7 10 7 0.0 31-Jan-13 0.000 526.740 DNV Switzerland (Vestergaard Frandsen Group) Vestergaard Frandsen Group 6-Sep-11 30-Dec-12 30-Dec-99 3 6 8 9 5 1 Switzerland No 52.674 52.674 52.674 52.674 52.674 52.674 52.674

719PoA0126 K7ROA1D14773WHR9RENE7CS44SA5VL 6110 Barefoot Power Lighting Programme Africa East Africa Kenya Uganda Kenya, Uganda Barefoot Power Pty Limited Registered Solar EE households Solar lamps AMS-III.AR. 2 17.7 9-Dec-11 28 4.875 177.140 JCI 0.000 n.a. Carbon Africa 7-Sep-11 23-Apr-12 26-Apr-12 22-Sep-12 25-Jul-12 CPA 30-Dec-99CPA 9 8 7 6 0.0

720CPA0126.01 6110-0001 Barefoot Power Lighting Programme SSK-KE-01 Africa East Africa Kenya Kenya Barefoot Power Pty Limited Registered Solar EE households Solar lamps AMS-III.AR. 1 9.7 10 10 0.3 1-Jul-12 4.875 97.490 JCI n.a. Carbon Africa 7-Sep-11 25-Jul-12 30-Dec-99 9 8 7 6 0 No Financial MSC SUZ 9.270 19.908 35.341 54.103 58.883 56.551 53.326 47.126 35.680 22.497 10.557

721CPA0126.02 6110-0002 Barefoot Power Lighting Programme BFPU-UG-01 Africa East Africa Uganda Uganda Barefoot Power Pty Limited Registered Solar EE households Solar lamps AMS-III.AR. 1 8.0 10 10 -3.0 1-Jan-14 79.650 JCI Carbon Africa 7-Sep-11 15-Nov-13 30-Dec-99 9 8 7 6 0 No Prevailing practice 27.183 34.452 17.127 0.883 0.000 0.000 0.000 0.000 0.000 0.000

722PoA0127 U8MZBSY2K4YV18JQA29WXRIW5WCBT5 5931 Small hydropower programme in Mexico Latin America North America Mexico Mexico Abengoa Mexico Registered Hydro Hydro Existing dam AMS-I.D. 1 4.8 1-May-12 28 0.000 38.501 AENOR 0.000 Spain (Zero Emissions Technologies) Zero Emissions Technologies 7-Sep-11 12-Oct-11 27-Apr-12 28-Jun-12 27-Apr-12 CPA 31-Dec-99CPA 5 7 9 10 31.0

723CPA0127.01 5931-0001 Comales, Small Hydro Power Project Latin America North America Mexico Tamaulipas Abengoa Mexico Registered Hydro Hydro Existing dam Hydropower plant with 5 MW capacity AMS-I.D. 1 4.8 7 30 0.0 1-Jan-13 0.000 38.501 AENOR Spain (Zero Emissions Technologies) Zero Emissions Technologies 7-Sep-11 27-Apr-12 30-Dec-99 5 7 9 10 0 31.0 986 0.573 No Other;Prevailing practice 3 10.038 10.038 10.038 10.038 10.038 10.038 10.038

724PoA0128 Z37079IMS4ISXZV1GXDRKL4889PY58 9169 Asia & Pacific East Asia China Sichuan Registered Methane avoidance Methane avoidance Manure AMS-I.I.+AMS-III.R. 1 6.8 1-Feb-13 28 0.000 54.549 BV Cert 0.000 Switzerland (Bunge Emissions Group) Carbonium 7-Sep-11 1-Mar-12 25-Dec-12 29-Mar-13 25-Dec-12 PoA 30-Dec-99PoA 4 2 1 3 6 0.0 Plist

725CPA0128.01 9169-0001 Asia & Pacific East Asia China Nanjiang Registered Methane avoidance Methane avoidance Manure 2982 biogas digesters AMS-I.I.+AMS-III.R. 1 6.8 7 20 0.0 25-Dec-12 0.000 54.549 BV Cert Switzerland (Bunge Emissions Group) Carbonium 7-Sep-11 25-Dec-12 30-Dec-99 4 2 1 3 6 0 No Technological Plist 6.800 6.800 6.800 6.800 6.800 6.800 6.800

726PoA0129 I1YBKGICIP8QHFKG20FYCR6D9XWEM5 9219 Anaerobic Digestion and Renewable Energy Generation in South Africa Africa Southern Africa South Africa South Africa Farmsecure Carbon Registered Methane avoidance Methane avoidance Manure 1 3.1 1-Aug-12 28 1.635 25.703 DNV 0.000 n.a. Farmsecure Carbon 9-Sep-11 8-Feb-12 22-Aug-13 25-Oct-13 22-Aug-13 CPA 31-Dec-99CPA 9 5 7 1 2 11 0.0

727CPA0129.01 9219-0001 Africa Southern Africa South Africa Gauteng Farmsecure Carbon Registered Methane avoidance Methane avoidance Manure 1 3.1 7 21 0.0 1-Sep-12 1.635 25.703 DNV n.a. Farmsecure Carbon 9-Sep-11 22-Aug-13 30-Dec-99 9 5 7 1 2 11 -2 5671 1.035 No 3 4.909 4.909 4.909 4.909 4.909 4.909 4.909

728PoA0130 93ODDFOE5F3EY1EH3W6WZDVBQ5O54E 6095 Sustainable Small Hydropower Programme of Activities (PoA) in Viet Nam Asia & Pacific Southeast Asia Vietnam Vietnam Vietnam PoA JSC Registered Hydro Hydro Run of river ACM2 7 197.2 23-Dec-09 28 0.000 1,153.363 BV Cert 0.000 Switzerland (South Pole Carbon Asset Management) 13-Sep-11 PoA0058 14-Jul-10 21-Aug-12 19-Oct-12 20-Aug-12 CPA 31-Dec-99CPA Gold Standard 2 4 10 5 9 11 95.9

729CPA0130.01 6095-0001 Thoong Cot 2 Hydropower Project Asia & Pacific Southeast Asia Vietnam Cao Bang Vietnam PoA JSC Registered Hydro Hydro Run of river 3.5 MW hydro power plant ACM2 1 8.0 7 36 0.0 1-Jan-13 0.000 64.118 BV Cert Switzerland (South Pole Carbon Asset Management) 13-Sep-11 CPA0058.01 20-Aug-12 30-Dec-99 2 4 10 5 9 11 -2 3.5 14710 0.576 No 3 4.154 8.309 8.309 8.309 8.309 8.309 8.309 4.155

730CPA0130.02 6095-0002 Ea Sup 3 Hydropower Project - CPA002 Asia & Pacific Southeast Asia Vietnam Dak Lak Vietnam PoA JSC Registered Hydro Hydro Run of river 6.4 MW Hydro power plant ACM2 1 13.5 7 40 0.0 1-Jan-13 0.000 108.053 BV Cert 13-Sep-11 30-Oct-13 30-Dec-99 2 4 10 5 9 11 -2 6.4 24295 0.556 No 3 2.256 13.502 13.502 13.502 13.502 13.502 13.502 13.502

731CPA0130.03 6095-0003 Song Mien 5A Hydropower Project Asia & Pacific Southeast Asia Vietnam Ha Giang Vietnam PoA JSC Registered Hydro Hydro Run of river 9 MW Hydro power plant ACM2 1 16.8 7 30 0.0 1-Nov-14 0.000 103.629 BV Cert 13-Sep-11 11-Apr-14 30-Dec-99 2 4 10 5 9 11 -2 9.0 30680 0.556 No 3 2.799 16.796 16.796 16.796 16.796 16.796 16.796 13.996

732CPA0130.04 6095-0004 Nam Chim 1A Hydropower Project Asia & Pacific Southeast Asia Vietnam Son La Vietnam PoA JSC Registered Hydro Hydro Run of river 10 MW Hydro power plant ACM2 1 19.4 7 40 0.0 1-Jun-15 0.000 108.528 BV Cert 13-Sep-11 11-Apr-14 30-Dec-99 2 4 10 5 9 11 -2 10.0 35290 0.556 No 3 11.327 19.418 19.418 19.418 19.418 19.418 19.418 8.091

733CPA0130.05 6095-0005 Krong No 3 Hydropower Project Asia & Pacific Southeast Asia Vietnam Lac Duong Vietnam PoA JSC Registered Hydro Hydro Run of river 16 MW Hydro power plant ACM2 1 32.7 7 40 0.0 1-Jun-15 0.000 182.946 BV Cert 13-Sep-11 11-Apr-14 30-Dec-99 2 4 10 5 9 11 -2 16.0 59490 0.556 No 3 19.094 32.733 32.733 32.733 32.733 32.733 32.733 13.639

734CPA0130.06 6095-0006 Krong No 2 Hydropower Project Asia & Pacific Southeast Asia Vietnam Dak Lak Vietnam PoA JSC Registered Hydro Hydro Run of river 30 MW Hydro power plant ACM2 1 60.1 7 40 0.0 1-Jun-16 0.000 275.495 BV Cert 13-Sep-11 7-May-14 30-Dec-99 2 4 10 5 9 11 -2 30.0 108078 0.556 No 3 35.040 60.069 60.069 60.069 60.069 60.069 60.069 60.069 60.069 60.069 60.069 60.069 60.069 60.069 60.069 60.069 60.069 60.069 60.069 28-Feb-00 24-Jan-00

735CPA0130.07 6095-0007 Ta Trach Hydropower Project Asia & Pacific Southeast Asia Vietnam Thua Thien-Hue Vietnam PoA JSC Registered Hydro Hydro Run of river 21 MW Hydro power plant ACM2 1 46.7 7 40 0.0 7-May-14 0.000 310.594 BV Cert 13-Sep-11 7-May-14 30-Dec-99 2 4 10 5 9 11 -2 21.0 83940 0.556 No 3 31.102 46.653 46.653 46.653 46.653 46.653 46.653 46.653 46.653 46.653 46.653 46.653 46.653 46.653 46.653 46.653 46.653 46.653 46.653 46.653 14.551

736PoA0131 P332KPA9I7PLWAM3250K4M23FTP4X6 8301 Asia & Pacific East Asia China Gansu Registered Methane avoidance Methane avoidance Domestic manure AMS-III.R.+AMS-I.I. 1 8.1 12-Jan-12 28 0.000 64.678 TÜV-Nord 0.000 A&T Carbon Asset Co. 14-Sep-11 1-Feb-12 20-Nov-12 12-Jan-13 20-Nov-12 PoA 30-Dec-99PoA 5 6 1 8 9 0.0

737CPA0131.01 8301-0001 Asia & Pacific East Asia China Gansu Registered Methane avoidance Methane avoidance Domestic manure AMS-III.R.+AMS-I.I. 1 8.1 7 15 0.0 1-Jan-13 0.000 64.678 TÜV-Nord A&T Carbon Asset Co. 14-Sep-11 20-Nov-12 30-Dec-99 5 6 1 8 9 0 No N/A MSC 8.082 8.082 8.082 8.082 8.082 8.082 8.082

738PoA0132 RA3R1CRP2GTKQJJRNKOAHHGFJIUY2B 8139 Animal Manure Treatment Programme in Gansu Province Asia & Pacific East Asia China Gansu Registered Methane avoidance Methane avoidance Manure AMS-III.D. 1 3.5 14-Sep-11 28 0.000 28.370 TÜV-Nord 0.000 A&T Carbon Asset Co. 14-Sep-11 1-Feb-12 27-Dec-12 19-Apr-13 27-Dec-12 CPA 31-Dec-99PoA 5 6 1 8 9 11 0.1739CPA0132.01 8139-0001 Animal Manure Treatment Programme in Gansu Province--CPA - 0001 Asia & Pacific East Asia China Gansu Registered Methane avoidance Methane avoidance Manure Biogas digester with energy generation AMS-III.D. 1 3.5 7 15 0.0 27-Dec-12 0.000 28.370 TÜV-Nord A&T Carbon Asset Co. 14-Sep-11 27-Dec-12 30-Dec-99 5 6 1 8 9 11 -1 0.1 613 0.841 No Investment 3 2.771 3.023 3.023 3.023 3.023 3.023 3.023 0.252 740PoA0133 AYYW2EJ3HYUNKG1IW90202KP44Z2NM 6222 Small-Scale Renewable Energy PoA in Thailand Asia & Pacific Southeast Asia Thailand Thailand Registered Hybrid renewables Hybrid renewables Solar PV AMS-I.D. 3 54.4 14-Sep-11 28 3.959 360.911 BV Cert 2.072 113.699 115.771 1 15-Aug-14 31-Mar-17 South Pole Carbon Asset Management 14-Sep-11 20-Feb-12 15-May-12 11-Jul-12 15-May-12 CPA 30-Dec-99CPA 5 2 9 12 11 1 30.6

741CPA0133.01 6222-0001 CPA No. 1: IFEC Solar PV Asia & Pacific Southeast Asia Thailand Kanchanaburi Registered Solar Solar Solar PV Solar PV of 2 X 5.51 MW AMS-I.D. 1 7.9 7 25 -0.1 1-Jul-12 3.959 67.357 BV Cert 2.072 43.826 45.898 1 15-Aug-14 31-Mar-17 South Pole Carbon Asset Management 14-Sep-11 15-May-12 30-Dec-99 5 2 9 12 11 1 1 China 11.0 13833 0.598 No Investment 3 8.703 8.488 8.326 8.219 8.129 8.057 7.985

742CPA0133.02 6222-0002 CPA No. 3: Pho Thong Solar PV Power Project Asia & Pacific Southeast Asia Thailand Ang Thong Registered Solar Solar Solar PV Solar PV of 9.66 MW AMS-I.D. 1 9.1 7 25 0.0 14-Feb-14 0.000 62.752 BV Cert 25.944 25.944 2 23-Mar-16 31-Mar-17 South Pole Carbon Asset Management 14-Sep-11 4-Mar-14 30-Dec-99 5 2 9 12 11 1 1 9.7 16416 0.555 No 9.118 9.118 9.118 9.118 9.118 9.118 9.118

743CPA0133.03 6222-0003 CPA No. 2 : Songkhla Biomass Power Plant Asia & Pacific Southeast Asia Thailand Songkhla Registered Solar Biomass energy Solar PV Biomass plant of 9.9 MW AMS-I.D. 1 37.4 7 20 0.0 1-Nov-14 0.000 230.802 BV Cert 43.929 43.929 1 10-Aug-17 31-Mar-17 South Pole Carbon Asset Management 14-Sep-11 17-Jul-14 30-Dec-99 5 2 9 12 11 1 1 9.9 73164 0.511 No 3 9.352 37.408 37.408 37.408 37.408 37.408 37.408 28.056

744PoA0134 7VIOEMF4O58MRP58K36FV02K2R53HQ 7676 Southern African Renewable Energy (SARE) Programme Africa Southern Africa South Africa EcoMetrix Africa Registered Hybrid renewables Hybrid renewables Solar & wind & other ACM2 1 51.8 1-Mar-12 28 43.007 457.748 BV Cert 0.000 n.a. EcoMetrix Africa 16-Sep-11 25-Jan-13 5-Sep-13 25-Jan-13 CPA 31-Dec-99CPA 9 10 5 25.0

745CPA0134.01 7676-0001 Africa Southern Africa South Africa South Africa EcoMetrix Africa Registered Solar Solar Solar PV ACM2 1 51.8 7 21 1.8 1-Mar-12 43.007 457.748 BV Cert n.a. EcoMetrix Africa 16-Sep-11 5-Sep-12 25-Jan-13 30-Dec-99 9 10 5 0 25.0 47071 1.030 No 3 41.044 54.283 53.840 53.398 52.956 52.514 52.072

746PoA0135 BGY26B7WBHBDYJV8NDRBS2VM3V8RUI Animal Manure Treatment Programme in Shanxi Province Asia & Pacific East Asia China Shanxi At Validation Methane avoidance Methane avoidance Manure AMS-I.C.+AMS-III.D. 1 4.8 1-Apr-12 28 3.585 41.793 CEC 0.000 United K. (A&T Carbon Asset Co.) A&T Carbon Asset Co. 21-Sep-11 CPA 31-Dec-99PoA 5 6 1 9 8 11 0.0

747CPA0135.01 Animal Manure Treatment Programme in Shanxi Province--CPA - 0001 Asia & Pacific East Asia China Shanxi At Validation Methane avoidance Methane avoidance Manure AMS-I.C.+AMS-III.D. 1 4.8 7 15 0.0 1-Apr-12 3.585 41.793 CEC United K. (A&T Carbon Asset Co.) A&T Carbon Asset Co. 21-Sep-11 30-Dec-99 5 6 1 9 8 11 0 0.870 No 3 3.583 4.773 4.773 4.773 4.773 4.773 4.773 1.190

748PoA0136 J2KE5VDTYHVB0AUT9KCQVFJF81HTZI 6434 Mexican Renewable Energy Alliance Programme of Activities (PoA) Latin America North America Mexico Mexico Registered Hybrid renewables Hybrid renewables Solar & wind & other ACM2 2 55.1 21-Sep-11 28 0.000 353.792 BV Cert 0.000 Switzerland (Swiss Carbon Asset) South Pole Carbon Asset Management 21-Sep-11 12-Oct-11 15-Jun-12 14-Aug-12 21-Jun-12 CPA 31-Dec-99CPA 2 4 5 9 10 11 58.8

749CPA0136.01 6434-0001 Queretaro 1 Solar Project in Queretaro, Mexico (CPA Queretaro 1) Latin America North America Mexico Querétaro Registered Solar Solar Solar PV A grid connected 20 MW solar plant ACM2 1 18.4 7 25 0.0 1-Oct-13 0.000 133.612 BV Cert Switzerland (Swiss Carbon Asset) South Pole Carbon Asset Management 21-Sep-11 21-Jun-12 30-Dec-99 2 4 5 9 10 11 1 20.0 65287 0.493 No 3 27.940 32.166 32.166 32.166 32.166 32.166 32.166 4.226

750CPA0136.02 6434-0002 Aura Solar I Solar Project in Baja California Sur, Mexico Latin America North America Mexico Registered Solar Solar Solar PV A grid connected 38.76 MW solar plant ACM2 1 36.7 7 25 0.0 1-Jan-15 220.180 BV Cert South Pole Carbon Asset Management 21-Sep-11 16-Jan-15 30-Dec-99 2 4 5 9 10 11 1 38.8 65700 0.558 No 3 36.680 36.680 36.680 36.680 36.680 36.680 36.680

751PoA0137 PTCR9T5XB55229KYPTDPQCVSKCGNHU Microscale solar electrical programme, South Africa Africa Southern Africa South Africa South Africa Blue World Carbon Validation Terminated Solar Solar Solar PV AMS-I.F. 1 5.8 23-Sep-11 28 7.214 53.342 Carbon Check 0.000 n.a. Blue World Carbon 23-Sep-11 PoA 30-Dec-99PoA 9 5 1 5.0

752CPA0137.01 Microscale solar electrical programme, South Africa – CPA-001 Africa Southern Africa South Africa KwaZulu-Natal Blue World Carbon Validation Terminated Solar Solar Solar PV Solar pv for electricity production AMS-I.F. 1 5.8 7 25 1.6 1-Oct-11 7.214 53.342 Carbon Check n.a. Blue World Carbon 23-Sep-11 30-Dec-99 9 5 1 0 5.0 7884 0.988 No N/A MSC 0.096 1.558 3.505 6.232 7.789 7.789 5.762 753PoA0138 V5E1Y4RTM17JGVNPVYMF1LGF527PF4 8674 Philippines Mini-Hydro PoA Asia & Pacific Southeast Asia Philippines Philippines Land Bank of the Philippines Registered Hydro Hydro Run of river AMS-I.D. 1 2.0 1-Oct-11 28 0.000 20.000 TÜV-Rhein 0.000 Germany (KfW) Climate Focus 1-Oct-11 23-Jul-12 11-Dec-12 26-Jan-13 11-Dec-12 CPA 30-Dec-99CPA 5 9 10 2 0.8 MSC

754CPA0138.01 8674-0001 CPA-1: Carit-an Mini-Hydropower Plant under Philippines Mini-Hydro PoA Asia & Pacific Southeast Asia Philippines Western Visayas Land Bank of the Philippines Registered Hydro Hydro Run of river 840 kw run of river hydro power plant AMS-I.D. 1 2.0 10 30 0.0 10-Jan-13 0.000 20.000 TÜV-Rhein Germany (KfW) Climate Focus 1-Oct-11 11-Dec-12 30-Dec-99 5 9 10 2 0 0.8 4301 0.488 No Investment MSC 3 2.000 2.000 2.000 2.000 2.000 2.000 2.000 2.000 2.000 2.000

755PoA0139 6YDIRX527ECQH9M3WKGOBARLIMC93Q Philippine Small-scale Hydropower PoA Asia & Pacific Southeast Asia Philippines Philippines Validation Terminated Hydro Hydro Run of river AMS-I.D. 1 4.8 1-Jan-12 28 0.000 28.977 SGS 0.000 n.a. 1-Oct-11 CPA 31-Dec-99CPA 10 5 9 2.8

756CPA0139.01 Philippine Small-scale Hydropower PoA: CPA #1 Upper Siffu Asia & Pacific Southeast Asia Philippines Philippines Validation Terminated Hydro Hydro Run of river AMS-I.D. 1 4.8 7 30 0.0 1-Dec-14 0.000 28.977 SGS n.a. 1-Oct-11 30-Dec-99 10 5 9 0 2.8 9630 0.477 No 4.760 4.760 4.760 4.760 4.760 4.760 4.760

757PoA0140 5F6U3LEFL9Y8OEN3IF2KOIOSFTGT4P Indonesia Biogas Projects Asia & Pacific Southeast Asia Indonesia Indonesia At Validation Methane avoidance Methane avoidance Waste water AMS-III.H. 1 51.9 5-Oct-11 28 38.958 518.750 BV Cert 0.000 United K. (GenPower Carbon Solutions) GenPower Carbon Solutions 5-Oct-11 CPA 30-Dec-99CPA 3 6 1 5 9 7 1.0

758CPA0140.01 Negeri Lama I & II Biogas Project Asia & Pacific Southeast Asia Indonesia Riau At Validation Methane avoidance Methane avoidance Waste water AMS-III.H.+AMS.I.F. 1 51.9 10 25 0.0 1-Apr-12 38.958 518.750 BV Cert United K. (GenPower Carbon Solutions) GenPower Carbon Solutions 5-Oct-11 30-Dec-99 3 6 1 5 9 7 3 1.0 5209 0.743 No 3 48.392 52.262 52.262 52.262 52.262 52.262 52.262 52.262 52.262 52.262

759PoA0141 9DG9YMQJVP6JHXZCG4DMEUR77OX0QZ 9902 Promotion of the Improved Cooking Stove (ICS) – Nepal Asia & Pacific Southern Asia Nepal Nepal Registered EE households EE households Stoves AMS-II.G. 1 33.8 5-Oct-11 28 8.046 295.696 TÜV-SÜD 0.000 Sweden (Government of Sweden) Alternative Energy Promotion Center 5-Oct-11 9-Jan-13 27-Mar-15 27-Mar-15 PoA 30-Dec-99PoA 6 4 8 3 5 9 0.0 Plist

760CPA0141.01 9902-0001 Promotion of the Improved Cooking Stove (ICS) – Nepal – CPA 1 Asia & Pacific Southern Asia Nepal Nepal Registered EE households EE households Stoves AMS-II.G. 1 33.8 7 3 0.0 1-Apr-12 8.046 295.696 TÜV-SÜD Sweden (Government of Sweden) Alternative Energy Promotion Center 5-Oct-11 27-Mar-15 30-Dec-99 6 4 8 3 5 9 0 20.0 Yes Other Plist 7.143 10.714 10.714 10.714 10.714 10.714 10.714 3.571

761PoA0142 ET8VSFNNQ40UXSGV6QG8WB1HRXLN5A 9889 PoA for Promotion of the Improved Water Mills (IWM) in Nepal Asia & Pacific Southern Asia Nepal Nepal Registered Hydro Hydro Run of river AMS-I.B. 2 22.3 5-Oct-11 28 12.915 102.717 TÜV-SÜD 0.000 Sweden (Government of Sweden) ADB CDM Facility 5-Oct-11 19-May-13 9-Sep-15 27-Oct-15 9-Sep-15 PoA 30-Dec-99PoA 4 10 1 8 0.0 MSC

762CPA0142.01 9889-0001 Promotion of the Improved Water Mills (IWM) in Nepal – CPA # 1 Asia & Pacific Southern Asia Nepal Nepal Registered Hydro Hydro Run of river Dissemination of Improved Water mills AMS-I.B. 1 11.0 7 20 1.0 9-Sep-15 12.915 58.583 TÜV-SÜD Sweden (Government of Sweden) ADB CDM Facility 5-Oct-11 9-Sep-15 30-Dec-99 4 10 1 8 0 Yes Financial MSC 1.353 7.853 13.362 13.362 13.362 13.362 13.362

763CPA0142.02 9889-0002 Asia & Pacific Southern Asia Nepal Nepal Registered Hydro Hydro Run of river Dissemination of Improved Water mills AMS-I.B. 1 11.3 7 10 1.0 1-Feb-17 44.135 TÜV-SÜD Sweden (Government of Sweden) 5-Oct-11 1-Feb-17 30-Dec-99 4 10 1 8 0 Yes MSC 11.273 11.273 11.273 11.273 11.273 11.273 11.273

764PoA0143 PNQJH84QZ4VXFWZSV4YFN44KYJ2YTR 6731 Asia & Pacific Southeast Asia Vietnam Vietnam Registered Biomass energy Biomass energy Biomass briquettes AMS-I.C. 1 23.8 11-Oct-11 28 0.000 237.540 BV Cert 0.000 n.a. INTRACO 11-Oct-11 21-Sep-11 19-Jul-12 14-Sep-12 23-Jul-12 CPA 31-Dec-99CPA 12 9 4 1 8 7 0.0 MSC

765CPA0143.01 6731-0001 Golden Hope Biomass Boiler Project Asia & Pacific Southeast Asia Vietnam Vietnam Registered Biomass energy Biomass energy Biomass briquettes AMS-I.C. 1 23.8 10 25 0.0 1-Jan-13 0.000 237.540 BV Cert n.a. INTRACO 11-Oct-11 23-Jul-12 30-Dec-99 12 9 4 1 8 7 0 0.576 No Investment MSC 24.314 24.314 24.314 24.314 24.314 24.314 24.314 24.314 24.314 24.314

766PoA0144 CQUYIQ6RTKTCFP2LZX9TZ6BO3YAGF7 Philippine Backyard Piggeries Biogas Programme Asia & Pacific Southeast Asia Philippines Philippines Validation Terminated Methane avoidance Methane avoidance Manure AMS-III.R.+AMS-I.I. 1 15.5 1-Jan-12 28 12.966 137.125 DNV 0.000 n.a. Food From Thin Air 11-Oct-11 CPA 30-Dec-99CPA 1 4 8 6 9 0.0

767CPA0144.01 Panay, Capiz Backyard Piggeries Biogas Program (CPA #1) Asia & Pacific Southeast Asia Philippines Western Visayas Validation Terminated Methane avoidance Methane avoidance Manure AMS-III.R.+AMS-I.I. 1 15.5 7 7 0.0 1-Mar-12 12.966 137.125 DNV n.a. Food From Thin Air 11-Oct-11 30-Dec-99 1 4 8 6 9 0 No 15.510 15.510 15.510 15.510 15.510 15.510 15.510

768PoA0145 FZSY2BYFJFKX8A4E7K1IV84D6XGAKK 7821 CarbonSoft Open Source PoA, LED Lighting Distribution: Pan Africa Africa East Africa Malawi Additional Energy Registered Solar EE households Solar lamps AMS-III.AR. 1 41.9 10-Oct-11 28 45.006 373.325 Carbon Check 0.000 Switzerland (Additional Energy) CarbonSoft 12-Oct-11 21-May-12 18-Jan-13 1-Oct-13 CPA 30-Dec-99CPA 9 5 7 6 8 0.0 Plist

769CPA0145.01 7821-0001 CarbonSoft East Africa CPA [01], [Light After Dark in Malawi] Africa East Africa Malawi Additional Energy Registered Solar EE households Solar lamps AMS-III.AR. 1 41.9 7 28 5.7 1-Feb-12 45.006 373.325 Carbon Check Switzerland (Additional Energy) CarbonSoft 12-Oct-11 1-Oct-13 30-Dec-99 9 5 7 6 8 0 No Plist 25.707 46.841 49.183 51.642 54.224 56.935 59.782

770PoA0146 AAZ1P0QEYGGC7O8V9BY7N7YPDJ1U2E 7247 Efficient Cook Stove Programme: Rwanda Africa East Africa Rwanda Rwanda CO2Balance Registered EE households EE households Stoves AMS-II.G. 1 51.8 1-Dec-11 28 0.000 410.719 DNV 0.000 United K. (CO2Balance) CO2Balance 19-Oct-11 PoA0096 9-May-12 29-Jan-13 13-Jun-13 29-Jan-13 PoA 30-Dec-99CPA 4 3 1 6 8 7 0.0

771CPA0146.01 7247-0001 CPA 1: Rubavu Improved Cook Stove Project Africa East Africa Rwanda Rwanda CO2Balance Registered EE households EE households Stoves Fuel efficient cook stoves AMS-II.G. 1 51.8 7 7 0.0 29-Jan-13 0.000 410.719 DNV United K. (CO2Balance) CO2Balance 19-Oct-11 CPA0096.01 29-Jan-13 30-Dec-99 4 3 1 6 8 7 -4 United K. No 47.501 51.819 51.819 51.819 51.819 51.819 51.819 4.318

772PoA0147 OCO7N727VYFR9U81A6E4OV7H3SDGYU 9488 Greenlight Solar PV Lighting India Asia & Pacific Southern Asia India India JPMVEC Registered Solar EE households Solar lamps AMS-III.AR. 1 56.4 14-Nov-11 28 0.000 447.004 RINA 0.000 United K. (JP Morgan) EcoSecurities 14-Oct-11 22-Nov-12 31-Dec-12 26-Jul-13 31-Dec-12 PoA 30-Dec-99PoA 6 8 9 1 0.0

773CPA0147.01 9488-0001 Greenlight Solar PV Lighting India “CPA 1” Asia & Pacific Southern Asia India India JPMVEC Registered Solar EE households Solar lamps Solar chargeable LED lamps AMS-III.AR. 1 56.4 7 21 0.0 29-Jan-13 0.000 447.004 RINA United K. (JP Morgan) EcoSecurities 14-Oct-11 31-Dec-12 30-Dec-99 6 8 9 1 0 No N/A MSC 34.796 59.997 59.997 59.997 59.997 59.997 59.997 774PoA0148 W7E1P44T8CEH3904D3RQR7YEL6YY78 7864 Asia & Pacific Southeast Asia Indonesia Indonesia KIS Group Registered Methane avoidance Methane avoidance Waste water AMS-III.H. 2 81.1 13-Oct-11 28 3.893 810.880 DNV 0.000 n.a. KIS Group 13-Oct-11 6-Mar-12 26-Oct-12 21-Dec-12 29-Oct-12 CPA 30-Dec-99CPA 1 4 8 5 3 7 0.0

775CPA0148.01 7864-0001 Asia & Pacific Southeast Asia Indonesia Bengkulu KIS Group Registered Methane avoidance Methane avoidance Waste water AMS-III.H. 1 38.9 10 20 0.0 29-Nov-12 3.893 389.130 DNV n.a. KIS Group 13-Oct-11 29-Oct-12 30-Dec-99 1 4 8 5 3 7 -2 No 3 38.967 38.967 38.967 38.967 38.967 38.967 38.967 38.967 38.967 38.967

776CPA0148.02 7864-0002 Asia & Pacific Southeast Asia Indonesia KIS Group Registered Methane avoidance Methane avoidance Waste water AMS-III.H. 1 42.2 10 20 0.0 14-Aug-15 421.750 DNV KIS Group 13-Oct-11 10-Aug-15 30-Dec-99 1 4 8 5 3 7 -2 No 42.175 42.175 42.175 42.175 42.175 42.175 42.175 42.175 42.175 42.175

777PoA0149 R27HIOG2RIDI2G99YZMR4JSMEZKIMP 7849 South African Grid Connected Wind Farm Programme Africa Southern Africa South Africa South Africa Blue World Carbon Registered Wind Wind Wind ACM2 1 57.8 1-Jan-13 28 0.000 390.824 Carbon Check 0.000 n.a. Blue World Carbon 15-Oct-11 27-Aug-12 11-Dec-12 26-Jan-13 13-Dec-12 CPA 30-Dec-99CPA 5 9 1 3 25.0

778CPA0149.01 7849-0001 CPA 001 under PoA ‘South African Grid Connected Wind Farm Programme’ Africa Southern Africa South Africa Eastern Cape Blue World Carbon Registered Wind Wind Wind 25 MW wind farm ACM2 1 57.8 7 25 0.0 1-Apr-14 0.000 390.824 Carbon Check n.a. Blue World Carbon 15-Oct-11 13-Dec-12 30-Dec-99 5 9 1 3 0 25.0 58550 0.988 No Investment 3 14.462 57.847 57.847 57.847 57.847 57.847 57.847 57.847 57.847 57.847 57.847 57.847 57.847 57.847 57.847 57.847 57.847 57.847 57.847 57.847 57.847 25-Feb-00 25-Feb-00 25-Feb-00 25-Feb-00 25-Feb-00 25-Feb-00

779PoA0150 TCGH2RBVBYJFAIMG0RQ1J9BPKRIKN7 6337 Installing Solar Water Heating Systems in the South of Viet Nam Asia & Pacific Southeast Asia Vietnam Vietnam Registered Solar Solar Solar water heating AMS-I.J. 1 0.1 9-Nov-09 28 0.033 0.480 JQA 0.000 Japan (Mitsubishi UFJ Securities) Mitsubishi UFJ Securities 15-Oct-11 PoA0010 30-Jul-10 8-Jun-12 31-Jul-12 8-Jun-12 PoA 30-Dec-99PoA 9 10 6 5 0.0

780CPA0150.01 6337-0001 Installing Solar Water Heating Systems in the South of Viet Nam - 1 Asia & Pacific Southeast Asia Vietnam Vietnam Registered Solar Solar Solar water heating Solar Water Heating systems AMS-I.J. 1 0.1 7 15 0.0 1-Aug-12 0.033 0.480 JQA Japan (Mitsubishi UFJ Securities) Mitsubishi UFJ Securities 15-Oct-11 CPA0010.01 8-Jun-12 30-Dec-99 9 10 6 5 0 0.576 No 0.057 0.057 0.057 0.057 0.057 0.057 0.057

781PoA0151 ALPG608RWSVIG66774CJ5AKPCAVG2E Refrigeration Plant Efficiency Programme of Activities Africa Southern Africa South Africa South Africa Standard Bank At Validation EE service EE service EE commercial buildings AMS-II.E. 1 43.9 15-Oct-11 28 3.735 355.372 BV Cert 0.000 United K. (Standard Bank) Cool nrg Carbon Investments 15-Oct-11 CPA 30-Dec-99PoA 9 7 0.0

782CPA0151.01 Africa Southern Africa South Africa South Africa Standard Bank At Validation EE service EE service EE commercial buildings AMS-II.E. 1 43.9 7 21 0.0 1-Dec-12 3.735 355.372 BV Cert United K. (Standard Bank) Cool nrg Carbon Investments 15-Oct-11 30-Dec-99 9 7 0 0.965 57.0 No 43.940 43.940 43.940 43.940 43.940 43.940 43.940

783PoA0152 A6IFE8OJZ2RMVMK89LH8VMWVLWFNDF 8950 Guacamaya Small Scale Hydropower Programme of Activities Latin America Central America Honduras Anaconda Carbon Registered Hydro Hydro Run of river AMS-I.D. 3 46.4 13-Apr-11 28 0.000 255.101 TÜV-Rhein 0.000 Netherlands (Mabanaft), Germany (Carbonbay) Anaconda Carbon 20-Oct-11 PoA0083 20-Dec-12 10-Dec-12 20-Dec-12 CPA 31-Dec-99CPA 5 9 10 11 15.2 MSC

784CPA0152.01 8950-0001 San Alejo Hydroelectric Project Latin America Central America Honduras Comayagua Anaconda Carbon Registered Hydro Hydro Run of river 2.28 MW run of river hydro power plant AMS-I.D. 1 5.8 7 25 0.0 1-Jun-14 0.000 37.966 TÜV-Rhein Netherlands (Mabanaft), Germany (Carbonbay) Anaconda Carbon 20-Oct-11 CPA0083.01 20-Dec-12 30-Dec-99 5 9 10 11 0 2.3 9260 0.622 No Financial MSC 5.860 5.860 5.860 5.860 5.860 5.860 5.860

785CPA0152.02 8950-0002 Zinguizapa Small Scale Hydropower Project Latin America Central America Honduras Anaconda Carbon Registered Hydro Hydro Run of river 3.28 MW run of river hydro power plant AMS-I.D. 1 11.5 7 30 0.0 1-Sep-15 0.000 61.375 TÜV-Rhein Anaconda Carbon 20-Oct-11 28-Jun-16 30-Dec-99 5 9 10 11 0 3.3 18480 0.622 No MSC 11.500 11.500 11.500 11.500 11.500 11.500 11.500

786CPA0152.03 8950-0003 Puringla Sazagua Small Scale Hydropower Project Latin America Central America Honduras Santiago de Puringla Anaconda Carbon Registered Hydro Hydro Run of river 9.6 MW run of river hydro power plant AMS-I.D. 1 29.2 7 30 0.0 1-Sep-15 0.000 155.760 TÜV-Rhein Anaconda Carbon 20-Oct-11 28-Jun-16 30-Dec-99 5 9 10 11 0 9.6 46900 0.622 No Financial MSC 29.185 29.185 29.185 29.185 29.185 29.185 29.185

787PoA0153 Z4D5ARUZ7HEL0M70UI2BR31UH3H933 7211 Latin America South America Brazil Brazil Eqao Registered Hydro Hydro New dam ACM2 3 29.9 22-Oct-11 28 0.000 184.224 BV Cert 0.000 Netherlands (Mabanaft) Eqao 22-Oct-11 22-Aug-12 6-Sep-12 21-Nov-12 6-Sep-12 CPA 31-Dec-99PoA 8 9 58.3

788CPA0153.01 7211-0001 “JAMBO small hydropower plant – CDM Programme Activity” Latin America South America Brazil Rio de Janeiro state Eqao Registered Hydro Hydro New dam 13 MW hydro power plant ACM2 1 13.1 7 30 0.0 1-Jun-14 0.000 86.639 BV Cert Netherlands (Mabanaft) Eqao 22-Oct-11 6-Sep-12 30-Dec-99 8 9 0 13.0 69677 0.189 No 3 7.743 13.144 13.144 13.144 13.144 13.144 13.144 5.402

789CPA0153.02 7211-0002 Tamboril small hydropower plant – CDM Programme Activity Latin America South America Brazil Goias state Eqao Registered Hydro Hydro New dam 29.3 MW Hydro power plant ACM2 1 11.1 7 22 0.0 28-Jan-15 65.999 BV Cert Eqao 22-Oct-11 4-Nov-14 30-Dec-99 8 9 0 29.3 113092 0.189 No 3 10.308 11.132 11.132 11.132 11.132 11.132 11.132

790CPA0153.03 7211-0003 Renic small hydropower plant – CDM Programme Activity Latin America South America Brazil Goias state Eqao Registered Hydro Hydro New dam 16MW Hydro power plant ACM2 1 5.6 7 22 0.0 25-May-15 31.585 BV Cert Eqao 22-Oct-11 3-Dec-14 30-Dec-99 8 9 0 16.0 57378 0.189 No 3 3.410 5.632 5.632 5.632 5.632 5.632 5.632 5.632 2.222

791PoA0154 NB9DX20J2BHQJXGEI1AY0UNKDCC7QO 9384 Kenya Improved woodstoves project Africa East Africa Kenya Kenya Climate Pal Registered EE households EE households Stoves AMS-II.G. 1 42.3 1-Apr-12 28 16.394 352.296 Carbon Check 0.000 France (EcoAct) EcoAct 22-Oct-11 4-Jun-12 28-Dec-12 20-Aug-13 31-Dec-12 PoA 30-Dec-99CPA Gold Standard 4 1 6 5 8 7 0.0 Plist

792CPA0154.01 9384-0001 Kenya Improved woodstoves project Mbeere01 CPA01 Africa East Africa Kenya Climate Pal Registered EE households EE households Stoves AMS-II.G. 1 42.3 7 21 0.0 1-Sep-12 16.394 352.296 Carbon Check France (EcoAct) EcoAct 22-Oct-11 2-Jan-13 30-Dec-99 4 1 6 5 8 7 -5 178.8 No Plist 32.820 49.230 49.230 49.230 49.230 49.230 49.230 16.410

793PoA0155 XMRDKSVTYTXGMAVLC73ZNR4V43AVPV 7881 Coal Mine Methane Utilisation and Destruction Programme in DPR Korea Asia & Pacific East Asia North Korea North Korea Carbon Development and Trading Registered Coal bed/mine methane Coal bed/mine methane Coal Mine Methane ACM8 1 137.3 11-Oct-11 28 0.000 972.925 Carbon Check 0.000 n.a. 22-Oct-11 3-Nov-11 17-Apr-13 27-Sep-13 17-Apr-13 PoA 30-Dec-99CPA 1 6 5 9 0.0

794CPA0155.01 7881-0001 Kogonwon Coal Mine (CMM-DPRK-1) Asia & Pacific East Asia North Korea North Hamgyong Carbon Development and Trading Registered Coal bed/mine methane Coal bed/mine methane Coal Mine Methane ACM8 1 137.3 7 10.5 1-Dec-13 0.000 972.925 Carbon Check n.a. 22-Oct-11 17-Apr-13 30-Dec-99 1 6 5 9 0 0.883 No Financial 105.251 118.681 132.112 145.542 158.973 172.405 168.381

795PoA0156 3KXKIO1DBBFUYTG8FTNDMP8WBF111G 8637 Green Light for Africa Africa East Africa Kenya Standard Bank Registered EE households EE households Lighting AMS-II.J. 3 93.5 25-Oct-11 28 0.000 1,247.110 BV Cert 0.000 Switzerland (Standard Bank) Cool nrg Carbon Investments 25-Oct-11 20-Jul-12 8-Dec-12 12-Dec-12 PoA 30-Dec-99PoA 9 4 0.0 Plist

796CPA0156.01 8637-0001 Green Light for Africa – SSC-CPA No. 1 – Kenya Africa East Africa Kenya Kenya Additional Energy Registered EE households EE households Lighting AMS-II.J. 1 31.1 10 10 -1.9 8-Jan-13 0.000 310.990 BV Cert Switzerland (Standard Bank) Cool nrg Carbon Investments 25-Oct-11 12-Dec-12 30-Dec-99 9 4 0 0.651 No Investment Plist 4 38.881 37.152 35.423 33.693 31.964 30.235 28.505 26.776 25.047 23.317

797CPA0156.02 8637-0002 Green Light for Africa PoA– SSC-CPA 0002 – KPLC Kenya Africa East Africa Kenya Kenya Additional Energy Registered EE households EE households Lighting AMS-II.J. 1 31.2 10 10 15-Jan-16 312.040 BV Cert Cool nrg Carbon Investments 25-Oct-11 28-Dec-15 31-Dec-99 9 4 0 0.657 No Investment Plist 39.013 37.278 35.543 33.807 32.072 30.337 28.602 26.867 25.131 23.396

798CPA0156.03 8637-0003 Green Light for Africa PoA– SSC-CPA 0003 – KPLC Kenya Africa East Africa Kenya Kenya Additional Energy Registered EE households EE households Lighting AMS-II.J. 1 31.2 10 10 15-Jan-16 312.040 BV Cert Cool nrg Carbon Investments 25-Oct-11 28-Dec-15 31-Dec-99 9 4 0 0.657 No Investment Plist 39.013 37.278 35.543 33.807 32.072 30.337 28.602 26.867 25.131 23.396

799CPA0156.04 8637-0004 Green Light for Africa PoA– SSC-CPA 0004 – KPLC Kenya Africa East Africa Kenya Kenya Additional Energy Registered EE households EE households Lighting 312.040 Cool nrg Carbon Investments 25-Oct-11 28-Dec-15 31-Dec-99 9 4 0 0.657 No Investment Plist 39.013 37.278 35.543 33.807 32.072 30.337 28.602 26.867 25.131 23.396 800PoA0157 A72S4CSO1BPEURQLGNVTM4LNY5NG33 7062 Latin America South America Brazil Brazil Omega Energia Renovável Registered Hydro Hydro New dam ACM2 1 21.8 15-Oct-11 28 0.000 130.968 BV Cert 0.000 n.a. Eqao 25-Oct-11 8-Aug-12 3-Dec-12 19-Jan-13 3-Dec-12 CPA 31-Dec-99PoA 9 16.0

801CPA0157.01 7062-0001 “SANTA CRUZ small hydropower plant – CDM Programme Activity” Latin America South America Brazil Minas Gerais Omega Energia Renovável Registered Hydro Hydro New dam 16 MW hydro power plant ACM2 1 21.8 7 30 0.0 1-Jan-15 0.000 130.968 BV Cert n.a. Eqao 25-Oct-11 3-Dec-12 30-Dec-99 9 0 16.0 7262 0.189 No 3 13.700 13.700 13.700 13.700 13.700 13.700 13.700

802PoA0158 7HB3XEK1HI5FF6AURCEM21LADMY98H CDM Africa Small Scale Hydro PoA for Southern Africa Africa Southern Africa South Africa PoA Africa Hydro Validation Terminated Hydro Hydro Run of river AMS-I.D. 1 13.2 30-Oct-11 28 1.122 132.000 ERM CVS 0.000 n.a. CDM Africa Climate Solutions 26-Oct-11 CPA 31-Dec-99CPA 5 7 2 4 9 2.1

803CPA0158.01 Middle Kruisvallei small scale hydro-electric project in Southern Africa Africa Southern Africa South Africa Free State PoA Africa Hydro Validation Terminated Hydro Hydro Run of river 2.1. MW run of river power plant AMS-I.D. 1 13.2 10 30 0.0 1-Dec-12 1.122 132.000 ERM CVS n.a. CDM Africa Climate Solutions 26-Oct-11 30-Dec-99 5 7 2 4 9 1 Mecamidi France 2.1 12000 1.086 No 3 13.200 13.200 13.200 13.200 13.200 13.200 13.200 13.200 13.200 13.200

804PoA0159 4BDKJLU68FX8QUVYFHMDTMO4E51787 8260 CDM Africa Wind and Solar Programme of Activities for South Africa Africa Southern Africa South Africa South Africa CDM Africa Wind/ Solar Registered Hybrid renewables Solar & wind Solar & wind ACM2 7 2,033.7 26-Oct-11 28 0.000 20,337.200 ERM CVS 0.000 n.a. CDM Africa Climate Solutions 26-Oct-11 9-Jul-12 16-Nov-12 15-Jan-13 21-Nov-12 CPA 31-Dec-99CPA 5 7 4 2 9 676.6

805CPA0159.01 8260-0001 Jeffrey’s Bay Wind Energy Project in South Africa Africa Southern Africa South Africa Eastern Cape CDM Africa Wind/ Solar Registered Wind Wind Wind 60 wind turbines of 2.3 MW capacity ACM2 1 352.7 10 20 0.0 8-Jan-14 0.000 3,526.540 ERM CVS n.a. CDM Africa Climate Solutions 26-Oct-11 21-Nov-12 30-Dec-99 5 7 4 2 9 3 Siemens Germany 138.0 384700 1.079 No Prevailing practice Foik 423.170 423.170 423.170 423.170 423.170 423.170 423.170 423.170 423.170 423.170

806CPA0159.02 8260-0002 Droogfontein Solar PV Project Africa Southern Africa South Africa Northern Cape CDM Africa Wind/ Solar Registered Solar Solar Solar PV ACM2 1 76.8 10 25 -0.6 3-Apr-14 0.000 767.800 ERM CVS CDM Africa Climate Solutions 26-Oct-11 25-Mar-14 30-Dec-99 5 7 4 2 9 3 45.6 78340 1.079 No Prevailing practice Foik 79.676 79.034 78.391 77.748 77.062 76.463 75.821 75.178 74.535 73.893

807CPA0159.03 8260-0003 De Aar Solar PV Project Africa Southern Africa South Africa Northern Cape CDM Africa Wind/ Solar Registered Solar Solar Solar PV ACM2 1 78.5 10 25 -0.7 27-May-14 0.000 784.530 ERM CVS CDM Africa Climate Solutions 26-Oct-11 25-Mar-14 30-Dec-99 5 7 4 2 9 3 45.6 80047 1.079 No Prevailing practice 81.408 80.751 80.094 79.439 78.782 78.125 77.469 76.812 76.155 75.499

808CPA0159.04 8260-0004 Khobab Wind Farm Africa Southern Africa South Africa Gauteng CDM Africa Wind/ Solar Registered Wind Wind Wind ACM2 1 474.7 10 20 0.0 30-Mar-17 0.000 4,746.620 ERM CVS CDM Africa Climate Solutions 26-Oct-11 26-Nov-15 31-Dec-99 5 11 4 7 9 0 Siemens Germany 140.0 484300 No Prevailing practice 474.662 474.662 474.662 474.662 474.662 474.662 474.662 474.662 474.662 474.662

809CPA0159.05 8260-0005 Loeriesfontein 2 Wind Farm Africa Southern Africa South Africa Gauteng CDM Africa Wind/ Solar Registered Wind Wind Wind ACM2 1 452.3 10 20 0.0 30-Mar-17 0.000 4,523.160 ERM CVS CDM Africa Climate Solutions 26-Oct-11 26-Nov-15 31-Dec-99 5 11 4 7 9 0 Siemens Germany 140.3 461500 No Prevailing practice 452.316 452.316 452.316 452.316 452.316 452.316 452.316 452.316 452.316 452.316

810CPA0159.06 8260-0006 Nojoli Wind Farm Africa Southern Africa South Africa Western Cape CDM Africa Wind/ Solar Registered Wind Wind Wind ACM2 1 352.7 10 20 0.0 30-Jun-16 0.000 3,526.540 ERM CVS CDM Africa Climate Solutions 26-Oct-11 26-Nov-15 31-Dec-99 5 11 4 7 9 0 88.0 238800 No Prevailing practice 234.047 234.047 234.047 234.047 234.047 234.047 234.047 234.047 234.047 234.047

811CPA0159.07 8260-0007 Noupoort Wind Farm Africa Southern Africa South Africa Gauteng CDM Africa Wind/ Solar Registered Wind Wind Wind ACM2 1 246.2 10 20 0.0 27-Nov-15 0.000 2,462.010 ERM CVS CDM Africa Climate Solutions 26-Oct-11 26-Nov-15 31-Dec-99 5 11 4 7 9 3 Siemens Germany 79.1 251200 No Prevailing practice 246.201 246.201 246.201 246.201 246.201 246.201 246.201 246.201 246.201 246.201

812PoA0160 8IWG42A9RCSVVP39DUR33I3QHMD1CO 7156 Omega Wind Power Plants Programme of Activities Latin America South America Brazil Brazil Omega Energia Renovável Registered Wind Wind Wind ACM2 2 556.0 27-Oct-11 28 0.000 2,009.939 BV Cert 0.000 Switzerland (eqao) Eqao 27-Oct-11 8-Aug-12 31-Aug-12 7-Nov-12 31-Aug-12 CPA 31-Dec-99PoA 1 5 10 9 229.8

813CPA0160.01 7156-0001 Muritiba Wind Power Plant CPA Latin America South America Brazil Rio de Janeiro state Omega Energia Renovável Registered Wind Wind Wind 9 MW wind power plant ACM2 1 11.2 7 20 0.0 1-Jan-16 0.000 56.176 BV Cert Switzerland (eqao) Eqao 27-Oct-11 31-Aug-12 30-Dec-99 1 5 10 9 0 9.0 28606 0.189 No 3 3.734 6.429 6.429 6.429 6.429 6.429 6.429 2.695

814CPA0160.02 7156-0002 Delta 3 Wind Power Plant CPA Latin America South America Brazil Maranhão state Omega Energia Renovável Registered Wind Wind Wind 220.8 MW wind power plant ACM2 1 544.8 7 20 0.0 1-Jun-17 0.000 1,953.763 BV Cert Switzerland (eqao) Eqao 27-Oct-11 19-Apr-17 30-Dec-99 1 5 10 9 0 220.8 1150363 0.482 No 253.169 554.856 554.856 554.856 554.856 554.856 554.856 231.190

815PoA0161 UNWFNFINB2BWZXM746PLOQXMWA968I 7271 Wind Power Programme of Activities in Brazil Latin America South America Brazil Brazil Registered Wind Wind Wind ACM2 5 429.5 29-Oct-11 28 0.000 2,238.624 BV Cert 0.000 United K. (Eqao) Eqao 29-Oct-11 29-Aug-12 13-Sep-12 9-Nov-12 13-Sep-12 CPA 31-Dec-99PoA 4 9 415.2

816CPA0161.01 7271-0001 “Lajeado Grande I Wind Power Plant" Latin America South America Brazil Rio Grande do Sul Registered Wind Wind Wind 25.2 MW wind power plant ACM2 1 21.1 7 20 0.0 1-Jan-15 0.000 126.436 BV Cert United K. (Eqao) Eqao 29-Oct-11 13-Sep-12 30-Dec-99 4 9 0 25.2 80269 0.189 No 3 7.562 18.041 18.041 18.041 18.041 18.041 18.041 10.479

817CPA0161.02 7271-0002 Areia Branca Wind Power Plant Complex” Latin America South America Brazil Rio Grande do Norte Registered Wind Wind Wind 3*30 MW wind power plant ACM2 1 71.2 7 20 0.0 1-Jul-14 0.000 463.184 BV Cert United K. (Eqao) Eqao 29-Oct-11 17-Jun-14 30-Dec-99 4 9 0 90.0 208714 0.189 No 3 21.070 73.418 73.418 73.418 73.418 73.418 73.418 36.709

818CPA0161.03 7271-0003 São Miguel do Gostoso Wind Power Plant Complex Latin America South America Brazil Rio Grande do Norte Registered Wind Wind Wind 108 MW wind power plant ACM2 1 117.3 7 20 0.0 1-Apr-15 0.000 675.440 BV Cert United K. (Eqao) Eqao 29-Oct-11 26-Oct-15 30-Dec-99 4 9 0 108.0 208714 0.225 No 117.342 117.342 117.342 117.342 117.342 117.342 117.342

819CPA0161.04 7271-0004 Vamcruz Wind Power Plant Complex Latin America South America Brazil Rio Grande do Norte Registered Wind Wind Wind 93 MW wind power plant ACM2 1 93.6 7 20 0.0 1-Jan-16 0.000 468.316 BV Cert United K. (Eqao) Eqao 29-Oct-11 24-Nov-15 30-Dec-99 4 9 0 93.0 374039 0.225 No 108.612 108.612 108.612 108.612 108.612 108.612

820CPA0161.05 7271-0005 Serra Pará Wind Power Plant Complex Latin America South America Brazil Serra Pará Registered Wind Wind Wind 99 MW wind power plant ACM2 1 126.3 7 20 0.0 1-Jan-17 0.000 505.248 BV Cert United K. (Eqao) Eqao 29-Oct-11 6-Feb-17 30-Dec-99 4 9 0 99.0 561914 0.225 No 126.312 126.312 126.312 126.312 126.312 126.312 126.312

821PoA0162 KKCUGF4GPWDS7VN3SFF39MNLI894XD 2901 Household Biogas Development Programme in Hubei Province Asia & Pacific East Asia China Hubei Registered Methane avoidance Methane avoidance Domestic manure AMS-III.R.+AMS-I.I. 1 8.3 3-Dec-11 28 0.137 67.683 TÜV-Nord 0.000 United K. (A&T Carbon Asset Co.) A&T Carbon Asset Co. 5-Nov-11 1-Apr-12 13-Nov-12 29-Mar-13 13-Nov-12 PoA 30-Dec-99PoA 5 6 1 9 11 0.0 Plist

822CPA0162.01 2901-0001 Household Biogas Development Programme in Hubei Province—CPA -0001 Asia & Pacific East Asia China Zhuxi County Registered Methane avoidance Methane avoidance Domestic manure Biogas digesters for 3000 households AMS-III.R.+AMS-I.I. 1 8.3 7 15 0.0 13-Nov-12 0.137 67.683 TÜV-Nord United K. (A&T Carbon Asset Co.) A&T Carbon Asset Co. 5-Nov-11 13-Nov-12 30-Dec-99 5 6 1 9 11 -1 No Technological Plist 0.157 8.318 8.318 8.318 8.318 8.318 8.318 8.161

823PoA0163 JVKYPM3AXKL44HJWFPI4FQZZJQDOH1 6573 Latin America South America Brazil Brazil Caixa Econômica Federal Registered Landfill gas Landfill gas Landfill power ACM1 2 1,018.7 22-Sep-10 28 151.674 7,616.250 BV Cert 6.985 1161.424 1244.251 1 30-Oct-14 31-Dec-15 Spain (IBRD) WB-CF 9-Nov-11 PoA0058 1-Jun-12 5-Oct-12 15-Nov-12 5-Oct-12 CPA 31-Dec-99CPA 5 7 34.0

824CPA0163.01 6573-0001 Latin America South America Brazil Rio de Janeiro state Caixa Econômica Federal Registered Landfill gas Landfill gas Landfill power ACM1 1 794.7 7 21 126.5 5-Oct-12 151.674 6,551.145 BV Cert 6.985 1161.424 1168.409 1 30-Oct-14 31-Dec-16 Spain (IBRD) WB-CF 9-Nov-11 CPA0058.01 5-Oct-12 30-Dec-99 5 7 0 25.5 67832 0.164 No Financial;Technological 3 151.722 504.910 670.643 791.918 873.099 956.548 1,011.422 1,065.223

825CPA0163.02 6573-0002 CPA-2: CTR São Gonçalo Latin America South America Brazil Rio de Janeiro state Caixa Econômica Federal Registered Landfill gas Landfill gas Landfill power ACM1 1 224.1 7 21 -7.2 1-Apr-16 0.000 1,065.105 BV Cert 75.842 75.842 10-Aug-17 31-Dec-16 WB-CF 9-Nov-11 31-Mar-16 30-Dec-99 5 7 0 8.6 No 110.403 198.018 213.752 227.404 239.629 250.873 261.441 66.995

826PoA0164 H86FD0CDIP83SCNAZN0722P6ZG1JNO 8734 India Wind Energy Programme of Activities Asia & Pacific Southern Asia India India Mabanaft Carbon India Pvt. Registered Wind Wind Wind ACM2 1 38.4 1-Mar-13 28 0.000 288.368 SQS 0.000 Germany (Carbonbay) Netherlands (Mabanaft) Perspectives 9-Nov-11 12-Oct-12 14-Dec-12 25-Jan-13 17-Dec-12 CPA 30-Dec-99CPA 10 9 25.5

827CPA0164.01 8734-0001 CPA001 - Amarapur Wind Park Asia & Pacific Southern Asia India Gujarat Mabanaft Carbon India Pvt. Registered Wind Wind Wind ACM2 1 38.4 7 21 0.0 1-Jul-13 0.000 288.368 SQS Germany (Carbonbay) Perspectives 9-Nov-11 17-Dec-12 30-Dec-99 10 9 -5 India 25.5 40757 0.945 No Investment 3 48.527 38.141 38.141 38.141 38.141 38.141 38.141

828PoA0165 0KMY34VTD58EQRN4GSPLH6UX72GVGT 7730 CFL Distribution Programme in Hebei Province Asia & Pacific East Asia China Hebei Registered EE households EE households Lighting AMS-II.J. 1 33.7 31-Jan-13 28 0.000 266.709 CEC 0.000 n.a. SinoCarbon Innovation & Investment 11-Nov-11 1-Jan-12 28-Dec-12 28-Dec-12 PoA 30-Dec-99CPA 9 0.0 Plist

829CPA0165.01 7730-0001 “CFL Distribution Programme in Hebei Province” CPA-001 Asia & Pacific East Asia China Wei County Registered EE households EE households Lighting High quality CFLs AMS-II.J. 1 33.7 7 8 -4.3 31-Jan-13 0.000 266.709 CEC n.a. SinoCarbon Innovation & Investment 11-Nov-11 28-Dec-12 30-Dec-99 9 -1 0.870 0.1 No Investment Plist 4 43.862 40.870 37.877 34.884 31.891 28.898 25.905 19.385

830PoA0166 LE362B1FKK3H1I84L6MEQVMWYYKDV3 7489 Project to replace fossil fuel based lighting with Solar LED lamps in East Africa Africa East Africa Kenya Tough Stuff International Registered Solar EE households Solar lamps AMS-III.AR. 1 21.4 16-Dec-12 28 0.120 171.496 Carbon Check 0.000 n.a. Viability Africa 11-Nov-11 4-May-12 28-Nov-12 19-Jan-13 3-Dec-12 CPA 30-Dec-99CPA 1 6 9 8 7 0.0 MSC

831CPA0166.01 7489-0001 Solar LED Lamp Project: Keny Africa East Africa Kenya Central, Rift Valley Tough Stuff International Registered Solar EE households Solar lamps Solar charged LED lamps AMS-III.AR. 1 21.4 7 7 8.5 27-Dec-12 0.120 171.496 Carbon Check n.a. Viability Africa 11-Nov-11 3-Dec-12 30-Dec-99 1 6 9 8 7 0 No MSC 3.445 8.638 14.857 22.459 31.788 42.153 53.556

832PoA0167 3V5JWD7L9MPSHO06WIFD5VCP51ZHVM Dubai Solar Farm Programme of Activities Middle-East Arabian Peninsula United Arab Emirates Replaced At Validation Solar Solar Solar PV ACM2 15-Nov-11 28 AENOR n.a. Dubai Electricity and Water Authority 15-Nov-11 1-Mar-12 CPA 31-Dec-99CPA 5 9 11

833CPA0167.01 Dubai 3 MW Photovoltaic Power Plant Middle-East Arabian Peninsula United Arab Emirates City of Dubai Replaced At Validation Solar Solar Solar PV ACM2 1 2.4 7 25 0.0 1-Jan-13 0.000 19.487 AENOR n.a. Dubai Electricity and Water Authority 15-Nov-11 1-Mar-12 30-Dec-99 5 9 11 1 First Solar USA 3.0 4723 0.516 No Prevailing practice 2.435 2.435 2.435 2.435 2.435 2.435 2.435

834PoA0168 KTK5EZZYX81QEZSJJUFCM9EDS84CSD 8239 African Clean Energy Switch – Biogas (ACES-Biogas) Africa East Africa Kenya Registered Methane avoidance Methane avoidance Domestic manure AMS-I.E. 1 63.9 2-Jan-12 28 0.000 513.048 Carbon Check 0.000 n.a. Uganda Carbon Bureau 16-Nov-11 4-Sep-12 24-Dec-12 19-Apr-13 24-Dec-12 CPA 30-Dec-99CPA 4 1 6 9 8 2 0.0

835CPA0168.01 8239-0001 ACES-Biogas – KENFAP – Kenya – CPA001 Africa East Africa Kenya Kenya Registered Methane avoidance Methane avoidance Domestic manure Domestic biogas systems AMS-I.E. 1 63.9 7 21 6.5 24-Dec-12 0.000 513.048 Carbon Check n.a. Uganda Carbon Bureau 16-Nov-11 24-Dec-12 30-Dec-99 4 1 6 9 8 2 0 Yes Prevailing practice 28.365 56.492 74.750 75.304 73.045 70.853 68.728

836PoA0169 ZXAQM4XKMQ3TBG57GFX12GCQ3EUT6B 10014 Asia & Pacific East Asia South Korea South Korea KECO Registered Methane avoidance Methane avoidance Waste water AMS-I.C. 3 3.1 26-Apr-11 28 0.202 19.238 SGS 0.000 n.a. KEMCO 18-Nov-11 29-Oct-12 3-Nov-14 6-Feb-15 3-Nov-14 PoA 30-Dec-99PoA 11 9 1 0.0 Investment

837CPA0169.01 10014-0001 Asia & Pacific East Asia South Korea Gyeongsangnam KECO Registered Methane avoidance Methane avoidance Waste water AMS-I.C. 1 1.2 10 25 0.0 26-Apr-11 0.202 12.180 SGS n.a. KEMCO 18-Nov-11 3-Nov-14 30-Dec-99 11 9 1 0 0.674 No 120.460 120.460 120.460 120.460 120.460 120.460 120.460 120.460 120.460 120.460

838CPA0169.02 10014-0002 Asia & Pacific East Asia South Korea Gyeongsangnam KECO Registered Methane avoidance Methane avoidance Waste water AMS-I.C. 1 1.6 7 25 0.0 1-Jan-18 0.000 4.692 SGS KEMCO 18-Nov-11 20-Jun-16 30-Dec-99 11 9 1 0 No 1.564 1.564 1.564 1.564 1.564 1.564 1.564

839CPA0169.03 10014-0003 Installation of co-generation system in sewage treatment plant of Asan Asia & Pacific East Asia South Korea Gyeongsangnam KECO Registered Methane avoidance Methane avoidance Waste water AMS-I.C. 1 0.3 7 25 0.0 3-Sep-12 0.000 2.366 SGS KEMCO 18-Nov-11 20-Jun-16 30-Dec-99 11 9 1 0 No 0.284 0.284 0.284 0.284 0.284 0.284 0.284

840PoA0170 809F1SI7X2R4P021CLFMYA1Q2QZJ0H 7167 Green Power for South Africa Africa Southern Africa South Africa South Africa Additional Energy Registered Hybrid renewables Solar Solar PV ACM2 11 1,233.4 18-Nov-11 28 0.000 12,333.620 JCI 0.000 598.331 598.331 Switzerland (Additional Energy) United K. (Standard Bank) International Carbon 18-Nov-11 11-Jun-12 13-Dec-12 26-Jan-13 14-Dec-12 CPA 31-Dec-99CPA 9 11 5 3 2 7 668.9

841CPA0170.01 7167-0001 Scatec Solar Linde CPA-001 (“SSL CPA-001”). Africa Southern Africa South Africa Northern Cape Additional Energy Registered Solar Solar Solar PV 75 MW (Linde) solar PV plant ACM2+ASB1 1 80.9 10 20 -0.6 1-Dec-13 0.000 809.070 JCI 86.814 86.814 2-Nov-16 30-Jun-15 Switzerland (Additional Energy) United K. (Standard Bank) International Carbon 18-Nov-11 14-Dec-12 30-Dec-99 9 11 5 3 2 7 0 75.0 130971 0.953 No Investment 3 22.092 80.907 80.907 80.907 80.907 80.907 80.907 80.907 80.907 80.907 74.165

842CPA0170.02 7167-0002 Scatec Solar Kalkbult CPA-002 (“SSK CPA-002”) Africa Southern Africa South Africa Northern Cape Additional Energy Registered Solar Solar Solar PV 75 MW (Kalkbult) solar PV plant ACM2+ASB1 1 126.5 10 20 -0.6 1-Jun-13 0.000 1,265.250 JCI 257.077 257.077 4-Nov-16 30-Jun-15 United K. (Standard Bank) International Carbon 28-Feb-13 30-Dec-99 9 11 5 3 2 7 0 75.0 135801 0.972 No Investment 3 53.875 128.671 128.165 127.637 127.109 126.581 126.053 125.525 124.997 124.469 72.165

843CPA0170.03 7167-0003 AE-AMD Herbert CPA-003 (“AEH CPA-003”) Africa Southern Africa South Africa Northern Cape Additional Energy Registered Solar Solar Solar PV 20 MW (Herbert) solar PV plant ACM2+ASB1 1 37.4 10 20 -0.6 9-Dec-13 0.000 374.320 JCI United K. (Standard Bank) International Carbon 28-Feb-13 30-Dec-99 9 11 5 3 2 7 0 20.0 43231 0.972 No Investment 3 38.650 38.375 38.101 37.829 37.559 37.291 37.025 36.760 36.497 36.236

844CPA0170.04 7167-0004 Erika Energy Soutpan CPA-004 (“EES CPA-004”). Africa Southern Africa South Africa Limpopo Additional Energy Registered Solar Solar Solar PV 28 MW (Soutpan) solar PV plant ACM2+ASB1 1 53.1 10 25 -0.6 9-Dec-13 0.000 530.880 JCI United K. (Standard Bank) n.a. 28-Mar-13 30-Dec-99 9 11 5 3 2 7 28.0 58331 0.972 No Investment 3 54,333.000 54,234.000 53,908.000 53,585.000 53,263.000 52,943.000 ### ###51,996.000 ###

845CPA0170.05 7167-0005 Core Energy Witkop CPA-005 (“CEW CPA-005”). Africa Southern Africa South Africa Limpopo Additional Energy Registered Solar Solar Solar PV 30 MW (Witkop) solar PV plant ACM2+ASB1 1 59.5 10 25 -0.6 10-Mar-14 0.000 594.880 JCI United K. (Standard Bank) n.a. 28-Mar-13 30-Dec-99 9 11 5 3 2 7 30.0 66171 0.972 No Investment 3 46,095.000 61,184.000 60,817.000 60,452.000 60,089.000 59,729.000 ### ###58,660.000 ### ###

846CPA0170.06 7167-0006 Solar Capital De Aar 1 CPA-006 ("SCDA1 CPA-006") Africa Southern Africa South Africa Northern Cape Additional Energy Registered Solar Solar Solar PV 75 MW (Witkop) solar PV plant ACM2+ASB1 1 155.3 10 25 -0.6 1-Mar-14 0.000 1,552.750 JCI 134.488 134.488 2-Nov-16 30-Jun-15 United K. (Standard Bank) n.a. 16-May-13 30-Dec-99 9 11 5 3 2 7 75.0 171534 0.972 No Investment 3 134.154 159.906 158.621 157.346 156.080 154.825 153.580 152.272 151.105 149.905 24.950

847CPA0170.07 7167-0007 Solar Capital De Aar 3 CPA-007 ("SCDA3 CPA-007") Africa Southern Africa South Africa Northern Cape Additional Energy Registered Solar Solar Solar PV 75 MW (Witkop) solar PV plant ACM2+ASB1 1 155.3 10 25 -0.6 1-Jan-15 0.000 1,552.750 JCI United K. (Standard Bank) n.a. 16-May-13 30-Dec-99 9 11 5 3 2 7 75.0 171534 0.972 No Investment 3 160.985 159.691 158.407 157.133 155.870 154.616 153.373 152.051 150.916 149.703

848CPA0170.08 7167-0008 Lesedi 74.96 MW Solar PV Project CPA-008 Africa Southern Africa South Africa Northern Cape Additional Energy Registered Solar Solar Solar PV 76.96 MW (Witkop) solar PV plant ACM2+ASB1 1 135.5 10 25 -0.6 1-Mar-14 0.000 1,354.540 JCI United K. (Standard Bank) n.a. 16-May-13 30-Dec-99 9 11 5 3 2 7 75.0 145813 0.972 No Investment 3 138.495 137.803 137.486 136.418 135.726 135.033 134.709 133.648 132.956 132.263

849CPA0170.09 7167-0009 Letsatsi 74.96 MW Solar PV Project CPA-009 Africa Southern Africa South Africa Free State Additional Energy Registered Solar Solar Solar PV 74.96 MW (Witkop) solar PV plant ACM2+ASB1 1 134.7 10 25 -0.6 1-Jan-14 0.000 1,346.900 JCI United K. (Standard Bank) n.a. 16-May-13 30-Dec-99 9 11 5 3 2 7 75.0 144992 0.972 No Investment 3 137.715 137.026 136.711 135.649 134.960 134.272 133.949 132.895 132.206 131.518

850CPA0170.10 7167-0010 Scatec Solar Dreunberg CPA-010 Africa Southern Africa South Africa Additional Energy Registered Solar Solar Solar PV 75 MW (Witkop) solar PV plant ACM2+ASB1 1 155.5 10 25 -0.6 1-Jul-14 0.000 1,555.370 JCI 119.952 119.952 2-Nov-16 30-Jun-15 United K. (Standard Bank) n.a. 16-May-13 30-Dec-99 9 11 5 3 2 7 75.0 165306 0.972 No Investment 3 79.215 158.108 157.466 156.823 156.180 155.537 154.894 154.252 153.609 152.966 76.322

851CPA0170.11 7167-0011 Boshof Solar Park CPA-011 Africa Southern Africa South Africa Free State Additional Energy Registered Solar Solar Solar PV 65.95MW Solar PV Park ACM2+ASB1 1 139.7 10 25 -0.8 1-Dec-14 0.000 1,396.910 JCI United K. (Standard Bank) n.a. 21-Jan-14 30-Dec-99 9 11 5 3 2 7 66.0 143967 0.980 No Investment 3 143.505 142.644 141.788 140.937 140.091 139.251 138.415 137.585 136.759 135.939

852PoA0171 IZAWROARH8X0ING3ZXO0848B19WM7L 7997 Improved Cook stoves Programme – India Asia & Pacific Southern Asia India Registered EE households EE households Stoves AMS-II.G. 10 441.3 1-Sep-11 28 0.060 1,410.232 BV Cert 0.000 Norway (Norwegian Ministry of Finance) General Carbon Advisory Services 19-Nov-11 14-Sep-12 30-Dec-12 21-Jun-13 30-Dec-12 CPA 30-Dec-99Both SD Tool 6 4 3 9 11 0.0

853CPA0171.01 7997-0001 CPA 001 – Improved Cook stoves Programme-India Asia & Pacific Southern Asia India Maharashtra Registered EE households EE households Stoves AMS-II.G. 1 11.0 10 10 0.0 30-Dec-12 0.060 110.050 BV Cert Norway (Norwegian Ministry of Finance) General Carbon Advisory Services 19-Nov-11 30-Dec-12 30-Dec-99 SD Tool 8 6 4 3 9 11 0 42.1 No 0.060 11.005 11.005 11.005 11.005 11.005 11.005 11.005 11.005 11.005 10.945

854CPA0171.02 7997-0002 CPA 002 – BioLite HomeStove in India Asia & Pacific Southern Asia India Nationwide Registered EE households EE households Stoves AMS-II.G. 1 47.8 7 7 0.0 9-Sep-16 0.000 206.207 BV Cert Norway (Norwegian Ministry of Finance) General Carbon Advisory Services 19-Nov-11 9-Sep-16 30-Dec-99 8 6 4 3 9 11 0 No 47.818 47.818 47.818 47.818 47.818 47.818 47.818

Distribution of h igher-efficiency, clean burning improved cooking b iomass ICS (stoves) to residential households

Up Energy Improved Cookstoves Programme,Uganda – CPA No 003

Distribution of h igher-efficiency, clean burning improved cooking b iomass ICS (stoves) to residential households

Up Energy Improved Cookstoves Programme,Uganda – CPA No 004

Distribution of h igher-efficiency, clean burning improved cooking b iomass ICS (stoves) to residential households

Provision of higher-efficiency, clean burning improved cooking b iomass ICS (stoves) to residential households

Replace with higher-efficiency, clean burning improved cooking b iomass ICS (stoves) to residential households

Provision of higher-efficiency, clean burning improved cooking b iomass ICS (stoves) to residential households

Provision of higher-efficiency, clean burning improved cooking b iomass ICS (stoves) to residential households

Provision of higher-efficiency, clean burning improved cooking b iomass ICS (stoves) to residential households

Provision of higher-efficiency, clean burning improved cooking b iomass ICS (stoves) to residential households

Provision of higher-efficiency, clean burning improved cooking b iomass ICS (stoves) to residential households

Provision of higher-efficiency, clean burning improved cooking b iomass ICS (stoves) to residential households

Botswana, Lesotho, Mozambique, Namibia, South Africa, Swaziland, Zambia, Zimbabwe

To reduce reliance on fossil fue l based electricity and thus to reduce the associated CO2 emissions in Southern Africa

Southern Africa Solar Electrical Energy (SASEE) Programme – Ellies Gauteng SSC-CP A

Investment;Prevailing practice

Botswana, Lesotho, Mozambique, Namibia, South Africa, Swaziland, Zambia, Zimbabwe

Botswana, Lesotho, Mozambique, Namibia, South Africa, Swaziland, Zambia, Zimbabwe

To to reduce re liance on fossil fuel based electricity and thus reduce the associated CO2 emissions in Southern Africa through the use of solar thermal energy

Southern Africa Solar Thermal Energy (SASTE) Programme – Ell ies Gauteng SSC-CP A

Investment;Prevailing practice

Simple cost analysis

Maintain ing the energy efficiency of South Africa’s residential l ightingstock achieved by previous Eskon CFL pro jects, by d istributing CFLs free of charge to households acrossSouth Africa

Between 800,000 to 1,000,000 CFLs to household

Financial ;Investment;Other;Prevailing practice

Simple cost analysis

Energy Efficiency Improvements in Furnaces used in SME Steel industry clusters in India

Small Industries Development Bank of India (SIDBI)Industries Development Bank of India (SIDBI)

Implementing energy efficiencyimprovements in existing furnaces used in Smal l and Medium Enterprises (SME) steel industry clustersacross Ind ia.

Energy Efficiency Improvements in Furnaces used in SME Steel industry clusters in India – CPA 01-Jodhpur

Small Industries Development Bank of India (SIDBI)

EE measures in furnaces in SME steel rerol ling industria l facili ties

ASEAN countries (Indonesia)

To introduce measures and technologies that recover b iogas from b iogenic organic matter in waste water and use this gas as a fuel to generate Renewable Electricity for export to a grid

Switzerland (South Pole Carbon Asset Management), Netherlands (E.ON)

Anaerobic Digester (AD) pond for POME treatment, wi th energy generation

Switzerland (South Pole Carbon Asset Management), Netherlands (E.ON)

Benchmark analysis

Chi le (Central In terconnected System)

Association of Smal l and Medium Scale Hydroelectric Power P lants (APEMEC)

To promote Non-Conventional Renewable Energy (NCRE) generation in Chi le inthe form of small hydro plants

Association of Smal l and Medium Scale Hydroelectric Power P lants (APEMEC)

Benchmark analysis

To facili ta te the development of smal l scale renewable energy projects in India

Switzerland (Swiss Carbon Asset+South Pole Carbon Asset Management)

2 MW grid connected so lar photovol ta ic plant

Switzerland (Swiss Carbon Asset+South Pole Carbon Asset Management)

Financial ;Other;Technological

Benchmark analysis

National Capi ta l Region

15 MW grid connected solar photovol ta ic plant

Switzerland (Swiss Carbon Asset+South Pole Carbon Asset Management)

Generation of electricity by utilizing the hydro power potentialin the region

To reduce a sign ificant amount of GHG emiss ions from the wastewater treatment systems of the agro-industry processing facil ities

Recovering the biogas from biogenic organic matter in the POME

Investment;Prevailing practice;Technological

Benchmark analysis

Methane Capture, Combustion and Possib le Electricity Generation from AWMS in Mexico

To promote susta inable development of livestockmanagement system by improvements on thei r wastewater treatment systems

AMS-III.D.+AMS-III.F.+AMS-I.D.

Methane Capture, Combustion and Possib le Electricity Generation from AWMS in Mexico – CPA 001

Closed anaerobic d igester with biogas capture and power generation

AMS-III.D.+AMS-III.F.+AMS-I.D.

Financial ;P revai ling practice

Benchmark analysis

Programme for replacement of trad itional cookstoves with modern cookstoves in Ind ia

To make modern cookstoves available at affordable prices in households of ruralIndia

CPA # 001 Replacement of traditional cookstoves with modern cookstoves in selected area of Pali D istrict.

Simple cost analysis

Programme of Activities to in troduce renewable energy system into col lective housing, Republ ic of Korea

To reduce the thermal or e lectric energy based on coal and other carbon intensive fossil fue lsProgramme of Activities to in troduce renewable energy system into col lective

housing, Republ ic of Korea – <CPA No.001>PV power plant and solar water heating system

Wuhan Tianying Envi ronmental Engineering

To establ ish a sustainable livestock waste management model thatwould signi ficantly improve rura l environment and reduce greenhouse gas emiss ions

Wuhan Tianying Envi ronmental Engineering

Biogas digesters wi thmethane utilization for energy generation

Benchmark analysis

To develop a p latform for overcoming the hurdles to the implementation of a series of solar power projects (SPV and CSP)

5 MW grid connected so lar PV power pro ject5 MW grid connected so lar PV power pro ject5 MW grid connected so lar PV power pro ject

CPA 6328-0004 : CPA - 003: 5 MW Solar PV power pro ject, Jodhpur District, Rajasthan, Ind ia

5 MW grid connected so lar PV power pro ject5 MW grid connected so lar PV power pro ject5 MW grid connected so lar PV power pro ject5 MW grid connected so lar PV power pro ject

CPA - 008: 11.25 MW Solar PV Power Pro ject, Rajgarh, Agar, MadhyaPradesh, India

11.25 MW grid connect Solar PV power pro ject

CPA - 009: 10.5 MW Solar PV Power Project, Agar and Sehore, MadhyaPradesh, India

10.5 MW grid connected Solar P V power pro ject

15 MW grid connected Solar PV power pro ject

To distribute over 3 mil lion LifeStraw® Family units, serving over 12 mil lionpeople, in Indonesia

Sustainable Deployment of the LifeStraw® Family in Lampung Timur d istrict in Lampung province, Indonesia

Vestergaard Frandsen Group

To make modern LED based lighting technologies available to poorhouseholds in develop ing countries and to expedi te the phasing out o f fossil fue l based lamps.

Renewable energy based LED l ighting systemsDistribute renewable energy based LED lamps to households and SMEs in Uganda. The lamps will be based on Solar PV.

To help small hydropower projectspromoters to overcome the financial and structural barriers faced on the implementation of smal lhydropower plants in Mexico

Benchmark analysis

Rural Household Biogas Digester Programme in Seven Regions of Sichuan Province

Sichuan Wuhai Envi ronmental Protection & Bioengineering CO.

To enable the rural population of the seven reg ions in Sichuan toparticipate in the biogas development programme.

Rural Household Biogas Digester Project Activity in Nanjiang County, CPA-01_ Nanjiang

Sichuan Wuhai Envi ronmental Protection & Bioengineering CO.

Energy generation through anaerobic digestion and b iogas-basedenergy generation.

AMS-III.AO.+AMS -III.D.+AMS-I.C.

CPA FSCAD001 – Under the PoA "A naerobic Digestion and Renewable Energy in South Africa"

Anaerobic digester and a b iogas cogeneration p lant

AMS-III.AO.+AMS -III.D.+AMS-I.C.

Investment;Other;Technological

Benchmark analysis

To develop a p latform for supporting the development of small hydropower projects in Viet Nam

Energy and Environment Consultancy Joint Stock Company

Energy and Environment Consultancy Joint Stock Company

Benchmark analysis

Energy and Environment Consultancy Joint Stock Company

Benchmark analysis

Energy and Environment Consultancy Joint Stock Company

Benchmark analysis

Energy and Environment Consultancy Joint Stock Company

Benchmark analysis

Energy and Environment Consultancy Joint Stock Company

Benchmark analysis

Energy and Environment Consultancy Joint Stock Company

Benchmark analysis

Energy and Environment Consultancy Joint Stock Company

Benchmark analysis

Biogas Development Programme at household/ small farm level in Gansu Province

Lanzhou Hualong Poul try Breeding Co.

To enable the population of the rural areas in Gansu Province to participate in the programme and therefore to improve local environment and l iving conditions

Uni ted K. (A&T Carbon Asset Co.), France (EDF Trading)

Biogas Development Programme at household/ small farm level in Gansu Province—CPA-0001

Lanzhou Hualong Poul try Breeding Co.

Biogas digesters for 3,500 ind ividual households with biogas use for cooking

Uni ted K. (A&T Carbon Asset Co.), France (EDF Trading)

Lanzhou Hualong Poul try Breeding Co.

To establ ish a sustainable livestock waste management model that

Uni ted K. (A&T Carbon Asset Co.), France (EDF Trading)Lanzhou Hualong Poul try

Breeding Co.Uni ted K. (A&T Carbon Asset Co.), France (EDF Trading)

Benchmark analysisCarbon Coord ination and

Managing Entity LtdTo increase the amount of renewable energy in the Thai electricity grid, therebyreducing CO2 emissions

Switzerland (South Pole Carbon Asset Management), Sweden (Government of S weden)

Carbon Coord ination and Managing Entity Ltd

Switzerland (South Pole Carbon Asset Management), Sweden (Government of S weden)

DuPont Apol lo

Benchmark analysis

Carbon Coord ination and Managing Entity Ltd

Solar Frontier, Hyundai , Sharp

Carbon Coord ination and Managing Entity Ltd

Botswana, Lesotho, Mozambique, Namibia, Swaziland, Zambia, Zimbabwe

Botswana, Lesotho, Mozambique, Namibia, Swazi land, South Africa, Zambia, Zimbabwe

To incentivise broad scale investment in renewable energy technology and reduce dependence on fossi l fuels electricity

Southern African Renewable Energy (SARE) Programme – African Rainbow Energy PV CPA

Grid connected so lar photovoltaic panels of approximately 25MW

Benchmark analysis

Beij ing Jinhaihuitong Investment Consul ting Co.

To establ ish a sustainable livestock waste management model thatwould signi ficantly improve rura l environment and reduce greenhouse gas emiss ions, through the use ofa programmatic approach for biogas digester activi ties

Beij ing Jinhaihuitong Investment Consul ting Co.

Biogas digester wi th uti lization of biogas for energy production

Investment;Other;Prevail ing practice;Technological

Benchmark analysis

Tonalli Renewable Energy Programme S. de R.L. de C.V.

To develop a p latform that can support the development ofsustainable, renewable energy projects in Mexic o

Tonalli Renewable Energy Programme S. de R.L. de C.V.

Investment;Other;Prevail ing practice;Technological

Benchmark analysis

Baja Cali fornia Sur State

Tonalli Renewable Energy Programme S. de R.L. de C.V.

Benchmark analysis

To boost the use of renewable energy by domestic consumers of the RSA

To implement smal l scale hydropower plants in thePhi lippines and d isplace fossi l-fuel based electricity generation

Benchmark analysis

Asiapac Green Renewable Energy Co.

To facili ta te implementation of s mall sca le hydro in Phi lippines

Carbonergy Business Consul tancy Services

Asiapac Green Renewable Energy Co.

Run of river hydro p lant wi th capaci ty of 2.75 MW

Carbonergy Business Consul tancy Services

Financial ;P revai ling practice

PT. GP Carbon Solutions Services Indonesia

To reduce a sign ificant amount of GHG emiss ions from the wastewater treatment systems of the agro-industry processing facil ities

PT. GP Carbon Solutions Services Indonesia

Recovering the biogas from biogenic organic matter in the POME and production of e lectrici ty

Investment;Prevailing practice;Technological

Benchmark analysis

Alternative Energy Promotion Center

To promote d issemination of Improved Cooking Stove (ICS) with replacement of existing Tradi tional Cooking Stoves (TCS )

Alternative Energy Promotion Center

Installation of 5,6453 Improved Cooking Stoves (ICS)

Alternative Energy Promotion Center

To promote d isseminationof Improved Water Mil ls with replacement of existing low powered, low efficiency Tradi tional Water Mi lls

Alternative Energy Promotion Center

CPA 9889-0002: PoA for Promotion of the Improved Water Mi lls (IWM) in Nepal

Alternative Energy Promotion Center

Biomass Heat Generation Development Programme of Activities Managed by INTRACO

Investment and Trade Consultancy Company (INTRACO)

To disp lace fossi l fuel util ization for thermal energy generation by the BiomassBased Heat Producing Programme

Investment and Trade Consultancy Company (INTRACO)

Installation of 12 MWth biomass heat generation system of b iomass boiler

Simple cost analysis

Phil ipp ine Backyard Piggeries Biogas Corporation

To Improve environmental conditions by the effective capture and clean-burn of biogasproduced from the anaerobic digestion of pig manure

Phil ipp ine Backyard Piggeries Biogas Corporation

Floating drum digester with use of biogas for cooking

Financial ;P revai ling practice;Technological

Eth iop ia, Uganda, Rwanda, Kenya, Zambia, Mozambique, Madagascar, Zimbabwe

Eth iop ia, Uganda, Rwanda, Kenya, Zambia, Malawi , Mozambique, Madagascar and Zimbabwe

To replace kerosene-based lighting with approved Project Lamps in East Africa

Blantyre, Chikwawa, Chi radzulu, Mulanje, Nsanje, Phalombe, Thyolo

Replacing kerosene lamps with solar LED lamps

Investment;Prevailing practice;Technological

Simple cost analysis

To construct and d istribute approximate ly 300,000 efficient cook stoves

Financial ;Investment;Prevai ling practice;Technological

Sales and d issemination of solar LED lamps in India

Recovery and Avoidance of Methane from Industrial Wastewater Treatment Projects

To recover the methane generated from industria l wastewater and thus avoid GHG emiss ions

Methane recovery from wastewater treatment in a palm oi l mill located at Desa Terungtung, Mukomuko, Bengkulu, Indonesia.

Anaerobic digesters with methane recovery system for treatment of wastewater generated in the palm oi l mill

Investment;Other;Technological

Benchmark analysis

Recovery and Avoidance of Methane from Industrial Wastewater Treatment Projects

Kalimantan BaratBarat

Replacing an existing wastewater treatment system with a newtreatment system i.e. anaerobic digestion using anaerobic tankbased technologies/system coupled with b iogas recovery.

To establ ish a CDM framework to which wind power pro jects

Benchmark analysis

Energy Conservation Center, Ho Chi Minh City

To promote energy saving in the southern reg ion of Viet Nam

Energy Conservation Center, Ho Chi Minh City

Investment;Prevailing practice;Technological

To facili ta te the installation of energyefficiency technologies in commercia l refrigeration plants

Refrigeration Plant Efficiency Programme of Activities SSC-CPA 0001 – PicknPay South Africa

Installation of technologies that improvethe energy efficiency of commercia l refrigeration plants

Financial ;P revai ling practice;Technological

Guatemala, Costa Rica, Nicaragua

Guatemala, Honduras, Costa Rica, Nicaragua

To develop a p latform for overcoming insti tu tional, financial and structuralhurdles for the construction of a series of small hydro projects

Cedros and Vallecil los

TUCANO CDM Programme of Activities for the Promotion of Smal l Hydropower Plants in Brazi l

To help meet Brazil ’s rising demand for energy due to economic growth and to improve the supply of electricity

Benchmark analysisInvestment comparison analysis

Investment comparison analysis

To make efficient cookstoves affordable and avai lab le to low income rural households across Kenya

Centra l (Mbeere North District)

Wood efficient KONSAVA cooking stoves

Financial ;Other;Prevail ing practice;Technological

To identify as many sites as possible and to implement methane capture and util isation and/or destruction

State Academy of Science in Pyongyang

2 flares at the site when fully operational and wi ll destroy an estimated 12m m3 /year of CMM

State Academy of Science in Pyongyang

Tanzania, Uganda, Zimbabwe

Kenya, Tanzania, Uganda, Zimbabwe

To replace ICLs amongst residential users in Kenya, Tanzania,Uganda and Zimbabwe with h igh qual ity CFLs1

Replacing 900,000 ICLs with h igh quali ty CFLs

Simple cost analysis

Replacing ICLs in residentia l applications with self–ballasted CFLs

Replace (approximate ly) 910,000 ICLs with h igh qual ity CFLs

Omega Energia CDM Programme of Activities for the Promotion of Smal l Hydropower Plants in Brazi l

To help meet Brazil ’s rising demand for energy due to economic growth and to improve the supply of electricity

Benchmark analysis

Angola, Botswana, DR Congo, Lesotho, Madagascar, Mauri tius, Malawi, Mozambique, Namibia, Seychelles, Swazi land, Tanzania, Zambia, Zimbabwe

Angola, Botswana, DR Congo, Lesotho, Madagascar, Mauri tius, Malawi, Mozambique, Namibia, Seychelles, Swazi land, Tanzania, South Africa, Zambia and Zimbabwe

To develop a multi-track pla tform for overcoming regulatory, institutional, financia l and structura l hurd les for the rol l-out of hydro power by provid ing access to carbon finance

Benchmark analysis

Installation of wind and solar projects generating electricity into the national grid across South Africa.

168,720 Photovol ta ic panels mounted over approx. 200 hectares. Total insta lled capacity o f 45.6 MW

Siemens, SunTech

167,580 Photovol ta ic panels mounted over approx. 100 hectares. Total insta lled capacity o f 45.6 MW

Siemens, SunTech

140.3 MW capacity green field project over an area of approximately 3 ,136 hectares in total

140.3 MW over two land parcels measuring 2,616 hectares (ha) in total

88 MW, delivering an average of 238,800 MWh per year over a 10 year period79.05 MW delivering an average of 251.2GWh per year over a 10 year period

To help meet Brazil ’s rising demand for energy due to economic growth and to improve the supply of electricity

Benchmark analysisBenchmark analysis

Deutsche Bank AG, London Branch

To help meet Brazil ’s rising demand for energy due to economic growth and to improve the supply of electricity

Deutsche Bank AG, London Branch

Benchmark analysis

Deutsche Bank AG, London Branch

Benchmark analysis

Ecopart Assessoria em Negocios Empresariais L tda.Deutsche Bank AG, London BranchEcopart Assessoria em Negocios Empresariais L tda. Wuhan Tianying Envi ronmental Engineering

To set up biogas diges ters and thei r auxiliary facili ties for gas collection and gas use

Wuhan Tianying Envi ronmental Engineering

Caixa Econômica Federa l Solid Waste Management and Carbon Finance Project

To promote the implementation of LFG capture andcombustion/energy generation/distribution systems through the CDM to mitigate the GHG emissions

CPA-1: Landfil l gas recovery, energy generation and biogas distribution from CTR Santa Rosa

LFG collection system and e lectrici ty generation

Benchmark analysis

LFG collection system and e lectrici ty generation

To increase the supply of renewable energy to the Indiannational/sub-national grid from renewable wind energy resources on a commercia lly sustainable basis

30 wind generation turb ines (WTG) of typeG58/850 KW WTGs

Gamesa Wind Turbines

Benchmark analysis

Zhenjiang Qiangling Energy-saving Light Source Co.

To distribute CFLs replacing low efficient ICLs, main ly covering the rura l area of Hebei Province and to reduce the electricity consumed by local residents

Zhenjiang Qiangling Energy-saving Light Source Co.

Benchmark analysis

Burundi, Eth iop ia, Rwanda, Tanzania, Uganda

Burundi, Ethiopia, Kenya, Rwanda, Tanzania, Uganda

To increase dissemination of so lar charged, LED based l ighting appl ications at the domestic level .

Investment;Prevailing practice;Technological

Uni ted Arab Emirates

Dubai Electricity and Water Authority

Generation of electricity through the util ization of the so larpower potential in Dubai.

Dubai Electricity and Water Authority

Thin-film so lar panels in a modular fashion in 1 MW sub-p lantblocks

Eth iop ia, Rwanda, Uganda

Eth iop ia, Kenya, Rwanda, Uganda

African Clean Energy Switch - Biogas (ACES-Biogas)

To make biogas systems affordable and available to households and institutions across East Africa

African Clean Energy Switch - Biogas (ACES-Biogas)

The program to improve energy independence of publ ic sewerage system through biogas increased efficiency in Korea

Introducing b iogas recovery sys tem and biogas power generation system to local sewage treatment p lant in Korea.

Installation of co-generation system in sewage treatment p lant of Chuncheon (ID: Korea environment corporation-0001)

Biogas recovery from sewage & renewable energy generation process

Investment;Prevailing practice;Technological

The retrofit of heat generation system through increased biogas at Gunsan sewage treatment plant

The pro ject retrofits Gunsan sewage treatment plant for e ffective utiliz ation of biogas.

Investment;Prevailing practice;Technological

The pro ject is to install a new biogas co-generation system that disp lace partia l electricity which otherwise would have been imported from a grid by util izing biogas from retrofitted sludge pre-treatment system.

Investment;Prevailing practice;Technological

To supply, install and finance wind and solar CPAs to providerenewable energy into the South African grid

Benchmark analysisBenchmark analysisBenchmark analysisBenchmark analysisBenchmark analysisBenchmark analysisBenchmark analysisBenchmark analysisBenchmark analysis

Eastern Cape Province

Benchmark analysisBenchmark analysis

India, Kenya, Uganda

General Carbon Advisory Services

To deploy appropriate financial mechanisms using carbon revenuesand other incentives to subsid ise the capital cost of e fficient cook stoves and make theseaccessible to rural households for sustainable use

General Carbon Advisory Services

Distribution of domestic fuel e fficient cook stoves to 5000households

Financial ;Investment;Prevai ling practice;Technological

Simple cost analysis

General Carbon Advisory Services

HomeStove wi ll be so ld by the company at attractive prices in exchange for the rights to thecarbon credits.

Financial ;Investment;Prevai ling practice;Technological

855CPA0171.03 7997-0003 CPA 003 – BioLite HomeStove in Kenya Africa East Africa Kenya Kenya Registered EE households EE households Stoves AMS-II.G. 1 48.5 7 7 0.0 19-Jan-18 0.000 143.108 BV Cert Norway (Norwegian Ministry of Finance) General Carbon Advisory Services 19-Nov-11 18-Jan-18 30-Dec-99 8 6 4 3 9 11 0 No 48.500 48.500 48.500 48.500 48.500 48.500 48.500

856CPA0171.04 7997-0004 CPA 004 – BioLite HomeStove in Kenya Africa East Africa Kenya Kenya Registered EE households EE households Stoves AMS-II.G. 1 48.5 7 7 0.0 19-Jan-18 0.000 143.108 BV Cert Norway (Norwegian Ministry of Finance) General Carbon Advisory Services 19-Nov-11 18-Jan-18 30-Dec-99 8 6 4 3 9 11 0 No 48.500 48.500 48.500 48.500 48.500 48.500 48.500

857CPA0171.05 7997-0005 CPA 005 – BioLite HomeStove in Kenya Africa East Africa Kenya Kenya Registered EE households EE households Stoves AMS-II.G. 1 48.5 7 7 0.0 19-Jan-18 0.000 143.108 BV Cert Norway (Norwegian Ministry of Finance) General Carbon Advisory Services 19-Nov-11 18-Jan-18 30-Dec-99 8 6 4 3 9 11 0 No 48.500 48.500 48.500 48.500 48.500 48.500 48.500

858CPA0171.06 7997-0006 CPA 006 – BioLite HomeStove in Kenya Africa East Africa Kenya Kenya Registered EE households EE households Stoves AMS-II.G. 1 48.5 7 7 0.0 19-Jan-18 0.000 143.108 BV Cert Norway (Norwegian Ministry of Finance) General Carbon Advisory Services 19-Nov-11 18-Jan-18 30-Dec-99 8 6 4 3 9 11 0 No 48.500 48.500 48.500 48.500 48.500 48.500 48.500

859CPA0171.07 7997-0007 CPA 007 – BioLite HomeStove in Uganda Africa East Africa Uganda Uganda Registered EE households EE households Stoves AMS-II.G. 1 43.3 7 7 0.0 19-Jan-18 0.000 127.818 BV Cert Norway (Norwegian Ministry of Finance) General Carbon Advisory Services 19-Nov-11 18-Jan-18 30-Dec-99 8 6 4 3 9 11 0 No 43.318 43.318 43.318 43.318 43.318 43.318 43.318

860CPA0171.08 7997-0008 CPA 008 – Charcoal Stoves in Kenya Africa East Africa Kenya Kenya Registered EE households EE households Stoves AMS-II.G. 1 48.4 7 7 0.0 16-Apr-18 0.000 131.241 BV Cert Norway (Norwegian Ministry of Finance) 19-Nov-11 17-Apr-18 30-Dec-99 8 6 4 3 9 11 0 No 48.387 48.387 48.387 48.387 48.387 48.387 48.387

861CPA0171.09 7997-0009 CPA 009 – Charcoal Stoves in Kenya Africa East Africa Kenya Kenya Registered EE households EE households Stoves AMS-II.G. 1 48.4 7 7 0.0 16-Apr-18 0.000 131.241 BV Cert Norway (Norwegian Ministry of Finance) 19-Nov-11 17-Apr-18 30-Dec-99 8 6 4 3 9 11 0 No 48.387 48.387 48.387 48.387 48.387 48.387 48.387

862CPA0171.10 7997-0010 CPA 010 – Charcoal Stoves in Kenya Africa East Africa Kenya Kenya Registered EE households EE households Stoves AMS-II.G. 1 48.4 7 7 0.0 16-Apr-18 0.000 131.241 BV Cert Norway (Norwegian Ministry of Finance) 19-Nov-11 17-Apr-18 30-Dec-99 8 6 4 3 9 11 0 No 48.387 48.387 48.387 48.387 48.387 48.387 48.387

860PoA0172 U4DUVPQZ8BNKWFSSB10VHMXA8PKLNR Ometepe Biogas Programme Latin America Central America Nicaragua EcoRessources Carbono Validation Terminated Methane avoidance Methane avoidance Waste water AMS-III.H. 1 6.3 22-Nov-11 28 0.019 63.310 ERM CVS 0.000 Germany (Mabanaft) EcoRessources Carbono 22-Nov-11 CPA 30-Dec-99CPA 3 1 6 11 5 9 1.2

861CPA0172.01 PROTENA Biogas Project - Ometepe Biogas PoA CPA # 1 Latin America Central America Nicaragua Managua EcoRessources Carbono Validation Terminated Methane avoidance Methane avoidance Waste water AMS-III.H. 1 6.3 10 25 0.0 31-Dec-12 0.019 63.310 ERM CVS Germany (Mabanaft) EcoRessources Carbono 22-Nov-11 30-Dec-99 3 1 6 11 5 9 3 1.2 20 1.300 6.331 6.331 6.331 6.331 6.331 6.331 6.331 6.331 6.331 6.331

862PoA0173 JVJQJIM242XJJ1IRYWYIN1GZP4HJ40 Ventilation Air Methane Oxidation Programme in coal mines Asia & Pacific East Asia China China At Validation Methane avoidance Methane avoidance Ventilation Air Methane ACM8 1 250.7 5-Mar-12 28 126.106 2,507.080 BV Cert 0.000 Japan (Carbon Capital Management) KOE Environmental Consultancy 24-Nov-11 CPA 31-Dec-99CPA 1 3 5 9 1.5

863CPA0173.01 Asia & Pacific East Asia China Henan At Validation Methane avoidance Methane avoidance Ventilation Air Methane ACM8 1 250.7 10 15 0.0 1-Jul-12 126.106 2,507.080 BV Cert Japan (Carbon Capital Management) KOE Environmental Consultancy 24-Nov-11 30-Dec-99 1 3 5 9 0 1.5 8952 0.724 No 3 125.354 250.708 250.708 250.708 250.708 250.708 250.708 250.708 250.708 250.708 125.354

864PoA0174 TMX78MWOLKQ7K1MQYUTE3MKXB0CL7R Landfill Gas Utilisation Programme of South Africa Africa Southern Africa South Africa South Africa Landfill Carbon (PTY) At Validation Landfill gas Landfill gas Landfill power ACM1 1 48.9 1-May-12 28 12.269 403.503 Carbon Check 0.000 n.a. Do-inc. 24-Nov-11 CPA 31-Dec-99CPA 1 6 9 5 7 1.2

865CPA0174.01 CPA01 “Landfill gas capture and utilisation project at Shongweni Landfill” Africa Southern Africa South Africa Durban Landfill Carbon (PTY) At Validation Landfill gas Landfill gas Landfill power ACM1 1 48.9 7 21 4.0 1-Oct-12 12.269 403.503 Carbon Check n.a. Do-inc. 24-Nov-11 30-Dec-99 1 6 9 5 7 0 1.2 8044 0.949 No Prevailing practice 3 10.579 44.501 54.184 56.104 57.905 59.595 61.181 47.002

866PoA0175 OU4SH064A4D3UXRCJX7DFPWDYXIFBE 7460 Animal Manure Treatment Programme in Henan Province and Shaanxi Province Asia & Pacific East Asia China Henan, Shaanxi Registered Methane avoidance Methane avoidance Manure 1 6.3 28-Nov-11 28 0.000 52.281 DNV 0.000 A&T Carbon Asset Co. 24-Nov-11 1-Jun-12 27-Sep-12 14-Dec-12 27-Sep-12 CPA 31-Dec-99PoA 5 6 8 9 11 0.0 MSC

867CPA0175.01 7460-0001 Asia & Pacific East Asia China Chengguan Town Registered Methane avoidance Methane avoidance Manure 1 6.3 7 15 0.0 27-Sep-12 52.281 DNV A&T Carbon Asset Co. 24-Nov-11 27-Sep-12 30-Dec-99 5 6 8 9 11 0 0.724 No Investment MSC 3 4.752 6.336 6.336 6.336 6.336 6.336 6.336 1.584

868PoA0176 6NPJZWMT1MFIDRJSY8ATI9NWEKXNAR Asia & Pacific East Asia China China At Validation Hydro Hydro New dam AMS-I.D. 1 9.2 1-Sep-12 28 9.229 83.112 GLC 0.000 n.a. 25-Nov-11 CPA 31-Dec-99CPA 10 5 9 8 3.2

869CPA0176.01 Jiangxi Suichuan Xianghong Small Hydropower Project Asia & Pacific East Asia China Jiangxi At Validation Hydro Hydro New dam 3.2 MW run of river hydro power plant AMS-I.D. 1 9.2 7 25 0.0 1-Jan-12 9.229 83.112 GLC n.a. 25-Nov-11 30-Dec-99 10 5 9 8 0 3.2 12740 0.724 No Investment 3 9.229 9.229 9.229 9.229 9.229 9.229 9.229

870PoA0177 MGN1UE1212FV8X8VYAN2B6MVWGD5UI 8856 Latin America South America Colombia Colombia CarbonBW Colombia Registered Landfill gas Landfill gas Landfill flaring AMS-III.G. 1 21.0 1-Jan-13 28 0.000 209.980 SQS 0.000 n.a. GFA Consulting Group 25-Nov-11 24-Aug-12 21-Dec-12 21-Dec-12 PoA 30-Dec-99Both 1 11 5 9 8 0.0

871CPA0177.01 8856-0001 CPA-1: Navarro Landfill, Cali Latin America South America Colombia Valle del Cauca CarbonBW Colombia Registered Landfill gas Landfill gas Landfill flaring LFG capture and flaring AMS-III.G. 1 21.0 10 10 -5.9 1-Apr-13 0.000 209.980 SQS n.a. GFA Consulting Group 25-Nov-11 21-Dec-12 30-Dec-99 1 11 5 9 1 No Investment 4 37.093 58.125 47.067 38.438 32.156 27.496 23.966 21.232 19.002 17.050 7.717

872PoA0178 Z0YFALRN6ZSABDAP9L8LOV5BCIFKRJ 6734 South Africa Wind Energy Africa Southern Africa South Africa South Africa Mabanaft Carbon B.V. Registered Wind Wind Wind ACM2 1 93.6 30-Sep-12 28 0.000 468.492 SQS 0.000 Netherlands (Mabanaft) Perspectives 30-Nov-11 6-Jul-12 14-Sep-12 3-Nov-12 14-Sep-12 CPA 31-Dec-99CPA 9 5 10 50.0

873CPA0178.01 6734-0001 Copperton Wind Farm Africa Southern Africa South Africa Northern Cape Mabanaft Carbon B.V. Registered Wind Wind Wind 20 wind turbines of 2.5 MW ACM2 1 93.6 7 20 0.0 1-Jan-16 0.000 468.492 SQS Netherlands (Mabanaft) Perspectives 30-Nov-11 14-Sep-12 30-Dec-99 1 11 5 9 8 3 Nordex Germany 50.0 94870 0.987 No Investment 3 93.674 93.674 93.674 93.674 93.674 93.674 93.674

874PoA0179 CRSHSVGVO1KLUB0ESRLPB3UIFVINAT Côte d’Ivoire and Cameroon Efficient Cookstoves Program Africa West Africa Côte d'Ivoire Cameroon Envirofit International Validation Terminated EE households EE households Stoves AMS-II.G. 1 45.2 1-Jul-12 28 22.740 384.586 TÜV-Rhein 0.000 n.a. Ecosur Afrique 3-Dec-11 PoA 30-Dec-99CPA 8 1 6 9 5 11 0.0

875CPA0179.01 Côte d’Ivoire and Cameroon Efficient Cookstoves Program CPA001 - Abobo 1 Africa West Africa Côte d'Ivoire Abidjan Envirofit International Validation Terminated EE households EE households Stoves AMS-II.G. 1 45.2 7 21 0.0 1-Jul-12 22.740 384.586 TÜV-Rhein n.a. Ecosur Afrique 3-Dec-11 30-Dec-99 8 1 6 9 5 11 1 Envirofit USA 180.0 No 23.961 45.209 45.209 45.209 45.209 45.209 45.209 23.961

876PoA0180 U4QLT6GYTP4SWBHBXP2U53K9CCAPA8 9126 Small Scale Grid-connected Solar Power Programme Africa Southern Africa South Africa South Africa Camco Carbon Africa Registered Solar Solar Solar PV AMS-I.D. 1 11.2 6-Dec-11 28 0.000 111.910 BV Cert 0.000 United K. (CAMCO) CAMCO 6-Dec-11 16-Aug-12 23-Dec-12 29-Mar-13 24-Dec-12 CPA 30-Dec-99CPA 10 5 5.9 MSC

877CPA0180.01 9126-0001 CPA RSA0001 - Merino Photovoltaic Power Station, Republic of South Africa Africa Southern Africa South Africa Free State Camco Carbon Africa Registered Solar Solar Solar PV AMS-I.D. 1 11.2 10 20 0.0 24-Dec-12 0.000 111.910 BV Cert United K. (CAMCO) CAMCO 6-Dec-11 24-Dec-12 30-Dec-99 10 5 0 5.9 11482 0.971 No Financial;Technological MSC 11.191 11.191 11.191 11.191 11.191 11.191 11.191 11.191 11.191 11.191

878PoA0181 ESBDSCL6PRP2QPLXIX9JT01J3XORSA Congo (DRC) Improved Cook Stoves program Africa Central Africa Congo DR Congo DR WESD Capital Validation Terminated EE households EE households Stoves AMS-II.G. 1 44.8 1-Jul-12 28 22.512 380.733 TÜV-Rhein 0.000 Switzerland (Vitol) Ecosur afrique 6-Dec-11 12-Jan-12 PoA 30-Dec-99CPA 1 6 8 5 11 0.0

879CPA0181.01 Congo (DRC) Improved Cook Stoves CPA001 - Kimbanseke 1 Africa Central Africa Congo DR Kinshasa WESD Capital Validation Terminated EE households EE households Stoves 12,749 affordable improved cook stoves AMS-II.G. 1 44.8 7 21 0.0 1-Jul-12 22.512 380.733 TÜV-Rhein Switzerland (Vitol) Ecosur afrique 6-Dec-11 12-Jan-12 30-Dec-99 1 6 8 5 11 3 179.8 No 22.378 44.756 44.756 44.756 44.756 44.756 44.756 22.378

880PoA0182 TZZV9YH000M50TF19LLRVEZO10J3E9 9904 Tanzania Renewable Energy Programme Africa East Africa Tanzania Tanzania Rural Energy Agency Registered Mixed renewables Hybrid renewables Solar & wind & other AMS-I.F.+AMS-I.D. 9 102.4 9-Dec-11 28 0.000 598.789 AENOR 0.000 Sweden (IBRD) WB-CF 10-Dec-11 20-Dec-12 5-Mar-14 3-Jul-14 8-May-14 CPA 31-Dec-99CPA 10 9 5 8 Envirofit USA 33.0

881CPA0182.01 9904-0001 Mapembasi Hydro Power Project, Njombe District Africa East Africa Tanzania Iringa Rural Energy Agency Registered Mixed renewables Hydro Run of river AMS-I.F.+AMS-I.D. 1 28.3 7 25 0.0 1-Jan-13 0.000 226.646 AENOR Sweden (IBRD) WB-CF 10-Dec-11 8-May-14 30-Dec-99 10 9 5 8 3 10.7 54000 0.529 No Financial;Technological 29.151 29.151 29.151 29.151 29.151 29.151 29.151

882CPA0182.02 9904-0002 NextGen Solar Project, Kigoma Region Africa East Africa Tanzania Kigoma Rural Energy Agency Registered Mixed renewables Solar Solar PV AMS-I.F.+AMS-I.D. 1 10.5 7 25 0.0 1-May-14 0.000 69.843 AENOR Sweden (IBRD) WB-CF 10-Dec-11 5-Aug-14 30-Dec-99 10 9 5 8 3 5.0 14000 No MSC 4.485 8.970 11.213 11.213 11.213 11.213 11.213

883CPA0182.03 9904-0003 Mbinga Hydroelectric Project Africa East Africa Tanzania Ruvuma Rural Energy Agency Registered Mixed renewables Hydro Run of river AMS-I.F.+AMS-I.D. 1 5.0 7 25 0.0 1-Dec-15 0.000 25.194 AENOR Sweden (IBRD) WB-CF 10-Dec-11 6-Nov-15 31-Dec-99 10 9 5 8 3.00 1.1 3114 No Financial;Technological MSC 0.208 4.982 4.982 4.982 4.982 4.982 4.982 4.567

884CPA0182.04 9904-0004 Yovi Small Hydro Power Project Africa East Africa Tanzania Morgoro Rural Energy Agency Registered Mixed renewables Hydro Run of river Installation of a 2.3 MW Pelton turbine AMS-I.F.+AMS-I.D. 1 12.0 7 25 0.0 1-Dec-15 0.000 61.128 AENOR Sweden (IBRD) WB-CF 10-Dec-11 6-Nov-15 31-Dec-99 10 9 5 8 3.00 2.3 15100 No Financial;Technological 0.553 12.080 12.080 12.080 12.080 12.080 12.080 11.073

885CPA0182.05 9904-0005 Tulila Hydro-electric Plant Africa East Africa Tanzania Ruvuma Rural Energy Agency Registered Mixed renewables Hydro Run of river AMS-I.F.+AMS-I.D. 1 24.0 7 25 0.0 1-Dec-15 0.000 122.048 AENOR Sweden (IBRD) WB-CF 10-Dec-11 6-Nov-15 31-Dec-99 10 9 5 8 3.00 7.5 44500 No Financial;Technological 1.886 23.800 26.280 23.585 23.585 23.585 23.585 21.619

886CPA0182.06 9904-0006 Maguta Small Hydro Power Project Africa East Africa Tanzania Kilolo Rural Energy Agency Registered Mixed renewables Hydro Run of river AMS-I.F.+AMS-I.D. 1 6.8 7 25 0.0 1-Nov-16 0.000 28.245 AENOR Sweden (IBRD) WB-CF 10-Dec-11 7-Jul-16 31-Dec-99 10 9 5 8 3.00 2.4 No Financial;Technological 1.076 6.539 6.623 6.708 6.793 6.878 6.963 5.873

887CPA0182.07 9904-0007 Ngombeni Biomass Power Plant Project Africa East Africa Tanzania Pwani Rural Energy Agency Registered Mixed renewables Biomass energy Forest residues: other AMS-I.F.+AMS-I.D. 1 12.0 7 25 0.0 1-Sep-16 0.000 52.093 AENOR Sweden (IBRD) WB-CF 10-Dec-11 11-Aug-16 31-Dec-99 10 9 5 8 3.00 2.5 15023 No Financial;Technological 4.006 12.019 12.019 12.019 12.019 12.019 12.019 8.012

888CPA0182.08 9904-0008 Ikondo Micro Hydro Power Plant Africa East Africa Tanzania Njombe Rural Energy Agency Registered Mixed renewables Hydro Run of river AMS-I.F.+AMS-I.D. 1 1.4 7 25 0.0 1-Oct-16 0.000 6.021 AENOR Sweden (IBRD) WB-CF 10-Dec-11 14-Oct-16 31-Dec-99 10 9 5 8 3.00 0.4 1960 No Financial;Technological 0.354 1.416 1.416 1.416 1.416 1.416 1.416 1.062

889CPA0182.09 9904-0009 Darakuta Mini Hydro Project Africa East Africa Tanzania Manyara Rural Energy Agency Registered Mixed renewables Hydro Run of river AMS-I.F.+AMS-I.D. 1 2.5 7 25 1-Dec-17 7.570 AENOR Sweden (IBRD) WB-CF 10-Dec-11 12-Dec-17 31-Dec-99 10 9 5 8 3.00 1.1 6266 0.530 No Financial;Technological 0.065 0.799 0.799 3.164 3.164 3.164 3.164 2.900

890PoA0183 Aux_ACG70V0UUUPNDPCRJL8KRYLHHSB0CJ 9870 Programme for Promotion of Access to Domestic Biogas in Rural Bangladesh Asia & Pacific Southern Asia Bangladesh Bangladesh Withdrawn Methane avoidance Methane avoidance Domestic manure AMS-I.E. 1 0.9 13-Dec-11 28 4.029 7.817 JQA 0.000 Japan (PEAR Carbon Offset Initiative) PEAR Carbon Offset Initiative 13-Dec-11 31-Jan-13 22-Jan-14 15-Mar-14 PoA 30-Dec-99PoA 1 6 4 8 0.0 MSC

891CPA0183.01 9870-0001 Domestic Biogas CPA-1.12.2011 in Rural Bangladesh (13/12/2011–31/01/2012) Asia & Pacific Southern Asia Bangladesh Dhaka Withdrawn Methane avoidance Methane avoidance Domestic manure AMS-I.E. 1 0.9 7 20 0.0 13-Dec-11 4.029 7.817 JQA Japan (PEAR Carbon Offset Initiative) PEAR Carbon Offset Initiative 13-Dec-11 30-Dec-99 1 6 4 8 0 Yes Other MSC 0.319 3.830 3.830 3.830 3.830 3.830 3.830 3.511

892PoA0184 2Q6GWNY332XXRS81YOIEB6EW5G4U5Q 7359 Africa East Africa Madagascar Green Development AS Registered EE households EE households Stoves AMS-I.E. 66 5,630.5 1-Oct-12 28 0.000 33,677.380 DNV 0.000 Norway (Green Development) Green Development 13-Dec-11 16-Nov-11 30-Nov-12 19-Jan-13 30-Nov-12 PoA 30-Dec-99PoA SD Tool 4 1 6 5 9 0.0 Yes

893CPA0184.01 7359-0001 CPA-MA-001-Ambhohidratrimo Africa East Africa Madagascar Ambohidratrimo Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 51.4 7 21 7.4 1-Jan-13 0.000 411.221 DNV Norway (Green Development) Green Development 13-Dec-11 30-Nov-12 30-Dec-99 SD Tool 4 1 6 5 9 0 No N/A Plist Yes 20.007 40.610 46.412 52.213 58.015 63.816 69.618

894CPA0184.02 7359-0002 CPA-MA 002 Atsinanana 1 Africa East Africa Madagascar Toamasina1 Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 101.8 7 21 12.7 1-Aug-13 0.000 755.366 DNV Green Development 1-Jul-13 30-Dec-99 4 1 6 5 9 0 No N/A Plist 57.454 80.435 91.926 103.417 114.907 126.398 137.889

895CPA0184.03 7359-0003 CPA-MA-003 Antananarivo Renivohitra 4 Africa East Africa Madagascar Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 101.5 7 21 12.7 1-Aug-13 0.000 753.458 DNV Green Development 1-Jul-13 30-Dec-99 4 1 6 5 9 0 No N/A Plist 57.309 80.232 91.694 103.156 114.617 126.079 137.541

896CPA0184.04 7359-0004 CPA-MA- 004 Vakinankaratra 1 Africa East Africa Madagascar Antsirabe 1 Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 82.4 7 21 10.3 1-Aug-13 0.000 611.818 DNV Green Development 1-Jul-13 30-Dec-99 4 1 6 5 9 0 No N/A Plist 46.536 65.150 74.457 83.764 93.071 102.378 111.685

897CPA0184.05 7359-0005 CPA-MA-005 Vakinankaratra 2 Africa East Africa Madagascar Antsirabe 2 Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 69.7 7 21 8.7 1-Aug-13 0.000 517.070 DNV Green Development 1-Jul-13 30-Dec-99 4 1 6 5 9 0 No N/A Plist 39.329 55.060 62.926 70.791 78.657 86.523 94.388

898CPA0184.06 7359-0006 CPA-MA- 006 Vakinankaratra 3 Africa East Africa Madagascar Betafo Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 66.7 7 21 8.3 1-Aug-13 0.000 494.931 DNV Green Development 1-Jul-13 30-Dec-99 4 1 6 5 9 0 No N/A Plist 37.645 52.703 60.232 67.760 75.289 82.818 90.347

899CPA0184.07 7359-0007 CPA-MA- 007 Vakinankaratra 4 Africa East Africa Madagascar Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 84.6 7 21 10.6 1-Aug-13 0.000 627.686 DNV Green Development 1-Jul-13 30-Dec-99 4 1 6 5 9 0 No N/A Plist 47.742 66.839 76.388 85.936 95.485 105.033 114.581

900CPA0184.08 7359-0008 CPA-MA-008 Atsinanana 2 Africa East Africa Madagascar Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 59.3 7 21 7.4 1-Aug-13 0.000 440.090 DNV Green Development 1-Jul-13 30-Dec-99 4 1 6 5 9 0 No N/A Plist 33.474 46.863 53.558 60.253 66.947 73.642 80.337

901CPA0184.09 7359-0009 CPA-MA-009 Alaotra Mangoro Africa East Africa Madagascar Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 47.7 7 21 6.0 1-Aug-13 0.000 354.226 DNV Green Development 1-Jul-13 30-Dec-99 4 1 6 5 9 0 No N/A Plist 26.942 37.719 43.108 48.496 53.885 59.273 64.662

902CPA0184.10 7359-0010 CPA-MA-010 Haute Matsiatra 1 Africa East Africa Madagascar Fianarantsoa Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 98.3 7 21 12.3 1-Aug-13 0.000 729.812 DNV Green Development 1-Jul-13 30-Dec-99 4 1 6 5 9 0 No N/A Plist 55.510 77.714 88.816 99.918 111.020 122.122 133.224

903CPA0184.11 7359-0011 CPA-MA-011 Haute Matsiatra 2 Africa East Africa Madagascar Ambohimahasoa Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 97.5 7 21 12.2 1-Aug-13 0.000 723.733 DNV Green Development 1-Jul-13 30-Dec-99 4 1 6 5 9 0 No N/A Plist 55.048 77.067 88.076 99.086 110.095 121.105 132.114

904CPA0184.12 7359-0012 CPA-MA-012 Haute Matsiatra 3 Africa East Africa Madagascar Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 69.7 7 21 8.7 1-Aug-13 0.000 517.159 DNV Green Development 1-Jul-13 30-Dec-99 4 1 6 5 9 0 No N/A Plist 39.335 55.070 62.937 70.804 78.671 86.538 94.405

905CPA0184.13 7359-0013 CPA-MA-013 Antananarivo Avaradrano Africa East Africa Madagascar Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 86.1 7 21 10.8 1-Aug-13 0.000 639.220 DNV Green Development 1-Jul-13 30-Dec-99 4 1 6 5 9 0 No N/A Plist 48.620 68.068 77.792 87.516 97.239 106.963 116.687

906CPA0184.14 7359-0014 CPA-MA-014 Bongolava Africa East Africa Madagascar Tsiroanomandidy Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 98.1 7 21 12.3 1-Aug-13 0.000 728.239 DNV Green Development 1-Jul-13 30-Dec-99 4 1 6 5 9 0 No N/A Plist 55.390 77.546 88.625 99.703 110.781 121.859 132.937

907CPA0184.15 7359-0015 CPA-MA-015 Itasy Africa East Africa Madagascar Miarinarivo Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 89.3 7 21 11.2 1-Aug-13 0.000 662.703 DNV Green Development 1-Jul-13 30-Dec-99 4 1 6 5 9 0 No N/A Plist 50.405 70.568 80.649 90.730 100.811 110.892 120.973

908CPA0184.16 7359-0016 CPA-MA-016 Analamanga 1 Africa East Africa Madagascar Manjakandriana Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 51.4 7 21 6.4 1-Aug-13 0.000 381.308 DNV Green Development 1-Jul-13 30-Dec-99 4 1 6 5 9 0 No N/A Plist 29.003 40.604 46.404 52.205 58.005 63.806 69.607

909CPA0184.17 7359-0017 CPA-MA-017 Analamanga 2 Africa East Africa Madagascar Anjozorobe Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 60.0 7 21 7.5 1-Aug-13 0.000 445.627 DNV Green Development 1-Jul-13 30-Dec-99 4 1 6 5 9 0 No N/A Plist 33.895 47.453 54.232 61.010 67.789 74.568 81.347

910CPA0184.18 7359-0018 CPA-MA-018 Analamanga 3 Africa East Africa Madagascar Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 103.8 7 21 13.0 1-Aug-13 0.000 770.595 DNV Green Development 1-Jul-13 30-Dec-99 4 1 6 5 9 0 No N/A Plist 58.612 82.057 93.779 105.502 117.224 128.947 140.669

911CPA0184.19 7359-0019 CPA-MA-019 Antananarivo Renivohitra 1 Africa East Africa Madagascar Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 103.9 7 21 13.0 1-Aug-13 0.000 771.085 DNV Green Development 1-Jul-13 30-Dec-99 4 1 6 5 9 0 No N/A Plist 58.649 82.109 93.839 105.569 117.299 129.029 140.759

912CPA0184.20 7359-0020 CPA-MA-020 Antananarivo Renivohitra 2 Africa East Africa Madagascar Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 99.2 7 21 12.4 1-Aug-13 0.000 736.306 DNV Green Development 1-Jul-13 30-Dec-99 4 1 6 5 9 0 No N/A Plist 56.004 78.406 89.607 100.808 112.008 123.209 134.410

913CPA0184.21 7359-0021 CPA-MA-021 Antananarivo Renivohitra 3 Africa East Africa Madagascar Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 101.2 7 21 12.7 1-Aug-13 0.000 751.343 DNV Green Development 1-Jul-13 30-Dec-99 4 1 6 5 9 0 No N/A Plist 57.148 80.007 91.436 102.866 114.295 125.725 137.154

914CPA0184.22 7359-0022 CPA-MA-022 Antananarivo Renivohitra 5 Africa East Africa Madagascar Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 93.7 7 21 11.7 1-Aug-13 0.000 695.337 DNV Green Development 1-Jul-13 30-Dec-99 4 1 6 5 9 0 No N/A Plist 52.888 74.043 84.621 95.198 105.776 116.353 126.931

915CPA0184.23 7359-0023 CPA-MA 023 Antananarivo Renivohitra 6 Africa East Africa Madagascar Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 102.5 7 21 12.8 1-Aug-13 0.000 760.583 DNV Green Development 1-Jul-13 30-Dec-99 4 1 6 5 9 0 No N/A Plist 57.851 80.991 92.561 104.131 115.701 127.271 138.841

916CPA0184.24 7359-0024 CPA-ET-001 LIBEN ZONE Africa East Africa Ethiopia Liben Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 23.2 7 21 1.7 1-Aug-13 0.000 172.419 DNV Green Development 1-Jul-13 30-Dec-99 4 1 6 5 9 0 No N/A Plist 15.487 23.231 23.231 23.231 23.231 23.231 30.975

917CPA0184.25 7359-0025 CPA-ET-002 GULELE Africa East Africa Ethiopia Gulele Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 26.5 7 21 1.9 1-Aug-13 0.000 196.391 DNV Green Development 1-Jul-13 30-Dec-99 4 1 6 5 9 0 No N/A Plist 17.641 26.461 26.461 26.461 26.461 26.461 35.281

918CPA0184.26 7359-0026 CPA-ET-003 KOLFE KERANYO Africa East Africa Ethiopia Kolfe Keranyo Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 23.5 7 21 1.7 1-Aug-13 0.000 174.534 DNV Green Development 1-Jul-13 30-Dec-99 4 1 6 5 9 0 No N/A Plist 15.677 23.516 23.516 23.516 23.516 23.516 31.354

919CPA0184.27 7359-0027 CPA-KE-001 KIBERA Africa East Africa Kenya Langata Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 38.3 7 21 2.7 1-Aug-13 0.000 284.564 DNV Green Development 1-Jul-13 30-Dec-99 4 1 6 5 9 0 No N/A Plist 25.561 38.341 38.341 38.341 38.341 38.341 51.122

920CPA0184.28 7359-0028 CPA-KE-002 NAIVASHA Africa East Africa Kenya Naivasha Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 37.4 7 21 2.7 1-Aug-13 0.000 277.847 DNV Green Development 1-Jul-13 30-Dec-99 4 1 6 5 9 0 No N/A Plist 24.957 37.436 37.436 37.436 37.436 37.436 49.915

921CPA0184.29 7359-0029 CPA-KE-003 KILIFI A Africa East Africa Kenya Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 38.1 7 21 2.7 1-Aug-13 0.000 282.782 DNV Green Development 1-Jul-13 30-Dec-99 4 1 6 5 9 0 No N/A Plist 25.401 38.101 38.101 38.101 38.101 38.101 50.801

922CPA0184.30 7359-0030 CPA-KE-004 KILIFI B Africa East Africa Kenya Magarini , Malindi Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 37.2 7 21 2.7 1-Aug-13 0.000 276.407 DNV Green Development 1-Jul-13 30-Dec-99 4 1 6 5 9 0 No N/A Plist 24.828 37.242 37.242 37.242 37.242 37.242 49.656

923CPA0184.31 7359-0031 CPA-KE-005 MOMBASA Africa East Africa Kenya Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 37.4 7 21 2.1 1-Aug-13 0.000 277.535 DNV Green Development 1-Jul-13 30-Dec-99 4 1 6 5 9 0 No N/A Plist 29.930 37.394 37.394 37.394 37.394 37.394 49.859

924CPA0184.32 7359-0032 CPA-KE-006 KWALE Africa East Africa Kenya Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 36.9 7 21 2.6 1-Aug-13 0.000 273.735 DNV Green Development 1-Jul-13 30-Dec-99 4 1 6 5 9 0 No N/A Plist 24.588 36.882 36.882 36.882 36.882 36.882 49.176

925CPA0184.33 7359-0033 CPA-KE-007 LAMU Africa East Africa Kenya Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 36.6 7 21 2.6 1-Aug-13 0.000 271.293 DNV Green Development 1-Jul-13 30-Dec-99 4 1 6 5 9 0 No N/A Plist 24.369 36.533 36.533 36.533 36.533 36.533 48.738

926CPA0184.34 7359-0034 CPA-KE-008 KISUMU Africa East Africa Kenya Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 34.7 7 21 2.5 1-Aug-13 0.000 257.281 DNV Green Development 1-Jul-13 30-Dec-99 4 1 6 5 9 0 No N/A Plist 23.110 34.665 34.665 34.665 34.665 34.665 46.220

927CPA0184.35 7359-0035 CPA-ML-001 LILONGWE Africa Southern Africa Malawi Lilongwe Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 24.1 7 21 1.7 1-Aug-13 0.000 179.143 DNV Green Development 1-Jul-13 30-Dec-99 4 1 6 5 9 0 No N/A Plist 16.091 24.137 24.137 24.137 24.137 24.137 32.183

928CPA0184.36 7359-0036 CPA-MO-001 MAPUTO CITY Africa East Africa Mozambique Maputo city Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 37.4 7 21 2.7 1-Aug-13 0.000 277.461 DNV Green Development 1-Jul-13 30-Dec-99 4 1 6 5 9 0 No N/A Plist 24.923 37.384 37.384 37.384 37.384 37.384 49.845

929CPA0184.37 7359-0037 CPA-MO-002 MAPUTO PROVINCE Africa East Africa Mozambique Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 26.9 7 21 2.2 1-Aug-13 0.000 199.301 DNV Green Development 1-Jul-13 30-Dec-99 4 1 6 5 9 0 No N/A Plist 17.902 26.853 26.853 26.853 26.853 26.853 38.804

930CPA0184.38 7359-0038 CPA-NI-001 OYO STATE Africa West Africa Nigeria Oyo state Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 26.6 7 21 1.9 1-Aug-13 0.000 197.712 DNV Green Development 1-Jul-13 30-Dec-99 4 1 6 5 9 0 No N/A Plist 17.760 26.639 26.639 26.639 26.639 26.639 35.519

931CPA0184.39 7359-0039 CPA-NI-002 DELTA STATE Africa West Africa Nigeria Delta state Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 23.9 7 21 1.7 1-Aug-13 0.000 177.250 DNV Green Development 1-Jul-13 30-Dec-99 4 1 6 5 9 0 No N/A Plist 15.921 23.882 23.882 23.882 23.882 23.882 31.842

932CPA0184.40 7359-0040 CPA-UG-001 KIRA TOWN Africa East Africa Uganda Wakiso Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 30.8 7 21 2.2 1-Aug-13 0.000 228.758 DNV Green Development 1-Jul-13 30-Dec-99 4 1 6 5 9 0 No N/A Plist 20.548 30.822 30.822 30.822 30.822 30.822 41.096

933CPA0184.41 7359-0041 CPA-ZA-001 LUSAKA Africa East Africa Zambia Lusaka Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 33.0 7 21 2.4 1-Aug-13 0.000 244.649 DNV Green Development 1-Jul-13 30-Dec-99 4 1 6 5 9 0 No N/A Plist 21.975 32.963 32.963 32.963 32.963 32.963 43.951

934CPA0184.42 7359-0042 CPA- MA-024 MADAGASCAR Africa East Africa Madagascar Madagascar Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 88.9 7 21 11.1 1-Apr-14 600.643 DNV Green Development 28-May-14 30-Dec-99 4 1 6 5 9 0 No N/A Plist 50.187 70.262 80.300 90.337 100.375 110.412 120.450

935CPA0184.43 7359-0043 CPA- CA-001-Chad Africa Central Africa Chad Chad Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 83.0 7 21 10.4 1-May-14 553.646 DNV Green Development 28-May-14 30-Dec-99 4 1 6 5 9 0 No N/A Plist 46.830 65.562 74.928 84.294 93.660 103.026 112.392

936CPA0184.44 7359-0044 CPA- ET-004-Ethiopia Africa East Africa Ethiopia Ethiopia Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 84.3 7 21 10.5 1-May-14 562.656 DNV Green Development 28-May-14 30-Dec-99 4 1 6 5 9 0 No N/A Plist 47.592 66.629 76.148 85.666 95.185 104.703 114.222

937CPA0184.45 7359-0045 CPA- GA-001-Ghana Africa West Africa Ghana Ghana Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 111.4 7 21 13.9 1-May-14 743.487 DNV Green Development 28-May-14 30-Dec-99 4 1 6 5 9 0 No N/A Plist 62.888 88.043 100.620 113.198 125.776 138.353 150.931

938CPA0184.46 7359-0046 CPA- IC-001-Ivory Coast Africa West Africa Côte d'Ivoire Ivory Coast Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 97.3 7 21 12.2 1-May-14 649.604 DNV Green Development 28-May-14 30-Dec-99 4 1 6 5 9 0 No N/A Plist 54.947 76.926 87.915 98.904 109.894 120.883 131.872

939CPA0184.47 7359-0047 CPA- KE-009 KENYA Africa East Africa Kenya Kenya Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 103.8 7 21 13.0 1-May-14 692.605 DNV Green Development 28-May-14 30-Dec-99 4 1 6 5 9 0 No N/A Plist 58.584 82.017 93.734 105.451 117.167 128.884 140.601

940CPA0184.48 7359-0048 CPA- LI-001-Liberia Africa West Africa Liberia Liberia Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 102.7 7 21 12.8 1-May-14 685.143 DNV Green Development 28-May-14 30-Dec-99 4 1 6 5 9 0 No N/A Plist 57.953 81.134 92.725 104.315 115.906 127.496 139.087

941CPA0184.49 7359-0049 CPA- ML-002-Malawi Africa East Africa Malawi Malawi Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 88.1 7 21 11.0 1-May-14 587.683 DNV Green Development 28-May-14 30-Dec-99 4 1 6 5 9 0 No N/A Plist 49.709 69.593 79.534 89.476 99.418 109.360 119.302

942CPA0184.50 7359-0050 CPA- MO-003-Mozambique Africa East Africa Mozambique Mozambique Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 98.6 7 21 12.3 1-May-14 657.927 DNV Green Development 28-May-14 30-Dec-99 4 1 6 5 9 0 No N/A Plist 55.650 77.910 89.041 100.171 111.301 122.431 133.561

943CPA0184.51 7359-0051 CPA- NA-001-Namibia Africa Southern Africa Namibia Namibia Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 60.4 7 21 7.5 1-May-14 403.048 DNV Green Development 28-May-14 30-Dec-99 4 1 6 5 9 0 No N/A Plist 34.092 47.729 54.547 61.365 68.184 75.002 81.821

944CPA0184.52 7359-0052 CPA- NI-003-Nigeria Africa West Africa Nigeria Nigeria Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 84.0 7 21 10.5 1-Apr-14 567.416 DNV Green Development 28-May-14 30-Dec-99 4 1 6 5 9 0 No N/A Plist 47.411 66.375 75.858 85.340 94.822 104.304 113.786

945CPA0184.53 7359-0053 CPA- RW-001-Rwanda Africa East Africa Rwanda Rwanda Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 124.9 7 21 15.6 1-May-14 833.459 DNV Green Development 28-May-14 30-Dec-99 4 1 6 5 9 0 No N/A Plist 70.498 98.697 112.797 126.897 140.996 155.096 169.195

946CPA0184.54 7359-0054 CPA- SL-001-Sierra Leone Africa West Africa Sierra Leone Sierra Leone Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 111.9 7 21 14.0 1-May-14 746.711 DNV Green Development 28-May-14 30-Dec-99 4 1 6 5 9 0 No N/A Plist 63.160 88.425 101.057 113.689 126.321 138.953 151.585

947CPA0184.55 7359-0055 CPA- UG-002-Uganda Africa East Africa Uganda Uganda Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 73.6 7 21 9.2 1-May-14 491.158 DNV Green Development 28-May-14 30-Dec-99 4 1 6 5 9 0 No N/A Plist 41.544 58.162 66.471 74.780 83.089 91.398 99.707

948CPA0184.56 7359-0056 CPA- ZA-002-Zambia Africa East Africa Zambia Zambia Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 97.3 7 21 12.2 1-May-14 649.418 DNV Green Development 28-May-14 30-Dec-99 4 1 6 5 9 0 No N/A Plist 54.931 76.903 87.889 98.875 109.861 120.847 131.833

949CPA0184.57 7359-0057 CPA- ZB-001-Zimbabwe Africa East Africa Zimbabwe Zimbabwe Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 122.1 7 21 15.3 1-May-14 814.558 DNV Green Development 28-May-14 30-Dec-99 4 1 6 5 9 0 No N/A Plist 68.899 96.459 110.239 124.019 137.799 151.579 165.359

950CPA0184.58 7359-0058 CPA- SO-001-Somalia Africa East Africa Somalia Somalia Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 91.5 7 21 11.4 1-Jul-14 595.559 DNV Green Development 16-Dec-14 30-Dec-99 4 1 6 5 9 0 No N/A Plist 51.669 72.337 82.670 93.004 103.338 113.672 124.006

951CPA0184.59 7359-0059 CPA- SA-001-South Africa Africa Southern Africa South Africa South Africa Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 81.9 7 21 10.2 1-Jan-15 491.889 DNV Green Development 16-Dec-14 30-Dec-99 4 1 6 5 9 0 No N/A Plist 46.259 64.762 74.014 83.266 92.518 101.770 111.021

952CPA0184.60 7359-0060 CPA-MA-25-Madagascar Ethanol Stove Program Africa East Africa Madagascar Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 300.0 7 21 3-Aug-16 1,324.110 DNV Green Development 3-Aug-16 30-Dec-99 4 1 6 5 9 0 No N/A 150.000 300.000 310.000 310.000 310.000 310.000 310.000

953CPA0184.61 7359-0061 CPA-MA-26-Madagascar Ethanol Stove Program Africa East Africa Madagascar Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 300.0 7 21 1-Jan-18 900.000 DNV Green Development 3-Aug-16 30-Dec-99 4 1 6 5 9 0 No N/A 150.000 300.000 310.000 310.000 310.000 310.000 310.000

954CPA0184.62 7359-0062 CPA-MA-27-Madagascar Ethanol Stove Program Africa East Africa Madagascar Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 300.0 7 21 1-Jan-19 600.000 DNV Green Development 3-Aug-16 30-Dec-99 4 1 6 5 9 0 No N/A 150.000 300.000 310.000 310.000 310.000 310.000 310.000

955CPA0184.63 7359-0063 CPA-MA-28-Madagascar Ethanol Stove Program Africa East Africa Madagascar Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 300.0 7 21 1-Jan-20 300.000 DNV Green Development 3-Aug-16 30-Dec-99 4 1 6 5 9 0 No N/A 150.000 300.000 310.000 310.000 310.000 310.000 310.000

956CPA0184.64 7359-0064 CPA-KE-011 Kenya Ecoeye Mombasa project Africa East Africa Kenya Mombasa Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 21.5 7 21 1-Nov-17 68.065 DNV Green Development 1-Nov-17 30-Dec-99 4 1 6 5 9 0 No N/A 21.491 21.491 21.491 21.491 21.491 21.491 21.491

957CPA0184.65 7359-0065 CPA-KE-010 Kenya Samsung Mombasa project Africa East Africa Kenya Mombasa Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 107.5 7 21 1-Nov-17 340.330 DNV Green Development 1-Nov-17 30-Dec-99 4 1 6 5 9 0 No N/A 107.457 107.457 107.457 107.457 107.457 107.457 107.457

958CPA0184.66 7359-0066 CPA-KE-012 Kenya Samsung project Africa East Africa Kenya Kenya Green Development AS Registered EE households EE households Stoves AMS-I.E. 1 103.7 7 21 15-Mar-18 290.284 DNV Green Development 5-Feb-18 30-Dec-99 4 1 6 5 9 0 No N/A 103.673 103.673 103.673 103.673 103.673 103.673 103.673

959PoA0185 TKUCI3AN3E122550AOL40YALO7IJWW 5341 Improved Cooking Stoves Programme of Activities in Africa Africa East Africa Kenya Envirofit International Registered EE households EE households Stoves AMS-II.G. 7 236.2 13-Dec-11 28 0.565 2,361.530 GLC 0.000 215.663 215.663 1 16-Oct-15 24-Oct-17 Carbon Check South Pole Carbon Asset Management 13-Dec-11 9-Aug-12 6-Dec-12 29-Jan-13 6-Dec-12 PoA 30-Dec-99PoA 5 4 1 6 8 10 0.0

960CPA0185.01 5341-0001 Africa East Africa Kenya Many Envirofit International Registered EE households EE households Stoves AMS-II.G. 1 13.6 10 21 0.0 15-Dec-12 0.565 135.560 GLC 215.663 16-Oct-15 31-Dec-16 Carbon Check South Pole Carbon Asset Management 13-Dec-11 9-Aug-12 6-Dec-12 30-Dec-99 5 4 1 6 8 10 3 Envirofit USA 52.5 No N/A MSC 6.600 13.200 13.556 13.556 13.556 13.556 13.556 13.556 13.556 13.556 12.991

961CPA0185.02 5341-0002 Africa East Africa Kenya Many Envirofit International Registered EE households EE households Stoves AMS-II.G. 1 43.1 10 10 0.0 1-Jan-14 0.000 430.630 GLC 120.643 120.643 1 16-Oct-15 31-Dec-16 Carbon Check South Pole Carbon Asset Management 13-Dec-11 29-Oct-13 30-Dec-99 5 4 1 6 8 10 3 Envirofit USA No N/A MSC 28.515 43.063 43.063 43.063 43.063 43.063 43.063 43.063 43.063 29.097

962CPA0185.03 5341-0003 Africa East Africa Kenya Many Envirofit International Registered EE households EE households Stoves AMS-II.G. 1 42.8 10 21 0.0 1-Jan-14 0.000 428.110 GLC 34.501 34.501 6-Oct-17 31-Dec-16 South Pole Carbon Asset Management 13-Dec-11 6-Nov-13 30-Dec-99 5 4 1 6 8 10 3 Envirofit USA No N/A MSC 42.811 42.811 42.811 42.811 42.811 42.811 42.811 42.811 42.811

963CPA0185.04 5341-0004 Africa East Africa Kenya Many Envirofit International Registered EE households EE households Stoves AMS-II.G. 1 43.4 10 10 0.0 1-Apr-14 0.000 433.840 GLC 60.519 60.519 16-Oct-15 31-Dec-16 Carbon Check South Pole Carbon Asset Management 13-Dec-11 24-Mar-14 30-Dec-99 5 4 1 6 8 10 3 Envirofit USA No N/A MSC 32.538 43.384 43.384 43.384 43.384 43.384 43.384 43.384 43.384 43.384

964CPA0185.05 5341-0005 Africa East Africa Kenya Many Envirofit International Registered EE households EE households Stoves AMS-II.G. 1 31.1 10 10 0.0 6-Nov-17 0.000 311.130 GLC Carbon Check South Pole Carbon Asset Management 13-Dec-11 6-Nov-17 30-Dec-99 5 4 1 6 8 10 3 Envirofit USA No N/A MSC 6.906 43.460 43.460 43.460 43.460 43.460 43.460 43.460

965CPA0185.06 5341-0006 Africa East Africa Kenya Many Envirofit International Registered EE households EE households Stoves AMS-II.G. 1 31.1 10 10 0.0 6-Nov-17 0.000 311.130 GLC Carbon Check South Pole Carbon Asset Management 13-Dec-11 6-Nov-17 30-Dec-99 5 4 1 6 8 10 3 Envirofit USA No N/A MSC 6.906 43.460 43.460 43.460 43.460 43.460 43.460 43.460

966CPA0185.07 5341-0007 Africa East Africa Kenya Many Envirofit International Registered EE households EE households Stoves AMS-II.G. 1 31.1 10 10 0.0 6-Nov-17 0.000 311.130 GLC Carbon Check South Pole Carbon Asset Management 13-Dec-11 6-Nov-17 30-Dec-99 5 4 1 6 8 10 3 Envirofit USA No N/A MSC 6.906 43.460 43.460 43.460 43.460 43.460 43.460 43.460

967PoA0186 L5NM3ZT1NP8125Z00TJ5E6XNLZ3MIV 5342 African Improved Cooking Stoves Programme of Activities Africa West Africa Ghana Ghana, Nigeria Envirofit International Registered EE households EE households Stoves AMS-II.G. 6 240.1 13-Dec-11 28 0.645 2,370.399 GLC 0.458 210.719 211.177 1 8-Jul-15 24-Oct-16 Carbon Check South Pole Carbon Asset Management 13-Dec-11 4-May-12 6-Dec-12 6-Dec-12 PoA 30-Dec-99PoA 5 4 1 6 8 10 0.0

968CPA0186.01 5342-0001 Africa West Africa Ghana Many Envirofit International Registered EE households EE households Stoves 4000-5000 ICS AMS-II.G. 1 15.5 7 21 0.0 15-Dec-12 0.645 124.579 GLC 0.458 56.282 56.740 1 8-Jul-15 24-Oct-16 Carbon Check South Pole Carbon Asset Management 13-Dec-11 6-Dec-12 30-Dec-99 5 4 1 6 8 10 3 Envirofit USA 52.0 No N/A MSC 5.515 11.030 15.477 15.477 15.477 15.477 15.477 15.477 15.477 15.477 14.832

969CPA0186.02 5342-0002 Africa West Africa Ghana Ghana Entire country Envirofit International Registered EE households EE households Stoves AMS-II.G. 1 47.0 10 21 0.0 1-Nov-13 0.000 470.080 GLC 0.000 47.008 47.008 8-Sep-17 24-Oct-16 South Pole Carbon Asset Management 13-Dec-11 21-Oct-13 CPA 30-Dec-99 5 4 1 6 8 10 No N/A MSC 47.008 47.008 47.008 47.008 47.008 47.008 47.008 47.008 47.008 47.008

970CPA0186.03 5342-0003 African Improved Cooking Stoves Programme of Activities CPA 00003 (Ghana) Africa West Africa Ghana Many Envirofit International Registered EE households EE households Stoves Distribution of 14607 ICS AMS-II.G. 1 47.0 10 21 0.0 1-Dec-13 0.000 470.080 GLC 0.000 65.345 65.345 8-Jul-15 24-Oct-16 Carbon Check South Pole Carbon Asset Management 13-Dec-11 8-Nov-13 30-Dec-99 5 4 1 6 8 10 0 Envirofit No N/A MSC 47.008 47.008 47.008 47.008 47.008 47.008 47.008

971CPA0186.04 5342-0004 African Improved Cooking Stoves Programme of Activities CPA 00004 (Nigeria) Africa West Africa Nigeria Entire country Envirofit International Registered EE households EE households Stoves Distribution of 13,658 stoves AMS-II.G. 1 44.2 10 10 0.0 25-Oct-14 441.590 GLC 5.016 5.016 5-Oct-17 24-Oct-17 South Pole Carbon Asset Management 13-Dec-11 9-May-12 23-Sep-14 30-Dec-99 5 4 1 6 8 10 0 Envirofit No N/A MSC 44.159 44.159 44.159 44.159 44.159 44.159 44.159 44.159 44.159 44.159

972CPA0186.05 5342-0005 African Improved Cooking Stoves Programme of Activities CPA 00005 (Nigeria) Africa West Africa Nigeria Entire country Envirofit International Registered EE households EE households Stoves Distribution of 14,268 stoves AMS-II.G. 1 44.2 10 10 0.0 25-Oct-14 441.590 GLC 37.068 37.068 5-Oct-17 24-Oct-17 South Pole Carbon Asset Management 13-Dec-11 23-Sep-14 30-Dec-99 5 4 1 6 8 10 0 Envirofit No N/A MSC 44.159 44.159 44.159 44.159 44.159 44.159 44.159 44.159 44.159 44.159

973CPA0186.06 5342-0006 Africa West Africa Liberia Entire country Envirofit International Registered EE households EE households Stoves Distribution of 15,000 stoves AMS-II.G. 1 42.2 10 7 0.0 31-Dec-14 422.480 GLC 0.000 South Pole Carbon Asset Management 13-Dec-11 13-May-13 31-Dec-14 30-Dec-99 5 4 1 6 8 10 0 Envirofit No N/A MSC 35.603 42.987 42.987 42.987 42.987 42.987 42.987 42.987 42.987 42.987

974PoA0187 MTFUUH9BLDEOKWUHPT76DTBR1I4Y63 8866 BWC Sustainable Landfill Gas Recovery Programme of Activities in Indonesia Asia & Pacific Southeast Asia Indonesia Indonesia PT Blue World Indonesia Registered Landfill gas Landfill gas Biogas from MSW ACM1 1 11.6 1-Sep-12 28 0.000 115.910 KBS 0.000 Netherlands (Blue World Carbon) Blue World Carbon 15-Dec-11 14-May-12 31-Dec-12 28-Jun-13 31-Dec-12 CPA 31-Dec-99CPA 1 6 9 5 0.6

975CPA0187.01 8866-0001 CPA B11001- Bagendung Landfill Gas Recovery Asia & Pacific Southeast Asia Indonesia Banten PT Blue World Indonesia Registered Landfill gas Landfill gas Biogas from MSW ACM1 1 11.6 10 15 0.1 1-Mar-13 0.000 115.910 KBS Netherlands (Blue World Carbon) Blue World Carbon 15-Dec-11 31-Dec-12 30-Dec-99 1 6 9 5 0 0.6 2323 0.725 No Investment 4 8.280 11.590 12.304 13.014 13.714 12.870 12.084 11.352 10.669 10.033 1.573

976PoA0188 FBQKWUL5BW73RGH7P1AVVPT3XVEQO0 6600 Asia & Pacific Southeast Asia Singapore Singapore Climate Resources Exchange Rejected EE service EE service EE commercial buildings AMS-II.C. 1 1.0 5-Aug-12 28 0.425 10.210 BV Cert 0.000 United K. (Standard Bank) Climate Resources Exchange 15-Dec-11 CPA0090.01 20-Sep-10 2-Oct-12 30-Nov-12 CPA 30-Dec-99PoA 5 9 0.0

977CPA0188.01 6600-0001 Asia & Pacific Southeast Asia Singapore Climate Resources Exchange Rejected EE service EE service EE commercial buildings AMS-II.C. 1 1.0 10 10 0.0 5-Aug-12 0.425 10.210 BV Cert United K. (Standard Bank) Climate Resources Exchange 15-Dec-11 PoA0090 2 30-Dec-99 5 9 7 0 0.451 No Prevailing practice 0.959 0.959 0.959 0.959 0.959 0.959 0.959 0.959 0.959 0.959

978PoA0189 FINZ0M5OXUBITQ36TKD1R3SRGKAMTM 6285 Chilean Small Hydroelectric Power Plants Programme of Activities Latin America South America Chile Registered Hydro Hydro Run of river AMS-I.D. 1 6.0 17-May-11 28 0.000 47.920 TÜV-SÜD 0.000 n.a. Bridge Builders 15-Dec-11 PoA0116 20-Apr-12 25-Jul-12 4-Sep-12 25-Jul-12 CPA 31-Dec-99CPA 4 2.0 MSC

979CPA0189.01 6285-0001 Las Flores Hydroelectric Project Latin America South America Chile Region XIV Registered Hydro Hydro Run of river AMS-I.D. 1 6.0 7 30 0.3 1-Jan-13 0.000 47.920 TÜV-SÜD n.a. Bridge Builders 15-Dec-11 CPA0116.01 25-Jul-12 30-Dec-99 4 0 2.0 10189 0.588 No Financial;Investment MSC 3 5.148 5.406 5.676 5.960 6.258 6.571 6.899

980PoA0190 8EHWNWHL0GPNASGNA9TLIH7ANA833Q Asia & Pacific East Asia China Zhejiang energy group At Validation EE supply side EE supply side Higher efficiency coal power AM62 1 55.6 1-Feb-12 28 27.979 556.240 BV Cert 0.000 Finland (GreenStream Network) China Carbon Technology 15-Dec-11 CPA 31-Dec-99PoA 1 5 0.0

981CPA0190.01 Asia & Pacific East Asia China Zhejiang Zhejiang energy group At Validation EE supply side EE supply side Higher efficiency coal power AM62 1 55.6 10 30 0.0 1-Jul-12 27.979 556.240 BV Cert Finland (GreenStream Network) China Carbon Technology 15-Dec-11 30-Dec-99 1 5 0 0.749 No N/A MSC 3 27.812 55.624 55.624 55.624 55.624 55.624 55.624 55.624 55.624 55.624 27.812

982PoA0191 1K5A8PDKVGVB8N7OTD4KF201903Y6M 9354 Promotion of POME and EFB Co-Composting in Colombia and Ecuador Latin America South America Ecuador Colombia Ecuador, Colombia Registered Methane avoidance Methane avoidance Palm oil waste AMS-III.F.+AMS-III.H. 1 14.2 20-Dec-11 28 0.000 115.136 AENOR 0.000 n.a. Gestora de Programa Marco Palma 20-Dec-11 20-Aug-12 28-Dec-12 25-Sep-13 13-Jun-13 CPA 30-Dec-99CPA 1 2 6 5 9 0.0

983CPA0191.01 9354-0001 Latin America South America Ecuador Esmeraldas Registered Methane avoidance Methane avoidance Palm oil waste AMS-III.F.+AMS-III.H. 1 14.2 7 25 0.3 1-Dec-12 115.136 AENOR n.a. Gestora de Programa Marco Palma 20-Dec-11 13-Jun-13 30-Dec-99 1 2 6 5 9 0 No Investment 4 3.243 13.169 13.952 14.540 14.540 14.540 14.540 10.905

984PoA0192 0DS5NLHJ5XXBHRNNGH0V1XH5JB80V8 7897 LED‘s save energy Asia & Pacific Southern Asia India India Mabanaft Carbon India Registered EE service EE service Lighting in service AMS-II.C. 1 6.3 1-Dec-12 28 0.521 62.580 SQS 0.000 Netherlands (Mabanaft+Do-inc.), Germany (Carbonbay) Do-inc. 20-Dec-11 PoA0099 15-Sep-11 30-Oct-12 5-Jan-13 30-Oct-12 PoA 30-Dec-99PoA 2 4 5 7 0.0

985CPA0192.01 7897-0001 LED’s save energy – CPA-001 Asia & Pacific Southern Asia India Many Mabanaft Carbon India Registered EE service EE service Lighting in service AMS-II.C. 1 6.3 10 10 6.9 1-Dec-12 0.521 62.580 SQS Netherlands (Mabanaft+Do-inc.), Germany (Carbonbay) Do-inc. 20-Dec-11 CPA0099.01 30-Oct-12 30-Dec-99 2 4 5 7 0 0.903 No 15.571 46.712 77.854 77.854 77.854 77.854 77.854 77.854 77.854 77.854

986PoA0193 AUF862OKSITP28IH3KRH5HNKAWTSEO 6819 TBEC Biogas Programme for South East Asia Asia & Pacific Southeast Asia Thailand Thailand Thai Biogas Energy Company Registered Methane avoidance Methane avoidance Waste water ACM14 1 21.3 15-Sep-12 28 0.000 155.308 GLC 0.000 n.a. Carbon Bridge 21-Dec-11 26-Jul-12 3-Sep-12 13-Dec-12 5-Sep-12 CPA 30-Dec-99Both 1 3 5 7 9 11 1.4

987CPA0193.01 6819-0001 TBEC Biogas Programme for South East Asia CPA#0001 BSW Asia & Pacific Southeast Asia Thailand Thailand Thai Biogas Energy Company Registered Methane avoidance Methane avoidance Waste water ACM14 1 21.3 7 25 0.0 15-Sep-13 0.000 155.308 GLC n.a. Carbon Bridge 21-Dec-11 5-Sep-12 30-Dec-99 1 3 5 7 9 11 0 1.4 5723 0.598 No Technological 3 23.588 23.588 23.588 23.588 23.588 23.588 23.588

988PoA0194 XXS38QZ6Z30SU0TJ4LQEYCBJJDLFY2 BWC Sustainable Mini Hydropower Programme of Activities in Indonesia Asia & Pacific Southeast Asia Indonesia Indonesia PT Blue World Indonesia Validation Terminated Hydro Hydro Run of river AMS-I.D. 1 25.4 1-Jun-12 28 25.307 228.517 TÜV-Rhein 0.000 Netherlands (Blue World Carbon) Blue World Carbon 22-Dec-11 CPA 30-Dec-99CPA 5 10 9 7 8 6.0

989CPA0194.01 CPA 1.1 – Karai 12 Hydroelectric power plant Asia & Pacific Southeast Asia Indonesia North Sumatra PT Blue World Indonesia Validation Terminated Hydro Hydro Run of river 2 x 3 MW run of river hydro plant AMS-I.D. 1 25.4 7 20 0.0 2-Jan-12 25.307 228.517 TÜV-Rhein Netherlands (Blue World Carbon) Blue World Carbon 22-Dec-11 30-Dec-99 5 10 9 7 8 0 6.0 34164 0.743 No Investment 3 25.383 25.383 25.383 25.383 25.383 25.383 25.383

990PoA0195 RMXE213I5N3S1RTNOLVMX8XXAPNWEB 6622 Inti Renewable Energy Program of Activities Latin America South America Peru Peru Energia Limpia S.A.C. Registered Hydro Hydro Run of river ACM2 1 90.0 19-Oct-11 28 0.000 540.235 AENOR 0.000 n.a. Endesa 22-Dec-11 29-Feb-12 6-Jul-12 13-Sep-12 13-Jul-12 CPA 30-Dec-99CPA 9 8 10 11 19.8

BioLite India Private Limited  Distribution of domestic fuel e fficient cook stoves

Financial ;Investment;Prevai ling practice;Technological

BioL ite India Private Limited  Distribution of domestic fuel e fficient cook stoves

Financial ;Investment;Prevai ling practice;Technological

BioL ite India Private Limited  Distribution of domestic fuel e fficient cook stoves

Financial ;Investment;Prevai ling practice;Technological

BioL ite India Private Limited  Distribution of domestic fuel e fficient cook stoves

Financial ;Investment;Prevai ling practice;Technological

BioL ite India Private Limited  Distribution of domestic fuel e fficient cook stoves

Financial ;Investment;Prevai ling practice;Technological

BioL ite India Private Limited  Distribution of domestic fuel e fficient cook stoves

BioLite India Private Limited  Distribution of domestic fuel e fficient cook stoves

BioLite India Private Limited  Distribution of domestic fuel e fficient cook stoves

Dominican Republ ic, Guatemala

Dominican Republ ic, Guatemala, Nicaragua

To more performing and sustainablewastewater treatment systems for industries in Latin America and the Caribbean

Biodigestion wastewater treatment system with methane recovery and combustion

AquaLimpia Consultores7

Junenghui li Carbon Asset Management

To reduce GHG emission by destroying methane conta ined in Ventila tion Air Methane(VAM) emitted from coal mines in China

Yongcheng Xuehu Coal Mine Ventila tion Air Methane Recovery and Util ization Project

Junenghui li Carbon Asset Management

Destruction of methane by oxidation in the VAM oxid izers and replacement of electricity from the CCPG

Investment;Prevailing practice

Benchmark analysis

To contribute to the sustainable development of South Africa, to reduce Greenhouse Gas (GHG) emissions and adverse environmental e ffec ts of landfill gas and to increase the use of renewable energy sources in South A frica

Capture & flaring of landfi ll gas, in phase two electricity production

Benchmark analysis

Zhongruihe International New Energy Science and Technology (Beij ing)

To establ ish a sustainable livestock waste management model that would significantly improve rural environment and reduce greenhouse gas emissions

AMS-III.D.+AMS-I.C.+AMS-I.D.+AMS-I.F.

Uni ted K. (A&T Carbon Asset Co.), France (EDF Trading)

Animal Manure Treatment Programme in Henan Province and Shaanxi Province--CPA-0001

Zhongruihe International New Energy Science and Technology (Beij ing)

Biogas digester wi th uti lization of methane for electricity production

AMS-III.D.+AMS-I.C.+AMS-I.D.+AMS-I.F.

Uni ted K. (A&T Carbon Asset Co.), France (EDF Trading)

Benchmark analysis

Promotion Programme for Smal l Hydropower Development in Rural Areas in China

Hangzhou Nannan Hydropower Development Co.

To apply carbon finance for small hydropower pro jects in rura l areas

Hangzhou Nannan Hydropower Development Co.

Hangzhou Nannan Hydropower Development Co.

Hangzhou Nannan Hydropower Development Co.

Benchmark analysis

Programme for the Capture and Destruction or Utilization of Landfi ll Gas in Colombia

To decrease methane emissions to the atmosphere and to contribute to sustainable development through util ization of landfi ll gas

Benchmark analysis

To increase the supply of renewable energy to the South African national grid from renewable wind energy resources on a commercial ly sustainable basis

Benchmark analysis

Côte d’ Ivo ire, Cameroon

To reduce CO2 emissions by disseminating efficient cookstoves throughout Côte d’ Ivo ire and Cameroon

Dissemination of 10,143 energy efficient cook stoves

Investment;Prevailing practice

To encourage development of small sca le grid-connected so lar photovoltaic and solar thermal electricity technologies

5.94 MW Solar PV power plant with 220 W modules

To reduce CO2 emissions by disseminating efficient cookstoves throughout Democratic Republ ic of the Congo (DRC)

Investment;Prevailing practice

To increase access to modern energy servic es in Tanzania

A 10.71 MW run-of-the-river hydroelectric power plantInstallation of a 3MW Solar PV power plantA 1.12 MW run-of-the-river hydroelectric power plant which will be insta lled in 2 phases of 560 kW each

A 7.5 MW hydro-electric power plant [(2 x 2 .5 MW) in phase 1 and additional 2 .5 MW in phase 2]

The CPA involves the installation of a 2.4 MW power generation capac ity.

The CPA consists o f a biomass power plant with the total insta lled capacity of 2.5 MWA mini hydropower p lant wi th ageneration capacity of 80 kW, second phase a second turbine wi th additional 350 kW

Run-of-the-river hydroelectric power plant with a generation of 1,470 MWh annually

In frastructure Development Company L imited

To accelerate dissemination of b iogas application in rural Bangladesh using micro-creditscheme

Infrastructure Development Company L imited

Micro-type b iogas digesters (typica lly, biogas generationcapacity of 2 .4–4.8 m3/day) and supply biogas for households in rura l Bangladesh

PoA for the Reduction of emission from non-renewable fuel from cooking at household leve l

Angola, Bangladesh, Congo, Eth iop ia, Guinea-Bissau, Kenya, Cambodia, Lao, Liberia, Mali, Myanmar, Malawi , Mozambique, Niger, Nigeria , Nepal , Sudan, Sierra

Angola, Bangladesh, Congo, Ethiopia, Guinea-Bissau, Kenya, Cambodia, Lao, Liberia, Madagascar, Mali, Myanmar, Malawi , Mozambique,

To reduce emissions from household cooking stoves.

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Antananarivo Renivohitra

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits,

Antani fo tsy, Ambatolampy

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, Toamasina 2,

Brickavi lle , Vatomandry, Mahanoro

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, Moramanga,

Anosibe AnalaEthanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Lalangina, Isandra, Vohibato, Ika lamavony

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Antananarivo Avaradrano

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Antananarivo Atsimondrano

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Antananarivo Renivohitra

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Antananarivo Renivohitra

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Antananarivo Renivohitra

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Antananarivo Renivohitra

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Antananarivo Renivohitra

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Ganze, Bahari, Kalo len i ,Rabai

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Mvita, L ikoni, Kisauni, Changamwe

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Matuga, Kinango, Msabweni

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Lamu, Tana River, Ta ita Taveta

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Kisumu West, Kisumu Central , Kisumu East, Seme, Nyando, Muhoroni , Nyakach

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Boane, Magude, Manhiça, Marracuene, Moamba, Namaacha, Matutuine

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Antananarivo, Antsirabe, Miandivazo

Replace non-renewable fuel with renewable fue l for 30,000 household cooking

Antananarivo, Antsirabe, Miandivazo

Replace non-renewable fuel with renewable fue l for 30,000 household cooking

Antananarivo, Antsirabe, Miandivazo

Replace non-renewable fuel with renewable fue l for 30,000 household cooking

Antananarivo, Antsirabe, Miandivazo

Replace non-renewable fuel with renewable fue l for 30,000 household cookingReplace non-renewable fuel with renewable fue l in in itial ly 2000 householdsReplace non-renewable fuel with renewable fue l in in itial ly 10,000 householdsReplace non-renewable fuel with renewable fue l in in itial ly 10,000 households

Kenya, South Africa

To enable the large-scale distribution of high efficiency biomass cook stoves in several Sub-Saharan African countries

Ethanol stoves wi th a ra ted thermal capacity of 1 .5 Kw, biogas stoves with a rated thermal capacity of 2 .8 Kw, household water puri fying kits, community water purification system

Uni ted K. (Envi rofit International ), Sweden (Government of Sweden)

Improved Cooking S toves Programme of Activi ties in Africa – CPA No. 00001 (Kenya)

CH2200 efficient stoves wi th average thermal efficiency of 38.2%

Uni ted K. (Envi rofit International ), Sweden (Government of Sweden)

Simple cost analysis

Improved Cooking S toves Programme of Activi ties in Africa – CPA No. 00002 (Kenya)

6000 Improved Cooking Stoves dispersed throughout the country

Improved Cooking S toves Programme of Activi ties in Africa – CPA No. 00003 (Kenya)

Distributing 16000 Improved cook stoves (ICS)

Improved Cooking S toves Programme of Activi ties in Africa – CPA No. 00004 (Kenya)

Distributing 17500 Improved cook stoves (ICS)

Uni ted K. (Envi rofit International ), Sweden (Government of Sweden)

Improved Cooking S toves Programme of Activi ties in Africa – CPA No. 00005 (Kenya)

Distributing 17500 Improved cook stoves (ICS)

Uni ted K. (Envi rofit International ), Sweden (Government of Sweden)

Improved Cooking S toves Programme of Activi ties in Africa – CPA No. 00006 (Kenya)

Distributing 17500 Improved cook stoves (ICS)

Uni ted K. (Envi rofit International ), Sweden (Government of Sweden)

Improved Cooking S toves Programme of Activi ties in Africa – CPA No. 00007 (Kenya)

Distributing 17500 Improved cook stoves (ICS)

Uni ted K. (Envi rofit International ), Sweden (Government of Sweden)

To enable the large-scale distribution of high efficiency biomass cook stoves in several Sub-Saharan African countries.

Uni ted K. (Envi rofit International ), Sweden (Government of Sweden)

African Improved Cooking Stoves Programme of Activities – CPA No. 00001 (Ghana)

Uni ted K. (Envi rofit International ), Sweden (Government of Sweden)

Simple cost analysis

African Improved Cooking Stoves Programme of Activities – CPA No. 00002 (Ghana)

Distribution of 17292 improved cook stoves (ICS)

Uni ted K. (Envi rofit International ), Sweden (Government of Sweden)

African Improved Cooking Stoves Programme of Activities – CPA 00006 (Liberia)

To intensify investment in the MSW management sector by promoting sustainable landfil l gas recovery practices for new or existing landfi lls

A landfill gas recovery project wi th 600 kW insta lled electricity generation capacity

Benchmark analysis

Cl imate Action Response Enterprise (CARE) for Energy Efficiency in Chiller Plants.

To promote Energy Efficiency in Singapore’s building sector byreplacing inefficient Chiller Plants wi th those of a more efficient design and technology

Energy Efficiency in Chi ller Plant at the CAPRICORN Bui lding located at 1 Science Park Road, The Capricorn, Singapore Science Park II, Singapore 117528 (CAPRICORN CPA)

The CAPRICORN at 1 Science Park Road Science Park II

Upgrading the existing a ir-cooled chil ler plant and enhance i ts e fficiencyto a energy efficient coefficient of 0.59KW/TR

Regions II to X, Region XIV and the Metropolitan Region

Asociación Gremial de Pequeñas y Medianas Centra les Hidroeléctricas

To promote Non-Conventional Renewable Energy (NCRE) generation in Chi le inthe form of small hydro plants

Asociación Gremial de Pequeñas y Medianas Centra les Hidroeléctricas

Run of river hydroplant o f 2 MW, one Pel ton turbine

Benchmark analysis

ZEG coal-fired power p lant's low-efficiency steam turb ine retro fi t CDM programme

Jiangsu, Zhej iang, Anhui, Fuj ian, Shanghai

To retrofit the basel ine steam turbines by using the current advanced steamturbine retrofit technology in the existing ZE G coal-fired power p lants

CPA-01 of ZEG coal -fi red power plant’s low-efficiency steam turbine retrofit CDM programme

300MW sub-critica l coal -fi red power un it’s low-efficiency steam turb ine retrofit

Benchmark analysis

Gestora de Programa Marco Palma

To reduce the pol lution potential o f EFB and POME by implementing an aerobiccomposting process of these two palm oi l mill waste streams

Promotion of POME and EFB Co/Composting in Colombia and Ecuador San Patricio POME and EFB Co/Composting Pro ject (CPA Number 001)

Gestora de Programa Marco Palma

Aerobic composting process of EFB and POME

Investment comparison analysis

To abate greenhouse gas emissions through the avoided use of electricityand corresponding fossi l fuel combustion

Distribution and installation of LE D lighting equipment

Prevai ling practice;Technological

To reduce greenhouse gas emissions from industria l wastewater treatmentand promote the consumption of renewable energy by using biogas generated from wastewater treatment

An anaerobic wastewater treatment system including methanerecovery, flaring system and methane utilization for e lectrici ty generation

Benchmark analysis

To develop a p latform for overcoming insti tu tional, financial and structural hurdles for the construction of smal l hydropower pro jects

Benchmark analysis

To encourage the wide scale adoption of small hydro power p lants, grid-connectedrenewable energy projects.

991CPA0195.01 6622-0001 Vilcanota II Hydropower Plant - Inti PoA CPA# 1 Latin America South America Peru Cusco Energia Limpia S.A.C. Registered Hydro Hydro Run of river Newly built 19.8 MW hydro power plant ACM2 1 90.0 7 40 0.0 1-Jan-15 0.000 540.235 AENOR n.a. Endesa 22-Dec-11 13-Jul-12 30-Dec-99 9 8 10 11 0 19.8 136489 0.657 No 3 89.639 89.639 89.639 89.639 89.639 89.639 89.639

992PoA0196 0NCQZ02Z76K6AOWLOE8ZOXNHW9FF0A CarbonSoft Open Source PoA, LED Lighting Distribution: Oceania Asia & Pacific Southeast Asia Indonesia Validation Terminated Solar EE households Solar lamps AMS-III.AR. 1 44.2 22-Dec-11 28 40.427 394.137 Carbon Check 0.000 United K. (Standard Bank) CarbonSoft 23-Dec-11 CPA 30-Dec-99CPA 1 6 9 5 8 11 0.0

993CPA0196.01 CarbonSoft Oceania CPA01 Asia & Pacific Southeast Asia Indonesia Sumatra Validation Terminated Solar EE households Solar lamps LED lamps AMS-III.AR. 1 44.2 7 28 5.7 1-Feb-12 40.427 394.137 Carbon Check United K. (Standard Bank) CarbonSoft 23-Dec-11 30-Dec-99 1 6 9 5 8 11 1 Illumination No 20.236 42.495 44.619 46.850 49.193 51.653 54.235

994PoA0197 ISDXOTZM941SFMINYZPODCDX70SUEK 7889 CarbonSoft Open Source PoA, LED Lighting Distribution: Emerging Markets Asia & Pacific Southern Asia India CarbonSoft Registered Solar EE households Solar lamps AMS-III.AR. 1 4.0 2-Aug-12 28 0.000 31.842 Carbon Check 0.000 n.a. CarbonSoft 23-Dec-11 12-Oct-12 24-Dec-12 22-Mar-13 24-Dec-12 CPA 30-Dec-99CPA 1 6 9 5 8 11 0.0 Plist

995CPA0197.01 7889-0001 CarbonSoft Emerging Markets CPA01 Asia & Pacific Southern Asia India CarbonSoft Registered Solar EE households Solar lamps AMS-III.AR. 1 4.0 7 28 3.8 24-Dec-12 0.000 31.842 Carbon Check n.a. CarbonSoft 23-Dec-11 24-Dec-12 30-Dec-99 1 6 9 5 8 11 1 Nokero USA No Plist 14.000 24.000 24.000 24.000 24.000 24.000 24.000 24.000

996PoA0198 1GOKB2OVPQBZNE60GS0VQTQRW2RIEC 7484 Small-scale solar electrical programme, South Africa Africa Southern Africa South Africa South Africa Blue World Carbon Registered Solar Solar Solar PV AMS-I.D.+AMS-I.F. 1 15.0 1-Aug-12 28 0.000 121.699 Carbon Check 0.000 n.a. Blue World Carbon 23-Dec-11 8-Aug-12 16-Nov-12 29-Mar-13 26-Nov-12 PoA 31-Dec-99PoA 5 1 7.5 Plist

997CPA0198.01 7484-0001 Small-scale solar electrical programme, South Africa – CPA-001 Africa Southern Africa South Africa KwaZulu-Natal Blue World Carbon Registered Solar Solar Solar PV AMS-I.D.+AMS-I.F. 1 15.0 7 30 4.0 26-Nov-12 0.000 121.699 Carbon Check n.a. Blue World Carbon 23-Dec-11 26-Nov-12 30-Dec-99 1 6 0 7.5 11826 0.988 No Plist 2.338 7.009 11.684 16.357 21.030 23.368 23.368

998PoA0199 PA1HQD9B7ABR4DKIHCZMSZIPGWCOZG 7734 SimGas Biogas Programme of Activities Africa East Africa Kenya Kenya SimGas BV Registered Methane avoidance Methane avoidance Domestic manure 1 45.2 24-Dec-11 28 0.000 367.310 AENOR 0.000 Climate Focus 24-Dec-11 25-Jun-12 16-Oct-12 6-Mar-13 21-Dec-12 CPA 30-Dec-99CPA 4 2 1 6 9 7 0.0 Yes

999CPA0199.01 7734-0001 SimGas Biogas Programme of Activities, Kenya (CPA KE1) Africa East Africa Kenya Many SimGas BV Registered Methane avoidance Methane avoidance Domestic manure 1 45.2 7 21 0.0 14-Nov-12 0.000 367.310 AENOR Climate Focus 24-Dec-11 21-Dec-12 30-Dec-99 4 2 1 6 9 7 0 No N/A MSC Yes 24.315 48.629 48.629 48.629 48.629 48.629 48.629

1000PoA0200 DAR84YC0483E2MLC0LW793AJSWNQ5Z 6813 Biogas Programme Nicaragua (PBN) Latin America Central America Nicaragua Nicaragua ProBioGas Nicaragua S.C.P. Registered Methane avoidance Methane avoidance Domestic manure AMS-III.R.+AMS-I.E. 1 10.0 27-Dec-11 28 3.338 83.490 AENOR 0.000 Netherlands (Hivos) Climate Focus 27-Dec-11 18-Apr-12 24-Jul-12 25-Jul-12 CPA 30-Dec-99CPA Gold Standard 1 6 4 9 8 2 0.0

1001CPA0200.01 6813-0001 CPA 1: Biogas Programme Nicaragua (PBN) Latin America Central America Nicaragua ProBioGas Nicaragua S.C.P. Registered Methane avoidance Methane avoidance Domestic manure Biogas systems in small diary farms AMS-III.R.+AMS-I.E. 1 10.0 7 21 1.9 1-Sep-12 3.338 83.490 AENOR Netherlands (Hivos) Climate Focus 27-Dec-11 25-Jul-12 30-Dec-99 1 6 4 9 8 2 0 No N/A MSC 1.748 5.826 13.108 13.108 13.108 13.108 13.108

1002PoA0201 RGYSWPL82UWLZC4S5YGQS5BHIPSUFE 7274 Tepeu Wind Programme of Activities Latin America Central America Nicaragua Peru Nicaragua and Peru EcoRessources Carbono Registered Wind Wind Wind ACM2 1 109.5 20-Dec-12 28 0.000 849.856 GLC 0.000 Netherlands (Mabanaft), Germany (Carbonbay) EcoRessources Carbono 28-Dec-11 1-Feb-12 18-Dec-12 25-Mar-13 2 CPA 31-Dec-99CPA 5 9 12 10 11 39.6

1003CPA0201.01 7274-0001 Alba Rivas, Wind Power Plant – Tepeu PoA CPA # 1 Latin America Central America Nicaragua EcoRessources Carbono Registered Wind Wind Wind 22 1,800 kW wind turbines ACM2 1 109.5 7 20 0.0 31-Mar-13 0.000 849.856 GLC Netherlands (Mabanaft), Germany (Carbonbay) EcoRessources Carbono 28-Dec-11 25-Mar-132 30-Dec-99 5 9 12 10 11 1 Vestas Denmark 39.6 158242 0.692 No 3 80.531 107.375 107.375 107.375 107.375 107.375 107.375

1004PoA0202 GQP47MJA61VINYYCATKCPHOZJI41RF 9744 Africa Southern Africa South Africa South Africa Farmsecure Carbon Withdrawn Biomass energy Biomass energy Gasification of biomass 1 62.3 1-Oct-12 28 0.000 483.232 SGS 0.000 n.a. Farmsecure Carbon 29-Dec-11 CPA 30-Dec-99CPA 5 9 11 7 10.5

1005CPA0202.01 9744-0001 Africa Southern Africa South Africa Mpumalanga Farmsecure Carbon Withdrawn Biomass energy Biomass energy Gasification of biomass 1 62.3 7 25 3.3 1-Apr-13 0.000 483.232 SGS n.a. Farmsecure Carbon 29-Dec-11 30-Dec-99 5 9 11 7 -2 10.5 76669 1.017 Yes Investment 3 58.480 77.973 77.973 77.973 77.973 77.973 77.973

1006PoA0203 I8ZG0M087B7Y0FW84S34XM1SG27O7N 8025 Asia & Pacific East Asia China Registered Methane avoidance Methane avoidance Manure AMS-III.D. 1 4.2 1-Sep-12 28 2.011 35.157 CEC 0.000 United K. (A&T Carbon Asset Co.) A&T Carbon Asset CO. 31-Dec-11 1-Aug-12 15-Nov-13 18-Jan-14 15-Nov-13 CPA 30-Dec-99PoA 5 6 8 9 11 0.0

1007CPA0203.01 8025-0001 Asia & Pacific East Asia China Shanxi Registered Methane avoidance Methane avoidance Manure AMS-III.D. 1 4.2 7 15 0.0 1-Sep-12 2.011 35.157 CEC United K. (A&T Carbon Asset Co.) A&T Carbon Asset Co. 31-Dec-11 15-Nov-13 30-Dec-99 5 6 8 9 11 -1 0.811 No Investment 3 2.002 6.040 6.040 6.040 6.040 6.040 6.040 4.038

1008PoA0204 DWICCW8YVLP4JQ3WEJJDCMM3L9Y5WR 7959 EN BADEN Large-Scale Hydro PoA in Peru Latin America South America Peru Peru Carbon BW Peru S.A.C Registered Hydro Hydro Run of river ACM2 1 36.2 14-Nov-12 28 0.000 217.431 SQS 0.000 n.a. Perspectives 6-Jan-12 10-Apr-12 9-Nov-12 19-Dec-12 14-Nov-12 CPA 30-Dec-99CPA 5 8 9 8.4

1009CPA0204.01 7959-0001 El Carmen Hydropower Project Latin America South America Peru Huanuco Carbon BW Peru S.A.C Registered Hydro Hydro Run of river 8.4 MW run-of river hydropower project ACM2 1 36.2 7 40 0.0 1-Jan-15 0.000 217.431 SQS n.a. Perspectives 6-Jan-12 14-Nov-12 30-Dec-99 5 8 9 12 0 8.4 55154 0.657 No Investment 3 36.222 36.222 36.222 36.222 36.222 36.222 36.222

1010PoA0205 HX1UYXTEJEN3EOPLZCZLK1LIDH09W5 Sustainable Promotion of East African Renewables (SPEAR) Africa East Africa Uganda Replaced At Validation Hybrid renewables Hybrid renewables Solar & wind & other ACM2+AMS-I.D. 1-Dec-11 28 Carbon Check n.a. Uganda Carbon Bureau 6-Jan-12 14-Jun-12 CPA 31-Dec-99CPA 4 5 9 10 7 8

1011CPA0205.01 Africa East Africa Uganda Western Replaced At Validation Hydro Hydro Run of river 1.18 MW run of river hydro plant ACM2+AMS-I.D. 1 4.8 7 21 0.0 1-Feb-12 4.392 42.819 Carbon Check n.a. Uganda Carbon Bureau 6-Jan-12 14-Jun-12 30-Dec-99 4 5 9 10 7 8 3 1.2 6750 0.710 No Other 2.400 4.800 4.800 4.800 4.800 4.800 2.400

1012PoA0206 XO06D7GKLCHEBCL3Y2UDNK9UN71TNN 7763 Wind Programme of Activities in Chile Latin America South America Chile All regions Registered Wind Wind Wind ACM2 1 19.0 9-Jan-12 28 0.000 139.351 BV Cert 0.000 n.a. Trie Projects 9-Jan-12 10-May-12 17-Oct-12 21-Dec-12 24-Oct-12 CPA 31-Dec-99CPA 4 9 9.0

1013CPA0206.01 7763-0001 Chome Wind Farm CPA #1 Latin America South America Chile Region VIII Registered Wind Wind Wind 5 wind turbines of 1.8 MW ACM2 1 19.0 7 20 0.0 2-Sep-13 139.351 BV Cert n.a. Trie Projects 9-Jan-12 24-Oct-12 30-Dec-99 4 9 1 Vestas Denmark 9.0 26400 0.720 No 3 19.000 19.000 19.000 19.000 19.000 19.000 19.000

1014PoA0207 A3YXATPTE2VKV38UIR1LWA3D55C8GQ Africa Southern Africa Gabon ENERCAP SAS Validation Terminated Solar EE households Solar lamps AMS-III.AR. 1 60.0 4-Jan-12 28 59.100 539.836 BV Cert 0.000 n.a. Enercap 9-Jan-12 CPA 30-Dec-99CPA 1 6 9 8 7 0.0

1015CPA0207.01 ENERCAP SunLighting™ Africa – Gabon Africa Central Africa Gabon Gabon ENERCAP SAS Validation Terminated Solar EE households Solar lamps PV LED systems AMS-III.AR. 1 60.0 7 28 0.0 4-Jan-12 59.100 539.836 BV Cert n.a. Enercap 9-Jan-12 30-Dec-99 1 6 9 8 7 0 No 60.000 60.000 60.000 60.000 60.000 60.000 60.000

1016PoA0208 FQRIZ8IQCR39FNV7VSBITCIN56AG60 3143 Livestock Farms Methane Engineering Programme in Jiangxi Province Asia & Pacific East Asia China Jiangxi Registered Methane avoidance Methane avoidance Manure AMS-III.D.+AMS-I.C. 1 1.6 15-Nov-12 28 0.000 12.700 TÜV-Nord 0.000 United K. (Innovative Carbon Investment) 10-Jan-12 1-Feb-12 19-Nov-12 11-Jan-13 19-Nov-12 CPA 31-Dec-99PoA 5 6 1 9 8 0.0 MSC

1017CPA0208.01 3143-0001 Livestock Farms Methane Engineering Programme in Jiangxi Province--CPA-TP Asia & Pacific East Asia China Yingtan City Registered Methane avoidance Methane avoidance Manure AMS-III.D.+AMS-I.C. 1 1.6 7 15 0.0 1-Jan-13 0.000 12.700 TÜV-Nord United K. (Innovative Carbon Investment) 10-Jan-12 19-Nov-12 30-Dec-99 5 6 1 9 8 -1 0.724 No Investment MSC 3 1.636 1.636 1.636 1.636 1.636 1.636 1.636

1018PoA0209 9VNB0233X4M3MRGV0MMSZEII5DRTTJ 8426 India Small Scale Solar PV Programme of Activities Asia & Pacific Southern Asia India India Registered Solar Solar Solar PV AMS-I.D. 1 1.3 31-Dec-12 28 0.000 10.724 GLC 0.000 Netherlands (Mabanaft), Germany (Carbonbay) Perspectives 12-Jan-12 20-Nov-12 29-Nov-12 12-Jan-13 29-Nov-12 PoA 30-Dec-99CPA 10 9 1.0 MSC

1019CPA0209.01 8426-0001 Mabanaft 1MW Solar PV Project Asia & Pacific Southern Asia India Tamil Nadu Registered Solar Solar Solar PV AMS-I.D. 1 1.3 7 25 0.0 1-Jan-13 0.000 10.724 GLC Netherlands (Mabanaft), Germany (Carbonbay) Perspectives 12-Jan-12 29-Nov-12 30-Dec-99 10 9 0 1.0 1664 0.930 No Other MSC 1.573 1.573 1.573 1.573 1.573 1.573 1.573

1020PoA0210 38GJ54QF3R14KC75AXQBP6AI7QDRSL 9638 Congo (DRC) Improved Cook Stoves program Africa Central Africa Congo DR Congo DR WESD Capital Registered EE households EE households Stoves AMS-II.G. 1 36.2 1-Jul-12 28 22.512 307.667 TÜV-Rhein 0.000 Switzerland (Vitol) Ecosur Afrique 12-Jan-12 PoA0181 9-Mar-13 17-Oct-14 21-Nov-14 17-Oct-14 PoA 30-Dec-99CPA 1 6 9 8 5 0.0 Yes

1021CPA0210.01 9638-0001 Congo (DRC) Improved Cook Stoves CPA001 - Kimbanseke 1 Africa Central Africa Congo DR Kinshasa WESD Capital Registered EE households EE households Stoves AMS-II.G. 1 36.2 7 21 0.0 1-Jul-12 22.512 307.667 TÜV-Rhein Switzerland (Vitol) Ecosur Afrique 12-Jan-12 CPA0181.01 17-Oct-14 30-Dec-99 1 6 9 8 5 3 USA 179.8 No Yes 44.756 44.756 44.756 44.756 44.756 44.756 44.756

1022PoA0211 PNWBHK2YFR15YXVM3WRUUEICHEH90Y 8696 Côte d’Ivoire and Cameroon Efficient Cookstoves Program Africa West Africa Côte d'Ivoire Cameroon Envirofit International Registered EE households EE households Stoves AMS-II.G. 3 114.6 3-Dec-11 28 0.000 818.002 TÜV-Rhein 5.420 Sweden (Government of Sweden) Ecosur Afrique 12-Jan-12 12-Mar-12 12-Dec-12 19-Dec-12 PoA 30-Dec-99CPA 8 1 6 9 5 0.0 Plist Yes

1023CPA0211.01 8696-0001 Côte d’Ivoire and Cameroon Efficient Cookstoves Program CPA001 - Abobo 1 Africa West Africa Côte d'Ivoire Abidjan City Envirofit International Registered EE households EE households Stoves AMS-II.G. 1 46.7 7 21 0.0 1-Jul-13 0.000 350.690 TÜV-Rhein Sweden (Government of Sweden) Ecosur Afrique 12-Jan-12 19-Dec-12 30-Dec-99 8 1 6 9 5 3 USA No Plist 45.209 45.209 45.209 45.209 45.209 45.209 45.209

1024CPA0211.02 8696-0002 Côte d’Ivoire and Cameroon Efficient Cookstoves Program CPA002 – Abidjan Africa West Africa Côte d'Ivoire Abidjan City Envirofit International Registered EE households EE households Stoves AMS-II.G. 1 39.7 7 21 0.0 1-Feb-14 0.000 274.872 TÜV-Rhein Ecosur Afrique 12-Jan-12 16-Jan-14 30-Dec-99 8 1 6 9 5 3 USA No Plist 32.156 40.435 40.435 40.435 40.435 40.435 40.435 3.369

1025CPA0211.03 8696-0003 Africa West Africa Cameroon Entire country Envirofit International Registered EE households EE households Stoves AMS-II.G. 1 28.1 7 21 0.0 1-Mar-14 0.000 192.440 TÜV-Rhein 5.420 5.420 Ecosur Afrique 12-Jan-12 3-Mar-14 30-Dec-99 8 1 6 9 5 3 USA No Plist Yes 28.130 28.130 28.130 28.130 28.130 28.130 28.130

1026PoA0212 QVY49WRWFA6BPEJSNJFDGOR6GCR8DV 10116 Small Hydropower Programme in Colombia Latin America South America Colombia Colombia Pacific Power Generation Corp. Registered Hydro Hydro Run of river AMS-I.D. 1 24.8 17-Jan-12 28 0.000 247.910 KBS 0.000 n.a. Zero Emissions Technologies 17-Jan-12 19-Mar-14 9-Jun-15 1-Aug-15 9-Jun-15 CPA 31-Dec-99CPA 9 5 7 10 9.1

1027CPA0212.01 10116-0001 Santa Inés Small Hydropower Project Latin America South America Colombia Pacific Power Generation Corp. Registered Hydro Hydro Run of river 9.1 MW run of river hydro plant AMS-I.D. 1 24.8 10 20 0.0 10-Jul-15 0.000 247.910 KBS n.a. Zero Emissions Technologies 17-Jan-12 9-Jun-15 30-Dec-99 9 5 7 10 0 9.1 53400 0.357 No Investment 3 19.073 19.073 19.073 19.073 19.073 19.073 19.073 19.073 19.073 19.073

1028PoA0213 L1V0GJCA5C0FBV3141N4354VQTZHN9 9181 MicroEnergy Credits – Microfinance for Clean Energy Product Lines – India Asia & Pacific Southern Asia India India MicroEnergy Credits Registered EE households EE households Appliances 11 644.7 9-Oct-11 28 0.000 3,253.918 DNV 0.000 465.515 494.493 15-Mar-16 20-Dec-16 DNV Switzerland (Climate Cent Foundation) MicroEnergy Credits 18-Jan-12 22-Aug-12 27-Dec-12 27-Dec-12 PoA 30-Dec-99PoA 4 9 1 8 6 7 0.0

1029CPA0213.01 9181-0001 MicroEnergy Credits POA – Grameen Koota Indoor Air Pollution Campaign Asia & Pacific Southern Asia India MicroEnergy Credits Registered EE households EE households Appliances 1 35.1 7 21 1-Jan-13 0.000 281.144 DNV 6.416 6.416 10-Jul-17 20-Jun-17 DNV Switzerland (Climate Cent Foundation) MicroEnergy Credits 18-Jan-12 27-Dec-12 30-Dec-99 4 9 1 8 6 7 -2 180.0 No N/A MSC 3.903 9.107 13.010 15.612 15.612 15.612 15.612

1030CPA0213.02 9181-0002 MicroEnergy Credits PoA – CPA 02 Asia & Pacific Southern Asia India Kerala, Tamil Nadu MicroEnergy Credits Registered EE households EE households Appliances 1 59.0 7 21 3.4 15-Feb-15 346.794 DNV 88.458 88.458 2 15-Mar-16 20-Jun-17 DNV Switzerland (Climate Cent Foundation) MicroEnergy Credits 18-Jan-12 27-Feb-15 30-Dec-99 4 9 1 8 6 7 -2 1.8 No N/A MSC 48.596 52.130 55.564 58.998 62.432 65.866 69.300

1031CPA0213.03 9181-0003 MicroEnergy Credits PoA – CPA 03 Asia & Pacific Southern Asia India Entire country MicroEnergy Credits Registered EE households EE households Appliances 1 61.5 7 21 5.4 18-Mar-15 356.085 DNV 51.567 51.567 2 15-Mar-16 20-Jun-17 DNV Switzerland (Climate Cent Foundation) MicroEnergy Credits 18-Jan-12 20-Mar-15 30-Dec-99 4 9 1 8 6 7 -2 1.8 MSC 35.439 57.203 60.637 64.071 67.505 70.939 74.373

1032CPA0213.04 9181-0004 MicroEnergy Credits PoA – CPA 04 Asia & Pacific Southern Asia India Entire country MicroEnergy Credits Registered EE households EE households Appliances 1 55.8 7 21 2.9 18-Mar-15 323.137 DNV 51.017 51.017 2 15-Mar-16 20-Jun-17 DNV Switzerland (Climate Cent Foundation) MicroEnergy Credits 18-Jan-12 20-Mar-15 30-Dec-99 4 9 1 8 6 7 -2 1.8 MSC 44.494 51.667 54.058 56.449 58.840 61.231 63.622

1033CPA0213.05 9181-0005 MicroEnergy Credits PoA – CPA 06 Asia & Pacific Southern Asia India Entire country MicroEnergy Credits Registered EE households EE households Appliances 1 52.4 7 21 2.9 20-Mar-15 303.068 DNV 85.534 85.534 1 24-Feb-17 20-Jun-17 DNV Switzerland (Climate Cent Foundation) MicroEnergy Credits 18-Jan-12 20-Mar-15 30-Dec-99 4 9 1 8 6 7 -2 1.8 MSC 41.080 48.253 50.644 53.035 55.426 57.817 60.208

1034CPA0213.06 9181-0006 MicroEnergy Credits PoA – CPA 05 Asia & Pacific Southern Asia India Entire country MicroEnergy Credits Registered EE households EE households Appliances 1 27.3 7 21 5.7 20-Apr-15 155.774 DNV 67.689 67.689 2 15-Mar-16 20-Jun-17 DNV Switzerland (Climate Cent Foundation) MicroEnergy Credits 18-Jan-12 20-Apr-15 30-Dec-99 4 9 1 8 6 7 -2 MSC 4.667 19.128 23.910 28.692 33.474 38.256 42.038

1035CPA0213.07 9181-0007 MicroEnergy Credits PoA – CPA 07 Asia & Pacific Southern Asia India Entire country MicroEnergy Credits Registered EE households EE households Appliances 1 13.7 7 21 2.9 24-Apr-15 77.786 DNV 69.264 69.264 1 24-Feb-17 20-Jun-17 DNV Switzerland (Climate Cent Foundation) MicroEnergy Credits 18-Jan-12 1-May-15 30-Dec-99 4 9 1 8 6 7 -2 MSC 2.931 9.564 11.955 14.346 16.737 19.128 21.519

1036CPA0213.08 9181-0008 MicroEnergy Credits PoA – CPA 08 Asia & Pacific Southern Asia India Entire country MicroEnergy Credits Registered EE households EE households Appliances 1 13.7 7 21 2.9 24-Apr-15 77.786 DNV 45.570 45.570 1 12-May-17 20-Jun-17 DNV Switzerland (Climate Cent Foundation) MicroEnergy Credits 18-Jan-12 1-May-15 30-Dec-99 4 9 1 8 6 7 -2 MSC 2.931 9.564 11.955 14.346 16.737 19.128 21.519

1037CPA0213.09 9181-0009 MicroEnergy Credits PoA - CPA 09 Asia & Pacific Southern Asia India Entire country MicroEnergy Credits Registered EE households EE households Appliances 1 106.7 7 21 2-Dec-16 435.647 DNV 1.802 1.802 1 24-Nov-17 20-Dec-16 DNV Switzerland (Climate Cent Foundation) MicroEnergy Credits 18-Jan-12 7-Dec-16 30-Dec-99 4 9 1 8 6 7 -2 MSC 55.310 79.605 88.526 106.367 118.260 127.181 171.783

1038CPA0213.10 9181-0010 MicroEnergy Credits PoA - CPA 10 Asia & Pacific Southern Asia India Entire country MicroEnergy Credits Registered EE households EE households Appliances 1 111.3 7 21 2-Dec-16 454.205 DNV 1.282 1.282 1 24-Nov-17 20-Dec-16 DNV Switzerland (Climate Cent Foundation) MicroEnergy Credits 18-Jan-12 7-Dec-16 30-Dec-99 4 9 1 8 6 7 -2 MSC 41.653 72.813 85.303 109.091 138.825 156.666 174.507

1039CPA0213.11 9181-0011 MicroEnergy Credits PoA - CPA 11 Asia & Pacific Southern Asia India Entire country MicroEnergy Credits Registered EE households EE households Appliances 1 108.4 7 21 2-Dec-16 442.493 DNV 25.894 25.894 24-Nov-17 20-Jun-17 DNV Switzerland (Climate Cent Foundation) MicroEnergy Credits 18-Jan-12 7-Dec-16 30-Dec-99 4 9 1 8 6 7 -2 MSC 75.858 95.802 117.422 117.422 117.422 117.422 117.422

1040PoA0214 IP8TBJ0IAM7QA2IPXEX0N0QG8HG5Y0 MSW Incineration for Power Generation Programme Asia & Pacific East Asia China China Validation Terminated Landfill gas Landfill gas Combustion of MSW AM25 1 146.8 19-Jan-12 28 0.000 1,467.760 CEPREI 0.000 Japan (Carbon Capital Management) KOE Environmental Consultancy 19-Jan-12 CPA 31-Dec-99CPA 1 5 9 18.0

1041CPA0214.01 Pujiangling MSW Incineration for Power Generation Project in Fujian Province Asia & Pacific East Asia China Validation Terminated Landfill gas Landfill gas Combustion of MSW MSW Incineration for Power Generation AM25 1 146.8 10 25 13.8 1-Jan-13 0.000 1,467.760 CEPREI Japan (Carbon Capital Management) KOE Environmental Consultancy 19-Jan-12 30-Dec-99 1 5 9 0 18.0 115498 0.749 No Investment 3 65.164 98.741 122.841 140.488 153.714 163.887 171.931 178.471 183.929 188.596

1042PoA0215 TN97S5ZTIE5DBHAZUDBFKXMOMJDX4P 9393 Argentinean Wind Power Programme (AWPP) Latin America South America Argentina Argentina wpd Argentina Registered Wind Wind Wind ACM2 1 24.1 20-Jan-12 28 0.000 241.100 RINA 0.000 Germany (Fichtner) Fichtner 20-Jan-12 27-Dec-12 29-Dec-12 10-Jul-13 31-Dec-12 CPA 31-Dec-99CPA 9 5 8 11 17.1

1043CPA0215.01 9393-0001 San Juan - Parque Eólico Latin America South America Argentina Santa Cruz wpd Argentina Registered Wind Wind Wind ACM2 1 24.1 10 20 2.3 1-Jan-14 0.000 241.100 RINA Germany (Fichtner) Fichtner 20-Jan-12 31-Dec-12 30-Dec-99 9 5 8 11 1 ENERCON Germany 17.1 53109 0.511 No Investment 3 5.713 18.275 27.139 27.139 27.139 27.139 27.139 27.139 27.139 27.139

1044PoA0216 ZO8MAL0Q5X0U4E51XLOMPWGDVVE1H6 8777 East Africa Renewable Energy Programme (EA-REP) Africa East Africa Kenya Rwanda, Uganda Standard Bank Registered Hybrid renewables Hybrid renewables Solar & wind & other AMS-I.D. 1 18.4 21-Jan-12 28 0.000 148.243 JCI 0.000 n.a. Carbon Africa 21-Jan-12 CPA 31-Dec-99CPA 10 5 9 12 5.0

1045CPA0216.01 8777-0001 EAREP - Njega 5MW Small Hydro Project Africa East Africa Kenya Central Standard Bank Registered Hydro Hydro Run of river 5MW run of river plant AMS-I.D. 1 18.4 7 20 0.0 19-Dec-12 0.000 148.243 JCI n.a. Carbon Africa 21-Jan-12 7-Nov-12 14-Dec-12 13-Mar-13 30-Dec-99 10 5 9 12 0 5.0 32530 0.570 No Financial MSC 6.147 18.442 18.442 18.442 18.442 18.442 18.442 12.295 1046PoA0217 HEBH6OHO8FTMJH59V8CC2B81651OFX 8990 Asia & Pacific East Asia North Korea North Korea Carbon Development and Trading Registered Methane avoidance Methane avoidance Waste water AMS-III.H. 1 22.8 1-Jul-13 28 0.000 159.466 BV Cert 0.000 n.a. 22-Jan-12 19-Apr-12 20-Dec-12 28-Mar-13 2 CPA 30-Dec-99CPA 11 5 9 7 0.0

1047CPA0217.01 8990-0001 Pulp Wastewater Treatment at Sinuiju Chemical Fibre Factory (IWW-DPRK-1) Asia & Pacific East Asia North Korea North Pyongan Carbon Development and Trading Registered Methane avoidance Methane avoidance Waste water AMS-III.H. 1 22.8 7 21 0.0 1-Jan-14 0.000 159.466 BV Cert n.a. 22-Jan-12 28-Mar-132 30-Dec-99 11 5 9 7 1 No Investment 22.772 22.772 22.772 22.772 22.772 22.772 22.772

1048PoA0218 8IIKQV4DL5NMDFBHMSSTVWLAUB4URX Grid-connected Coal Mine Methane Power Generation Programme Asia & Pacific East Asia China China At Validation Coal bed/mine methane Coal bed/mine methane Coal Mine Methane ACM8 1 78.3 1-Mar-12 28 78.277 782.770 BV Cert 0.000 n.a. KOE Environmental Consultancy 22-Jan-12 CPA 31-Dec-99CPA 1 5 8 3.0

1049CPA0218.01 Asia & Pacific East Asia China Shanxi At Validation Coal bed/mine methane Coal bed/mine methane Coal Mine Methane CMM power generation unit ACM8 1 78.3 10 10 0.0 1-Jan-13 78.277 782.770 BV Cert n.a. KOE Environmental Consultancy 22-Jan-12 30-Dec-99 1 5 8 0 3.0 15500 0.811 No Investment 3 78.277 78.277 78.277 78.277 78.277 78.277 78.277 78.277 78.277 78.277

1050PoA0219 XDI0HGFWE4BQ3NMQDAJ85EBGCWO9LH 9797 Run of River Hydro Power Plants in Chile Latin America South America Chile Chile Besalco Construcciones Registered Hydro Hydro Run of river ACM2 1 11.0 22-Jan-12 28 0.000 57.745 BV Cert 0.000 n.a. Besalco 22-Jan-12 28-Jun-13 20-Mar-14 20-Mar-14 CPA 30-Dec-99CPA 12 4 3.0

1051CPA0219.01 9797-0001 "Tunel Melado Run of River Hydro Power Plant, Chile" Latin America South America Chile Region VI Besalco Construcciones Registered Hydro Hydro Run of river 3 mw run of river plant ACM2 1 11.0 7 30 0.0 1-Oct-15 0.000 57.745 BV Cert n.a. Besalco 22-Jan-12 20-Mar-14 30-Dec-99 12 4 0 3.0 20310 0.608 No Investment 3 1.021 12.247 12.247 12.247 12.247 12.247 12.247 11.226

1052PoA0220 132XKMFCRDJ3IU5XP99CUXV4G0DSK8 9497 Southern African Solar LED Programme Africa Southern Africa South Africa ToughStuff International Registered Solar EE households Solar lamps AMS-III.AR. 1 12.2 22-Jan-12 28 0.000 96.916 BV Cert 0.000 n.a. EcoMetrix Africa 22-Jan-12 13-Jul-12 31-Dec-12 19-Jul-13 31-Dec-12 CPA 30-Dec-99CPA 1 6 9 8 7 0.0

1053CPA0220.01 9497-0001 Southern African Solar LED Programme – South Africa CPA Africa Southern Africa South Africa South Africa ToughStuff International Registered Solar EE households Solar lamps Solar LED lamps AMS-III.AR. 1 12.2 7 7 3.2 31-Jan-13 0.000 96.916 BV Cert n.a. EcoMetrix Africa 22-Jan-12 31-Dec-12 30-Dec-99 1 6 9 8 7 0 No Investment;N/A Plist 1.288 3.864 7.084 10.948 15.456 20.608 26.404 1054PoA0221 FFHNB44R5OIR99WCQZDUM3LFQR6ERS LFG recovery to power Programme of Activities in China Asia & Pacific East Asia China China Replaced At Validation Landfill gas Landfill gas Landfill power ACM1 15-Feb-12 28 SGS Germany (Germany (First Climate) First Climate 24-Jan-12 27-Apr-12 CPA 31-Dec-99CPA 1 10

1055CPA0221.01 CPA-01: Shangrao MSW landfill site LFG recovery to power project Asia & Pacific East Asia China Jiangxi Replaced At Validation Landfill gas Landfill gas Landfill power ACM1 1 24.6 10 19 2.6 1-Nov-12 4.116 246.490 SGS Germany (Germany (First Climate) First Climate 24-Jan-12 27-Apr-12 30-Dec-99 1 10 0 2.0 5817 0.908 No Financial 3 2.002 14.621 17.110 19.499 21.813 24.069 26.284 28.471 30.646 32.816 29.160

1056PoA0222 TVZY0J03JATF0XR96HUUJ3ALJMB4KR 8142 MicroEnergy Credits – Microfinance for Clean Energy Product Lines - Mongolia Asia & Pacific East Asia Mongolia Mongolia MicroEnergy Credits Registered EE households EE households Appliances AMS-II.E. 3 150.4 23-Nov-11 28 0.000 891.269 DNV 0.000 162.532 217.270 4-Jan-16 30-Apr-17 DNV MicroEnergy Credits 25-Jan-12 30-Apr-12 12-Nov-12 12-Nov-12 PoA 30-Dec-99PoA Gold Standard 4 9 1 6 8 11 0.0 Yes

1057CPA0222.01 8142-0001 Asia & Pacific East Asia Mongolia Many MicroEnergy Credits Registered EE households EE households Appliances AMS-II.E. 1 50.1 7 21 0.0 12-Nov-12 0.000 408.069 DNV 0.000 162.532 162.532 4-Jan-16 30-Apr-16 DNV MicroEnergy Credits 25-Jan-12 12-Nov-12 30-Dec-99 4 9 1 6 8 11 3 178.2 No Financial Yes 46.243 61.656 61.656 61.656 61.656 61.656 61.656 15.415

1058CPA0222.02 8142-0002 Asia & Pacific East Asia Mongolia Many MicroEnergy Credits Registered EE households EE households Appliances AMS-II.E. 1 50.1 7 21 0.0 8-Mar-16 0.000 241.600 DNV 51.567 51.567 1-Dec-17 30-Apr-17 DNV MicroEnergy Credits 25-Jan-12 8-Mar-16 30-Dec-99 4 9 1 6 8 11 3 60.0 No 50.133 50.133 50.133 50.133 50.133 50.133 50.133

1059CPA0222.03 8142-0003 Asia & Pacific East Asia Mongolia Many MicroEnergy Credits Registered EE households EE households Appliances AMS-II.E. 1 50.1 7 21 0.0 8-Mar-16 0.000 241.600 DNV 3.171 3.171 1-Dec-17 30-Apr-17 DNV MicroEnergy Credits 25-Jan-12 8-Mar-16 30-Dec-99 4 9 1 6 8 11 3 60.0 No 50.133 50.133 50.133 50.133 50.133 50.133 50.133

1060PoA0223 YNCLZL2NNJGIWK5UTMX4AS747JPWXZ 8457 GRT Energy Small Scale Solar PV (PoA) Asia & Pacific Southeast Asia Thailand Thailand GRT Energy Co Registered Solar Solar Solar PV AMS-I.D. 1 3.3 30-Jan-13 28 0.000 24.491 BV Cert 0.000 Sweden (Tricorona Carbon Asset Management Sweden) Biosphere Capital 25-Jan-12 23-Apr-12 29-Nov-12 19-Jan-13 29-Nov-12 CPA 30-Dec-99CPA 7 5.0 MSC

1061CPA0223.01 8457-0001 GRT Energy Small Scale Solar PV (PoA)- CPA- 001 Asia & Pacific Southeast Asia Thailand Lop Buri GRT Energy Co Registered Solar Solar Solar PV Sungen Thinfilm solar modules AMS-I.D. 1 3.3 7 25 0.0 1-Sep-13 0.000 24.491 BV Cert Sweden (Tricorona Carbon Asset Management Sweden) Biosphere Capital 25-Jan-12 29-Nov-12 30-Dec-99 7 0 5.0 6868 0.598 No Other MSC 4.107 4.107 4.107 4.107 4.107 4.107 4.107

1062PoA0224 T716YA14513361G5690S6PU3F7EO2C 8060 Improved Cookstoves Program for Zambia Africa Southern Africa Zambia Zambia Registered EE households EE households Stoves AMS-II.G. 4 164.2 12-Jan-12 28 0.000 1,122.186 TÜV-SÜD 54.363 202.367 11-Dec-17 30-Apr-17 128.365TÜV-SÜD Shared Value Africa 26-Jan-12 28-Jun-12 13-Dec-12 11-Jan-13 7-Nov-12 PoA 30-Dec-99PoA 8 1 6 9 0.0

1063CPA0224.01 8060-0001 Improved Cookstoves Program for Zambia (SVA-CPA-001) Africa Southern Africa Zambia Eastern Registered EE households EE households Stoves AMS-II.G. 1 41.0 7 21 0.0 12-Jan-10 450.494 TÜV-SÜD 77.998 77.998 11-Dec-17 30-Apr-17 TÜV-SÜD Shared Value Africa 26-Jan-12 7-Nov-12 30-Dec-99 8 1 6 9 0 10.0 No N/A MSC 22.578 22.578 22.578 22.578 22.578 22.578 22.578

1064CPA0224.02 8060-0002 Improved Cookstoves Program for Zambia (COMCPA-002) Africa Southern Africa Zambia Eastern Registered EE households EE households Stoves AMS-II.G. 1 41.0 7 21 0.0 20-Jul-15 223.897 TÜV-SÜD 51.922 51.922 11-Dec-17 30-Apr-17 TÜV-SÜD C-Quest Capital 26-Jan-12 15-May-15 30-Dec-99 8 1 6 9 0 No N/A MSC 41.046 41.046 41.046 41.046 41.046 41.046 41.046

1065CPA0224.03 8060-0003 Improved Cookstoves Program for Zambia (COMCPA-003) Africa Southern Africa Zambia Eastern Registered EE households EE households Stoves AMS-II.G. 1 41.0 7 21 0.0 20-Jul-15 223.897 TÜV-SÜD 44.975 44.975 11-Dec-17 30-Apr-17 TÜV-SÜD C-Quest Capital 26-Jan-12 15-Jun-15 30-Dec-99 8 1 6 9 0 No N/A MSC 41.046 41.046 41.046 41.046 41.046 41.046 41.046

1066CPA0224.04 8060-0004 Improved Cookstoves Program for Zambia (COMCPA-004) Africa Southern Africa Zambia Eastern Registered EE households EE households Stoves AMS-II.G. 1 41.0 7 21 0.0 20-Jul-15 223.897 TÜV-SÜD 27.472 27.472 11-Dec-17 30-Apr-17 TÜV-SÜD C-Quest Capital 26-Jan-12 15-Jun-15 30-Dec-99 8 1 6 9 0 No N/A MSC 41.046 41.046 41.046 41.046 41.046 41.046 41.046

1067PoA0225 RBGRWO9MSIMOI9P556IZLLZV7UUK8A Promoting Efficient Stove Dissemination and Use in West Africa Africa West Africa Togo E+Carbon Replaced At Validation EE households EE households Stoves AMS-II.G. 8-Jun-10 28 DNV n.a. n.a. 28-Jan-12 24-Aug-12 PoA0080 CPA 30-Dec-99CPA 9 6 8

1068CPA0225.01 Africa West Africa Togo Togo E+Carbon Replaced At Validation EE households EE households Stoves "Toyola Asuto" charcoal stoves AMS-II.G. 1 45.2 7 7 7.0 18-Mar-11 80.984 442.758 DNV n.a. n.a. 28-Jan-12 24-Aug-12 CPA0080-0001 30-Dec-99 9 6 8 -5 Yes Financial;Technological 8.966 51.290 51.290 51.290 51.290 51.290 50.928

1069PoA0226 0CCBL3OUQDKUE3SOKLJEGN9L5FJZB2 7767 Mexico Water, Energy, & Emissions Efficiency Residential Program Latin America North America Mexico Mexico Camino Azul Registered EE households EE households Appliances AMS-II.M. 1 0.4 30-Nov-12 28 0.000 4.390 PJRCES 0.000 Switzerland (myclimate) Carbonding Climate Community 28-Jan-12 15-Jan-11 19-Dec-12 19-Dec-12 PoA 30-Dec-99PoA Gold Standard 9 4 1 3 8 7 0.0

1070CPA0226.01 7767-0001 Latin America North America Mexico Mexico City Camino Azul Registered EE households EE households Appliances AMS-II.M. 1 0.4 10 10 0.0 1-Apr-13 0.000 4.390 PJRCES Switzerland (myclimate) Carbonding Climate Community 28-Jan-12 19-Dec-12 30-Dec-99 9 4 1 3 8 7 0 No Investment Foik 0.439 0.439 0.439 0.439 0.439 0.439 0.439 0.439 0.439 0.439

1071PoA0227 4FZ8ITDUBGUEU7F7C23V5BLRE2TW2M 9176 Latin America Central America Honduras Honduras Envirofit International Registered EE households EE households Stoves AMS-II.G. 9 380.0 18-Jan-12 28 29.042 1,556.777 DNV 38.179 19-Jun-17 14-Jun-16 Earthhood n.a. ECLAC 28-Jan-12 17-May-12 12-Jun-15 7-Aug-15 15-Jun-15 PoA 30-Dec-99PoA 4 1 9 8 5 0.0 Plist

1072CPA0227.01 9176-0001 Latin America Central America Honduras Many Envirofit International Registered EE households EE households Stoves AMS-II.G. 1 42.2 7 21 2.8 15-Jun-15 29.042 234.361 DNV 38.179 38.179 14-Jun-16 n.a. ECLAC 28-Jan-12 15-Jun-15 30-Dec-99 4 1 9 8 5 1 Envirovit United K. 387.6 No Plist 18.888 36.451 36.274 36.272 35.952 36.214 36.068

1073CPA0227.02 9176-0002 Latin America Central America Honduras Many Envirofit International Registered EE households EE households Stoves AMS-II.G. 1 42.2 7 21 0.0 1-Feb-17 165.302 DNV n.a. 28-Jan-12 30-Jan-17 30-Dec-99 4 1 9 8 5 1 Plist 42.222 42.222 42.222 42.222 42.222 42.222 42.222

1074CPA0227.03 9176-0003 Latin America Central America Honduras Many Envirofit International Registered EE households EE households Stoves AMS-II.G. 1 42.2 7 21 0.0 1-Feb-17 165.302 DNV n.a. 28-Jan-12 30-Jan-17 30-Dec-99 4 1 9 8 5 1 Plist 42.222 42.222 42.222 42.222 42.222 42.222 42.222

1075CPA0227.04 9176-0004 Latin America Central America Honduras Many Envirofit International Registered EE households EE households Stoves AMS-II.G. 1 42.2 7 21 0.0 1-Feb-17 165.302 DNV n.a. 28-Jan-12 30-Jan-17 30-Dec-99 4 1 9 8 5 1 Plist 42.222 42.222 42.222 42.222 42.222 42.222 42.222

1076CPA0227.05 9176-0005 Latin America Central America Honduras Many Envirofit International Registered EE households EE households Stoves AMS-II.G. 1 42.2 7 21 0.0 1-Feb-17 165.302 DNV n.a. 28-Jan-12 30-Jan-17 30-Dec-99 4 1 9 8 5 1 Plist 42.222 42.222 42.222 42.222 42.222 42.222 42.222

1077CPA0227.06 9176-0006 Latin America Central America Honduras Many Envirofit International Registered EE households EE households Stoves AMS-II.G. 1 42.2 7 21 0.0 1-Feb-17 165.302 DNV n.a. 28-Jan-12 30-Jan-17 30-Dec-99 4 1 9 8 5 1 Plist 42.222 42.222 42.222 42.222 42.222 42.222 42.222

1078CPA0227.07 9176-0007 Latin America Central America Honduras Many Envirofit International Registered EE households EE households Stoves AMS-II.G. 1 42.2 7 21 0.0 1-Feb-17 165.302 DNV n.a. 28-Jan-12 30-Jan-17 30-Dec-99 4 1 9 8 5 1 Plist 42.222 42.222 42.222 42.222 42.222 42.222 42.222

1079CPA0227.08 9176-0008 Latin America Central America Honduras Many Envirofit International Registered EE households EE households Stoves AMS-II.G. 1 42.2 7 21 0.0 1-Feb-17 165.302 DNV n.a. 28-Jan-12 30-Jan-17 30-Dec-99 4 1 9 8 5 1 Plist 42.222 42.222 42.222 42.222 42.222 42.222 42.222

1080CPA0227.09 9176-0009 Latin America Central America Honduras Many Envirofit International Registered EE households EE households Stoves AMS-II.G. 1 42.2 7 21 0.0 1-Feb-17 165.302 DNV n.a. 28-Jan-12 30-Jan-17 30-Dec-99 4 1 9 8 5 1 Plist 42.222 42.222 42.222 42.222 42.222 42.222 42.222

1081PoA0228 D3IXYADJFQZYZONY64WOJVSCIR5JQ4 Latin America South America Colombia Colombia Carbon BW Colombia Validation Terminated Methane avoidance Methane avoidance Palm oil waste AMS-III.H. 1 26.7 30-Jan-12 28 0.000 209.075 SQS 0.000 n.a. Carbon BW Colombia 31-Jan-12 PoA 30-Dec-99CPA 1 5 11 0.0

1082CPA0228.01 CPA-1: Abagó Biogas Project Latin America South America Colombia Meta Carbon BW Colombia Validation Terminated Methane avoidance Methane avoidance Palm oil waste AMS-III.H. 1 26.7 7 25 6.7 1-Mar-13 0.000 209.075 SQS n.a. Carbon BW Colombia 31-Jan-12 30-Dec-99 1 5 11 0 0.285 No Investment 4 6.666 13.332 19.998 26.664 33.330 39.995 46.662

1083PoA0229 ZCZ4IE4R16JZYHFDC0BIR7R4KAUS94 Asia & Pacific Southeast Asia Malaysia Malaysia Wilmar International At Validation Methane avoidance Methane avoidance Palm oil waste AMS-III.H. 1 24.9 31-Jan-12 28 2.120 201.690 BV Cert 0.000 n.a. Wilmar International 31-Jan-12 CPA 30-Dec-99CPA 1 4 9 11 5 8 0.5

1084CPA0229.01 Asia & Pacific Southeast Asia Malaysia Sabah Wilmar International At Validation Methane avoidance Methane avoidance Palm oil waste AMS-III.H. 1 24.9 7 25 0.0 1-Dec-12 2.120 201.690 BV Cert n.a. Wilmar International 31-Jan-12 30-Dec-99 1 4 9 11 5 8 3 0.5 4380 No 4 24.938 24.938 24.938 24.938 24.938 24.938 24.938

1085PoA0230 7RJXZ70OE5F8EXYLLLBLHOAW4H4LWM 7470 Nuru Lighting Programme Africa East Africa Kenya Kenya Nuru East Africa Registered Solar EE households Solar lamps AMS-III.AR. 1 34.3 31-Jan-12 28 0.000 342.940 JCI 0.000 United K. (Merrill Lynch) Carbon Africa 31-Jan-12 25-Jun-12 27-Sep-12 30-Nov-12 3-Oct-12 PoA 30-Dec-99PoA 6 1 8 0.0 Plist

1086CPA0230.01 7470-0001 Nuru Lighting Programme NEAL-KEN-01 Africa East Africa Kenya Many Nuru East Africa Registered Solar EE households Solar lamps AMS-III.AR. 1 34.3 10 10 3.6 1-Jan-13 0.000 342.940 JCI United K. (Merrill Lynch) Carbon Africa 31-Jan-12 3-Oct-12 30-Dec-99 9 8 6 7 0 No Financial Plist 0.593 5.146 24.628 53.716 57.989 55.019 50.681 49.819 45.580 28.972 5.680 1087PoA0231 0BHM38GH8YKQE61A8NLIXFZS8N149H Cogeneration/trigeneration for commercial buildings Asia & Pacific Southern Asia India India Standard Bank Validation Terminated Fossil fuel switch Fossil fuel switch Oil to natural gas AMS-II.K. 1 124.6 1-Oct-12 28 31.263 1,245.520 BV Cert 0.000 United K. (Standard Bank) Do-inc. 31-Jan-12 CPA 31-Dec-99PoA 5 0.0

1088CPA0231.01 Cogeneration/trigeneration for commercial buildings – CPA-001 Asia & Pacific Southern Asia India Many Standard Bank Validation Terminated Fossil fuel switch Fossil fuel switch Oil to natural gas Cogeneration/trigeneration system AMS-II.K. 1 124.6 10 20 0.0 1-Oct-12 31.263 1,245.520 BV Cert United K. (Standard Bank) Do-inc. 31-Jan-12 30-Dec-99 5 0 0.884 No Other;Prevailing practice 31.138 124.552 124.552 124.552 124.552 124.552 124.552 124.552 124.552 124.552 93.414

1089PoA0232 T94KGKJ2UFC666YC99RJ1NGFX8BFVV Foxx Energy CDM Programme of Activities Latin America South America Brazil Brazil Foxx Soluções Ambientais Ltda.. At Validation Landfill gas Landfill gas Combustion of MSW AM25 1 53.9 3-Feb-12 28 0.000 346.366 PJRCES 0.000 n.a. Eqao 3-Feb-12 CPA 31-Dec-99PoA 8 5 9 17.5

1090CPA0232.01 “Osasco Energy Project – CDM Programme Activity”. Latin America South America Brazil São Paulo Foxx Soluções Ambientais Ltda.. At Validation Landfill gas Landfill gas Combustion of MSW Incineration plant AM25 1 53.9 7 11.0 1-Aug-14 0.000 346.366 PJRCES n.a. Eqao 3-Feb-12 30-Dec-99 8 5 9 0 17.5 118073 0.310 No Prevailing practice 3 -15.471 5.558 34.939 55.349 69.697 79.939 87.387 60.147

1091PoA0233 3RFE9NHQUMA3N122AWWI72F0OUAP76 6913 Asia & Pacific East Asia South Korea South Korea SH Corporation Registered Solar Solar Solar PV AMS-I.F. 1 1.4 1-Apr-13 28 0.000 14.170 Keco 0.000 n.a. LEE RCC Co. 7-Feb-12 18-Jul-12 1-Aug-12 19-Oct-12 18-Oct-12 PoA 31-Dec-99CPA 9 1 1.9

1092CPA0233.01 6913-0001 Asia & Pacific East Asia South Korea SH Corporation Registered Solar Solar Solar PV PV and BIPV system at 12 complexes AMS-I.F. 1 1.4 10 20 0.0 29-May-14 0.000 14.170 Keco n.a. LEE RCC Co. 7-Feb-12 18-Oct-12 30-Dec-99 9 1 0 1.9 2278 0.679 No N/A MSC 1.546 1.546 1.546 1.546 1.546 1.546 1.546 1.546 1.546 1.546

1093PoA0234 NKRDMXKDBH86AK6833QQTSCKQFLDZ4 Uniufa-3F Program— Methane recovery through controlled anaerobic digestion Asia & Pacific East Asia China China Beijing Uniufa Energy Technology At Validation Methane avoidance Methane avoidance Waste water AMS-III.AO. 1 418.9 1-Sep-12 28 0.000 4,188.550 BV Cert 0.000 United K. (Lakewood Carbon) Beijing Uniufa Energy Technology 11-Feb-12 CPA 31-Dec-99CPA 1 8 0.0

1094CPA0234.01 Xinzheng Biological Organic Waste Treatment Project (CPA 001) Asia & Pacific East Asia China Henan Beijing Uniufa Energy Technology At Validation Methane avoidance Methane avoidance Waste water AMS-III.AO. 1 418.9 10 15 0.0 1-May-13 0.000 4,188.550 BV Cert United K. (Lakewood Carbon) Beijing Uniufa Energy Technology 11-Feb-12 30-Dec-99 5 1 8 0 No Financial 3 27.903 41.855 41.855 41.855 41.855 41.855 41.855 41.855 41.855 13.952

1095PoA0235 XTDJA013UQ2PQJ27WUW1N56DOXJUMB 7699 Hot Water Heating Programme for South Africa Africa Southern Africa South Africa South Africa International Carbon Registered Solar Solar Solar water heating AMS-I.C.+AMS-II.C. 1 12.1 12-Feb-12 28 0.000 120.840 DNV 0.000 Liechtenstein (International Carbon) International Carbon 11-Feb-12 13-Jun-12 15-Oct-12 15-Jan-13 15-Oct-12 PoA 30-Dec-99PoA 10 5 9 7 0.0 Plist

1096CPA0235.01 7699-0001 Hot Water Heating Programme for South Africa – CPA-001 Africa Southern Africa South Africa South Africa International Carbon Registered Solar Solar Solar water heating AMS-I.C.+AMS-II.C. 1 12.1 10 15 0.0 1-Jan-13 0.000 120.840 DNV Liechtenstein (International Carbon) International Carbon 11-Feb-12 15-Oct-12 30-Dec-99 10 5 9 7 0 7.0 No Other Plist 1.799 10.796 10.796 10.796 10.796 10.796 10.796 10.796 10.796 10.796 8.997

1097PoA0236 XOKQYSJPU08IHSTCEGXC11ZS60BGJB 9507 SKG Sangha Biodigester PoA Asia & Pacific Southern Asia India India SKG Sangha Registered Methane avoidance Methane avoidance Domestic manure 1 54.2 14-Feb-12 28 22.067 456.611 TÜV-Nord 0.000 61.402 61.402 24-Oct-16 27-Feb-17 TÜV-NORD Switzerland (Myclimate) SKG Sangha 14-Feb-12 27-Jun-12 17-Jan-13 28-Jan-13 PoA 30-Dec-99PoA SD Tool 1 6 4 8 0.0

1098CPA0236.01 9507-0001 SKG Sangha Biodigester PoA - Gulbarga Biodigester Project CPA1 Asia & Pacific Southern Asia India Karnataka SKG Sangha Registered Methane avoidance Methane avoidance Domestic manure 1 54.2 7 21 7.3 1-Aug-12 22.067 456.611 TÜV-Nord 61.402 61.402 24-Oct-16 27-Feb-17 TÜV-NORD Switzerland (Myclimate) SKG Sangha 14-Feb-12 28-Jan-13 30-Dec-99 1 6 4 8 2 No N/A MSC 16.494 53.221 59.966 59.966 59.966 59.966 59.966

1099PoA0237 Y7Z6QD9N3MTM65OI7QZIFDWGINQT8P 9218 UpEnergy Open Access Improved Cookstoves Program in Latin America Latin America Central America El Salvador Mexico, Nicaragua UpEnergy Registered EE households EE households Stoves AMS-II.G. 1 43.6 14-Feb-12 28 0.000 349.288 DNV 0.000 n.a. 14-Feb-12 2-Mar-12 27-Dec-12 27-Dec-12 PoA 30-Dec-99PoA Gold Standard 4 1 8 9 0.0

1100CPA0237.01 9218-0001 Latin America Central America El Salvador El Salvador UpEnergy Registered EE households EE households Stoves AMS-II.G. 1 43.6 7 21 6.5 1-Jan-13 0.000 349.288 DNV n.a. 14-Feb-12 27-Dec-12 30-Dec-99 4 1 8 9 3 No N/A MSC 18.188 40.990 48.318 50.138 50.055 48.992 48.839

1101PoA0238 N1AH4XNR0XZ0RUVBCQK6KVLAX00G78 9247 Asia & Pacific East Asia South Korea South Korea LH Corporation To reduce intensive fossil fuels Registered Solar Solar Solar PV AMS-I.F. 2 6.6 1-Nov-11 28 0.000 33.068 KSA 0.000 n.a. Ecoeye 15-Feb-12 PoA0122 5-Jul-12 27-Dec-12 26-Apr-13 27-Dec-12 CPA 30-Dec-99CPA 1 12 7.3 MSC

1102CPA0238.01 9247-0001 PV power plants project on collective housing of 2011-<2011-LH-001-01457> Asia & Pacific East Asia South Korea Many LH Corporation Registered Solar Solar Solar PV 15 PV power plant and 4 SWH systems AMS-I.F. 1 1.3 7 20 0.0 27-Dec-12 0.000 10.630 KSA n.a. Ecoeye 15-Feb-12 CPA0122.01 27-Dec-12 30-Dec-99 1 12 0 1.5 1953 0.679 No Other MSC 0.845 1.689 1.689 1.689 1.689 1.689 1.689 0.844

1103CPA0238.02 9247-0002 PV power plants project on collective housing <2016-LH-001-05826> Asia & Pacific East Asia South Korea Many Registered Solar Solar Solar PV AMS-I.F. 1 5.3 7 20 0.0 8-Oct-16 0.000 22.438 KSA Ecoeye 15-Feb-12 8-Oct-16 30-Dec-99 1 12 0 5.8 0.679 No Other MSC 5.301 5.301 5.301 5.301 5.301 5.301 5.301

1104PoA0239 H6HQGBTCNUENVNM427KGQHH5IB9KIB Promotion of Biomass Power in Indonesia Asia & Pacific Southeast Asia Indonesia Indonesia PT Xoma Power Nusantara At Validation Biomass energy Biomass energy ACM18 1 117.2 15-Feb-12 28 0.000 1,172.260 KBS 0.000 United K. (Sindicatum Carbon Capital) Sindicatum Carbon Capital 17-Feb-12 CPA 30-Dec-99CPA 2 1 8 5 9 11 22.7

1105CPA0239.01 Serdang Bedagai Biomass Power Project CPA#0001. Asia & Pacific Southeast Asia Indonesia North Sumatera PT Xoma Power Nusantara At Validation Biomass energy Biomass energy Agricultural residues: rice husk Circulating fluidized bed technology ACM18 1 117.2 10 15 0.0 1-Apr-14 0.000 1,172.260 KBS United K. (Sindicatum Carbon Capital) Sindicatum Carbon Capital 17-Feb-12 30-Dec-99 2 1 8 5 9 11 -2 22.7 160000 0.716 No Foik 3 117.226 117.226 117.226 117.226 117.226 117.226 117.226 117.226 117.226 117.226

1106PoA0240 IU2WOJVQL2FZMXDAEPTQ7ZY4GIG4VQ Asia & Pacific East Asia North Korea North Korea ET biogas Validation Terminated Methane avoidance Methane avoidance Manure 1 9.6 1-Mar-12 28 0.000 95.630 TÜV-Rhein 0.000 Czech Republic (ET biogas) 21-Feb-12 PoA 30-Dec-99CPA 1 3 6 8 5 9 0.0

1107CPA0240.01 Sokjong/SSCPA-AWMS 01/DPR Korea Asia & Pacific East Asia North Korea Pyongyang ET biogas Validation Terminated Methane avoidance Methane avoidance Manure 1 9.6 10 10 0.0 1-Jan-14 0.000 95.630 TÜV-Rhein Czech Republic (ET biogas) 21-Feb-12 30-Dec-99 1 3 6 8 5 9 0 No 9.563 9.563 9.563 9.563 9.563 9.563 9.563 9.563 9.563 9.563

1108PoA0241 8CUCOFI81EQHW0N4UYBTM0ATZP4M74 9174 Asia & Pacific East Asia China Beijing Uniufa Energy Technology Registered EE Industry EE Industry Construction AMS-II.D. 1 19.5 1-Feb-13 28 0.000 151.571 BV Cert 0.000 United K. (Lakewood Carbon) Beijing Uniufa Energy Technology 21-Feb-12 1-Sep-12 25-Dec-12 27-Dec-12 CPA 31-Dec-99PoA 1 9 0.0

1109CPA0241.01 9174-0001 CPA-001 Energy efficiency project for Shenyang Xinkai Ceramic Co., Ltd Asia & Pacific East Asia China Liaoning Beijing Uniufa Energy Technology Registered EE Industry EE Industry Construction AMS-II.D. 1 19.5 7 10 0.0 1-Apr-13 0.000 151.571 BV Cert United K. (Lakewood Carbon) Beijing Uniufa Energy Technology 21-Feb-12 27-Dec-12 30-Dec-99 1 9 0 45.7 No Investment 3 14.656 19.542 19.542 19.542 19.542 19.542 19.542 19.542 19.542 19.542 4.886

1110PoA0242 ECSSZ4NVP0A7JJTK9XM6DQ8UU39M6X CFL Lighting Scheme in Democratic People’s Republic of Korea (DPRK) Asia & Pacific East Asia North Korea Nort Korea Top Energo Invest Validation Terminated EE households EE households Lighting AMS-II.J. 1 22.3 21-Feb-12 28 0.000 223.180 TÜV-Rhein 0.000 Czech Republic (Top Energo Invest) 21-Feb-12 PoA 30-Dec-99PoA 1 10 8 5 0.0

1111CPA0242.01 CFL Lighting Scheme in DPRK: EDCSHP - CPA # 1 Asia & Pacific East Asia North Korea Top Energo Invest Validation Terminated EE households EE households Lighting AMS-II.J. 1 22.3 10 10 -2.7 1-Sep-12 0.000 223.180 TÜV-Rhein Czech Republic (Top Energo Invest) 21-Feb-12 30-Dec-99 6 8 9 10 5 1 0 0.884 60.0 No Financial 40.090 37.355 34.620 31.884 29.149 26.413 23.678

1112PoA0243 99GG4SAUG5ZO8GWVL0AZZ90U6CC489 7191 Enlightened Solar PoA Middle-East Fertile Crescent Israel Israel Registered Solar Solar Solar PV AMS-I.D. 4 47.7 1-Oct-12 28 0.000 341.403 BV Cert 0.000 Sweden (Tricorona Carbon Asset Management Sweden) Biosphere Capital 22-Feb-12 4-Apr-12 1-Sep-12 11-Oct-12 4-Sep-12 CPA 30-Dec-99CPA 1 7 43.7

1113CPA0243.01 7191-0001 Enlightened Solar PoA- CPA- 001 Middle-East Fertile Crescent Israel many Registered Solar Solar Solar PV AMS-I.D. 1 3.0 7 25 0.0 1-Jan-13 0.000 24.352 BV Cert Sweden (Tricorona Carbon Asset Management Sweden) Biosphere Capital 22-Feb-12 4-Sep-12 30-Dec-99 1 7 0 3.5 5300 0.643 No Other 3.340 3.340 3.340 3.340 3.340 3.340 3.340

1114CPA0243.02 7191-0002 Enlightened Solar PoA- CPA- 002 Middle-East Fertile Crescent Israel Registered Solar Solar Solar PV AMS-I.D. 1 16.3 7 25 0.0 5-Nov-13 0.000 116.955 BV Cert Biosphere Capital 22-Feb-12 5-Nov-13 30-Dec-99 1 7 0 14.7 24858 0.657 No Other Plist 2.886 16.618 16.515 16.413 16.312 16.211 16.111 13.292

1115CPA0243.03 7191-0003 Enlightened Solar PoA- CPA- 003 Middle-East Fertile Crescent Israel Registered Solar Solar Solar PV AMS-I.D. 1 16.4 7 25 -0.1 11-Dec-13 0.000 115.584 BV Cert Biosphere Capital 22-Feb-12 20-Dec-13 30-Dec-99 1 7 0 14.3 25 0.657 No Other 16.804 16.658 16.512 16.368 16.226 16.084 15.944

1116CPA0243.04 7191-0004 Enlightened Solar PoA- CPA- 004 Middle-East Fertile Crescent Israel Registered Solar Solar Solar PV AMS-I.D. 1 12.0 7 25 -0.1 11-Dec-13 0.000 84.511 BV Cert Biosphere Capital 22-Feb-12 20-Dec-13 30-Dec-99 1 7 0 11.3 18 0.657 No Other 12.194 12.119 12.044 11.969 11.895 11.821 11.748

1117PoA0244 DO32TAZRBG5NQXAOYUKIHZK4O1NIC1 7467 Wind and solar PoA in South Africa Africa Southern Africa South Africa South Africa CDC Climat Asset Management Registered Hybrid renewables Hybrid renewables Solar & wind ACM2 1 16.5 1-Jan-13 28 0.000 132.132 ERM CVS 0.000 France (CDC Climat) Ably Carbon 25-Feb-12 26-Dec-12 CPA 30-Dec-99CPA 3 4 9 7 5 8 10.0

1118CPA0244.01 7467-0001 Wind and solar PoA in South Africa – Solar – Kakama Africa Southern Africa South Africa Northern Cape CDC Climat Asset Management Registered Solar Solar Solar PV PV panels ACM2 1 16.5 7 20 -0.1 26-Dec-12 0.000 132.132 ERM CVS France (CDC Climat) Ably Carbon 25-Feb-12 26-Dec-12 30-Dec-99 3 4 9 7 5 8 0 10.0 17042 1.040 No Other 9.140 18.230 18.102 17.975 17.849 17.724 17.600 17.477 17.355 17.233 8.533

1119PoA0245 BN2SV3KJCTJ5VW13047UBGCRE06S5F 9596 Heat Retention Cooking in Less Developed Countries Africa East Africa Rwanda 36 LDC countries Natural Balance International Registered EE households EE households Stoves AMS-II.G. 1 43.1 1-Mar-12 28 47.639 380.981 DNV 0.000 United K. (Natural Balance International+ABHAssociates) ABHAssociates 28-Feb-12 9-Jul-12 16-Mar-13 20-Sep-13 18-Mar-13 PoA 30-Dec-99CPA 6 4 8 9 5 0.0

1120CPA0245.01 9596-0001 Heat Retention Cooking in Less Developed Countries, CPA01 Africa East Africa Rwanda Rwanda Natural Balance International Registered EE households EE households Stoves Heat Retention Cooking device AMS-II.G. 1 43.1 7 21 7.5 1-Mar-12 47.639 380.981 DNV United K. (Natural Balance International+ABHAssociates) ABHAssociates 28-Feb-12 18-Mar-13 30-Dec-99 6 4 8 9 5 0 No Foik 17.498 68.199 69.407 70.559 53.965 58.243 62.462

1121PoA0246 76GA3M12W8UTADVZ6T5BDSDN4UNGAV Vertical Shaft Brick Kiln (VSBK) Programme of Activities for South Africa Africa Southern Africa South Africa South Africa Swisscontact At Validation EE industry EE industry Building materials AMS-III.Z. 1 5.9 29-Feb-12 28 0.000 58.730 ERM CVS 0.000 n.a. CDM Africa Climate Solutions 29-Feb-12 CPA 30-Dec-99CPA 5 7 6 9 11 0.0

1122CPA0246.01 Africa Southern Africa South Africa Eastern Cape Swisscontact At Validation EE industry EE industry Building materials Vertical Shaft Brick Kilns AMS-III.Z. 1 5.9 10 20 0.0 1-Jan-13 0.000 58.730 ERM CVS n.a. CDM Africa Climate Solutions 29-Feb-12 30-Dec-99 5 7 6 9 11 3 No Investment 1.949 3.911 5.873 5.873 5.873 5.873 5.873 5.873 5.873 5.873

1123PoA0247 02IS5MW4OCP9GI15FLG0DJ4YYT5T3J 8733 Sichuan Animal Farms GHG Mitigation Programme Asia & Pacific East Asia China Sichuan province Registered Methane avoidance Methane avoidance Manure AMS-III.D. 1 5.1 15-Dec-12 28 0.000 50.930 TÜV-Nord 0.000 United K. (UPM) 1-Mar-12 1-Mar-12 13-Dec-12 26-Jan-13 13-Dec-12 CPA 31-Dec-99CPA Gold Standard 6 8 3 1 12 9 0.2

1124CPA0247.01 8733-0001 Asia & Pacific East Asia China Registered Methane avoidance Methane avoidance Manure Biogas digester AMS-III.D. 1 5.1 10 16 0.0 1-Jun-13 0.000 50.930 TÜV-Nord United K. (UPM) 1-Mar-12 13-Dec-12 30-Dec-99 6 8 3 1 12 9 -1 0.2 151 0.724 No Investment 3 5.474 5.093 5.093 5.093 5.093 5.093 5.093 5.093 5.093 5.093 2.593

1125PoA0248 2OQ8RHGK659ZERE2KGNN3Q61M8NVSS Fuel switch for Thermal Energy Production Programme Africa Southern Africa South Africa Zimbabwe EcoMetrix Africa Validation Terminated Biomass energy Biomass energy Agricultural residues: other kinds AMS-I.C. 1 54.1 1-Jul-12 28 0.000 541.000 Carbon Check 0.000 n.a. EcoMetrix Africa 1-Mar-12 CPA 30-Dec-99CPA 5 9 8 0.0

1126CPA0248.01 Africa Southern Africa South Africa Limpopo EcoMetrix Africa Validation Terminated Biomass energy Biomass energy Agricultural residues: other kinds Fuel switch to biomass AMS-I.C. 1 54.1 10 25 0.0 1-Jul-13 0.000 541.000 Carbon Check n.a. EcoMetrix Africa 1-Mar-12 30-Dec-99 5 9 8 0 No Prevailing practice Foik 27.050 54.100 54.100 54.100 54.100 54.100 54.100 54.100 54.100 54.100 27.050

1127PoA0249 AGKJ9V25MHHI826CEC0KO9C5MINRMG 6035 UAE Solar Programme of Activities Middle-East Arabian Peninsula United Arab Emirates Withdrawn Solar Solar Solar PV+Solar thermal power ACM2 1 3.9 1-Mar-12 28 0.000 31.435 AENOR 0.000 n.a. Dubai Electricity and Water Authority 1-Mar-12 PoA0167 8-Nov-12 23-Jul-13 18-Oct-13 CPA 31-Dec-99CPA 5 9 8 11 3.0

1128CPA0249.01 6035-0001 Dubai 3 MW Photovoltaic Power Plant Middle-East Arabian Peninsula United Arab Emirates Dubai Withdrawn Solar Solar Solar PV ACM2 1 3.9 7 25 0.0 1-Jan-13 0.000 31.435 AENOR n.a. Dubai Electricity and Water Authority 1-Mar-12 CPA0167.01 30-Dec-99 5 9 8 11 3 First Solar USA 3.0 4723 0.516 No Prevailing practice 2.435 2.435 2.435 2.435 2.435 2.435 2.435

1129PoA0250 JS3EO0HYAMPMSLBAAT3K95T0T3GY8J 9153 Advanced Energy Solutions for Buildings. Programme of Activities (PoA) Middle-East Arabian Peninsula Saudi Arabia CES Carbon Services Registered EE service EE service EE commercial buildings AMS-II.K. 1 6.0 6-Mar-12 28 0.000 50.419 TÜV-SÜD 0.000 n.a. 6-Mar-12 9-Dec-12 28-Mar-14 28-Mar-14 CPA 30-Dec-99CPA 5 7 11 4 0.0

1130CPA0250.01 9153-0001 Installation of a Tri Generation system supplying energy to the Serafi Mega City Middle-East Arabian Peninsula Saudi Arabia Jeddah Total Energy Solutions Registered EE service EE service EE commercial buildings Installation of a trigeneration system AMS-II.K. 1 6.0 7 20 0.0 15-Aug-12 0.000 50.419 TÜV-SÜD n.a. 6-Mar-12 28-Mar-14 30-Dec-99 4 5 7 11 2 0.654 54.0 No Investment 3 6.014 6.014 6.014 6.014 6.014 6.014 6.014

1131PoA0251 J1SI0K59Q8NTQV5VRKV6GMHG03CFFN CONSTANT COMMISSIONING Asia & Pacific Southeast Asia Philippines Philippines Thermal Solutions At Validation EE service EE service EE commercial buildings AMS-II.E. 1 0.6 30-Mar-12 28 0.348 5.660 TÜV-SÜD 0.000 Netherlands (Eneco Energy+Do-inc.) Do-Inc. 6-Mar-12 PoA 30-Dec-99PoA Gold Standard 9 3 0.0

1132CPA0251.01 CONSTANT COMMISSIONING – CPA-001 Asia & Pacific Southeast Asia Philippines Phillippines Thermal Solutions At Validation EE service EE service EE commercial buildings AMS-II.E. 1 0.6 7 21 0.0 30-Mar-12 0.348 5.660 TÜV-SÜD Netherlands (Eneco Energy+Do-inc.) Do-Inc. 6-Mar-12 30-Dec-99 9 3 0 1.4 No Other;Prevailing practice 0.348 0.696 0.696 0.696 0.696 0.696 0.696

1133PoA0252 V4JQN27JEQ2JMQZ8F8S5ZOWDE7BO5H 9477 Macedonian Microscale Grid-connected Hydroelectricity Programme Europe & Central Asia Europe Macedonia Macedonia CAMCO Registered Hydro Hydro Run of river AMS-I.D. 1 10.6 7-Mar-12 28 0.000 105.900 BV Cert 0.000 United K. (CAMCO) CAMCO 7-Mar-12 23-Nov-12 31-Dec-12 19-Jul-13 CPA 31-Dec-99CPA 1 11 5 3.6

1134CPA0252.01 9477-0001 CPA: MAC0001 – Jablanica Europe & Central Asia Europe Macedonia Southwestern CAMCO Registered Hydro Hydro Run of river 3.023 MW run-of-the river plant AMS-I.D. 1 10.6 10 23 0.0 1-Jan-15 0.000 105.900 BV Cert United K. (CAMCO) CAMCO 7-Mar-12 30-Dec-99 1 11 5 0 3.6 11112 0.953 No N/A MSC 10.590 10.590 10.590 10.590 10.590 10.590 10.590 10.590 10.590 10.590 1135PoA0253 NAYSBWJC7KK1H9209Z8JVU6R0YSXZR Demand-side energy efficiency PoA in Malaysia Asia & Pacific Southeast Asia Malaysia Malaysia GenPower Carbon Solutions At Validation EE service EE service EE public buildings AMS-II.C. 1 2.7 8-Mar-12 28 0.687 27.180 PJRCES 0.000 n.a. GenPower Carbon Solutions 8-Mar-12 PoA 30-Dec-99PoA 5 11 2 9 0.0

1136CPA0253.01 Demand-side energy efficiency PoA in Malaysia CPA1 Asia & Pacific Southeast Asia Malaysia Putrajaya GenPower Carbon Solutions At Validation EE service EE service EE public buildings AMS-II.C. 1 2.7 10 10 0.0 1-Oct-12 0.687 27.180 PJRCES n.a. GenPower Carbon Solutions 8-Mar-12 30-Dec-99 5 11 2 9 3 No 2.435 2.749 2.749 2.749 2.749 2.749 2.749 2.749 2.749 2.749

1137PoA0254 MARVKNFGZRP3ZZMXYSP6N93TBGYWF3 Grid-Connected Wind Power Programme in Kenya Africa East Africa Kenya Kenya EnBW Kraftwerke AG Validation Terminated Wind Wind Wind ACM2 1 77.9 1-Jan-14 28 0.000 487.643 DNV 0.000 n.a. Deloitte & Touche 9-Mar-12 CPA 31-Dec-99CPA 9 5 11 3 48.0

1138CPA0254.01 Grid Connected Wind Power Plant in Vipingo, Kenya Africa East Africa Kenya Coast EnBW Kraftwerke AG Validation Terminated Wind Wind Wind Wind turbines ACM2 1 77.9 7 20 0.0 30-Sep-14 0.000 487.643 DNV n.a. Deloitte & Touche 9-Mar-12 30-Dec-99 9 5 11 3 3 48.0 132084 0.590 No 3 77.929 77.929 77.929 77.929 77.929 77.929 77.929

1139PoA0255 E6UMY8BE3SGQWURIDTPKTA69G18JEB Grid-Connected Wind Power Programme in South Africa Africa Southern Africa South Africa South Africa EnBW Kraftwerke AG Validation Terminated Wind Wind Wind ACM2 1 353.6 1-Jan-13 28 0.000 2,122.395 DNV 0.000 n.a. Deloitte & Touche 9-Mar-12 CPA 31-Dec-99CPA 9 5 11 3 140.0

1140CPA0255.01 Grid Connected Wind Power Plant in Roggeveld, South Africa Africa Southern Africa South Africa EnBW Kraftwerke AG Validation Terminated Wind Wind Wind Wind turbines ACM2 1 353.6 7 20 0.0 1-Jan-15 0.000 2,122.395 DNV n.a. Deloitte & Touche 9-Mar-12 30-Dec-99 9 5 11 3 3 140.0 380180 0.930 No 3 353.371 353.371 353.371 353.371 353.371 353.371 353.371

1141PoA0256 JO6D4JGL7W11Y8PBHKUC7YCKQVI2MY 7570 South Africa Renewable Energy Programme (SA-REP) Africa Southern Africa South Africa South Africa Additional Energy Registered Hybrid renewables Hybrid renewables Solar & wind & other AMS-I.D. 3 64.1 27-Feb-12 28 0.000 448.133 JCI 0.000 Switzerland (Additional Energy), Germany (First Climate) Switzerland (Standard Bank) Carbon Africa 13-Mar-12 19-Sep-12 7-Oct-12 29-Nov-12 10-Sep-12 CPA 30-Dec-99CPA 5 9 11 30.0

1142CPA0256.01 7570-0001 SAREP – Greefspan 10MW Solar PV Project Africa Southern Africa South Africa Northern Cape Additional Energy Registered Solar Solar Solar PV AMS-I.D. 1 24.8 7 20 0.0 1-Jun-14 0.000 163.131 JCI Switzerland (Additional Energy), Germany (First Climate) Switzerland (Standard Bank) Carbon Africa 13-Mar-12 10-Sep-12 30-Dec-99 5 9 11 3 Germany 10.0 26967 0.968 No MSC 19.596 26.128 26.128 26.128 26.128 26.128 26.128 6.532

1143CPA0256.02 7570-0002 SA-REP – Aries 10 MW Solar PV Project Africa Southern Africa South Africa Northern Cape Additional Energy Registered Solar Solar Solar PV AMS-I.D. 1 19.5 7 20 5-Oct-13 0.000 141.523 JCI Carbon Africa 28-Feb-13 30-Dec-99 5 9 11 3 Germany 10.0 20644 0.968 No MSC 4.767 19.754 19.675 19.596 19.518 19.440 19.362 14.649

1144CPA0256.03 7570-0003 SA-REP – Konkoonsies 10 MW Solar PV Project Africa Southern Africa South Africa Additional Energy Registered Solar Solar Solar PV AMS-I.D. 1 19.8 7 20 5-Oct-13 0.000 143.479 JCI Carbon Africa 28-Feb-12 30-Dec-99 5 9 11 3 Germany 10.0 20930 0.968 NO MSC 4.833 20.027 19.947 19.867 19.787 19.708 19.630 14.852

1145PoA0257 TLU6V63QTB0N9T7256CNV9RQUJIVCW 7847 Programme for Grid Connected Renewable Energy in the Mediterranean Region Africa North Africa Morocco Promote and support RE Registered Hybrid renewables Hybrid renewables Solar & wind ACM2 1 20.9 31-Dec-12 28 0.000 160.256 GLC 0.000 France (CDC Climat) Perspectives 14-Mar-12 10-Aug-12 24-Oct-12 12-Dec-12 29-Oct-12 CPA 30-Dec-99CPA 12 1 25.0

1146CPA0257.01 7847-0001 Power station 25MWc in Er Rachidia Town in Morocco Africa North Africa Morocco Meknès-Tafilalet Registered Solar Solar Solar PV 135.000 PV panels 185 W each ACM2 1 20.9 7 20 0.0 1-May-13 0.000 160.256 GLC France (CDC Climat) Perspectives 14-Mar-12 29-Oct-12 30-Dec-99 10 5 12 1 0 25.0 35477 0.635 No Investment Foik 3 23.654 23.654 23.654 23.654 23.654 23.654 23.654

1147PoA0258 5SKJO0H8D86SP22QZ87FPHBR2VNL15 Programme for the Avoidance of Methane Emissions through Composting Latin America South America Colombia Colombia Carbon BW Colombia Validation Terminated Methane avoidance Methane avoidance Composting AMS-III.F. 1 17.5 15-Mar-12 28 0.000 122.520 SQS 0.000 n.a. 16-Mar-12 CPA 31-Dec-99CPA 5 9 2 0.0

1148CPA0258.01 Composting Plant GEO - Cajicá Latin America South America Colombia Bogota Carbon BW Colombia Validation Terminated Methane avoidance Methane avoidance Composting Windrow composting AMS-III.F. 1 17.5 7 20 4.5 1-Jan-14 0.000 122.520 SQS n.a. 16-Mar-12 30-Dec-99 5 9 2 1 11 0 No Investment 3 3.249 8.717 13.686 18.226 22.407 26.284 29.905

1149PoA0259 TOJDGI5KILKTY44OZOHIYGN5VCFAQ1 8627 BWC Sustainable Small Hydropower Programme of Activities in Viet Nam Asia & Pacific Southeast Asia Vietnam Vietnam Blue World Carbon Registered Hydro Hydro Run of river AMS-I.D. 1 28.6 17-Mar-12 28 0.000 221.749 TÜV-Rhein 0.000 Netherlands (Blue World Carbon) Blue World Carbon 17-Mar-12 26-Oct-12 7-Dec-12 24-Jan-13 14-Dec-12 CPA 31-Dec-99CPA 8 9 10 14.0

1150CPA0259.01 8627-0001 CPA B12001 - Suoi Lum 3 Hydroelectric Power Plant Asia & Pacific Southeast Asia Vietnam Son La Blue World Carbon Registered Hydro Hydro Run of river 14 MW Run of river plant AMS-I.D. 1 28.6 7 30 0.0 1-Apr-13 0.000 221.749 TÜV-Rhein Netherlands (Blue World Carbon) Blue World Carbon 17-Mar-12 14-Dec-12 30-Dec-99 8 9 10 0 14.0 51440 0.576 No Investment 3 29.650 29.650 29.650 29.650 29.650 29.650 29.650

1151PoA0260 9055XOBL6CB4HDSHSHRZYFI54IN3NT 8919 Asia & Pacific Southern Asia India India Energy Marketers Registered Solar Solar Solar water heating AMS-I.J. 1 8.8 17-Mar-12 28 0.000 88.320 TÜV-Nord 0.000 n.a. Energy Marketers 17-Mar-12 27-Jun-12 20-Dec-12 14-Mar-13 20-Dec-12 PoA 30-Dec-99CPA 10 9 5 11 8 0.0

1152CPA0260.01 8919-0001 Asia & Pacific Southern Asia India Energy Marketers Registered Solar Solar Solar water heating Solar Water Heaters AMS-I.J. 1 8.8 10 15 0.0 20-Dec-12 0.000 88.320 TÜV-Nord n.a. Energy Marketers 17-Mar-12 20-Dec-12 30-Dec-99 10 9 5 11 8 0 9.585 No N/A MSC 8.832 8.832 8.832 8.832 8.832 8.832 8.832 8.832 8.832 8.832

1153PoA0261 CJ2Z26U47EIAAJ3AX108X7L58LZ4BJ 7892 Regional Biogas PoA Asia & Pacific Southeast Asia Malaysia Ably Carbon Registered Methane avoidance Methane avoidance Palm oil waste 1 27.6 26-Jun-12 28 0.000 221.244 Carbon Check 0.000 France (Ably Carbon) Ably Carbon 20-Mar-12 3-Aug-12 6-Nov-12 1-Jan-13 7-Nov-12 PoA 30-Dec-99CPA 1 3 6 5 8 11 1.2

1154CPA0261.01 7892-0001 Felda Triang Regional Biogas PoA – CPA 1 Asia & Pacific Southeast Asia Malaysia Kuala Lumpur Ably Carbon Registered Methane avoidance Methane avoidance Palm oil waste 1 27.6 7 20 0.0 1-Jan-13 0.000 221.244 Carbon Check France (Ably Carbon) Ably Carbon 20-Mar-12 7-Nov-12 30-Dec-99 1 3 6 5 8 11 1 1.2 6798 0.672 No Investment 3 2.440 29.280 27.646 27.646 27.646 27.646 27.646 27.646

1155PoA0262 IVURYHEDF4KHW3YKDE8YU6ETCCUY3O 8188 Shinsung Solar Energy Grid Connected Photovoltaic Power Generation PoA Asia & Pacific East Asia South Korea South Korea Shinsung Solar Energy Registered Solar Solar Solar PV AMS-I.D. 1 0.1 15-Feb-12 28 0.030 0.628 Deloitte-TECO 0.000 n.a. Ecoeye 20-Mar-12 24-Aug-12 13-Nov-12 3-Jan-13 13-Nov-12 CPA 31-Dec-99CPA 10 12 5 0.1 MSC

1156CPA0262.01 8188-0001 Jeungpyeong Photovoltaic Power Generation Project Asia & Pacific East Asia South Korea Chungcheongbuk Shinsung Solar Energy Registered Solar Solar Solar PV Polycrystal 260 W solar panels AMS-I.D. 1 0.1 7 25 0.0 12-Dec-12 0.030 0.628 Deloitte-TECO n.a. Ecoeye 20-Mar-12 13-Nov-12 30-Dec-99 10 12 5 0 South Korea 0.1 127 0.679 No MSC 0.003 0.078 0.078 0.078 0.078 0.078 0.078 0.075

1157PoA0263 GOTQOSYX2HDUAK40K9WCI751PQXIPH 9780 Africa East Africa Malawi Registered EE households EE households Stoves AMS-II.G. 1 40.7 15-Mar-12 28 11.262 335.582 BV Cert 0.000 n.a. Eqao 23-Mar-12 31-Jan-13 22-Jan-14 25-Mar-14 21-May-14 CPA 30-Dec-99CPA 4 2 0.0 Plist

1158CPA0263.01 9780-0001 Promotion of Efficient Cook Stoves in Malawi Africa East Africa Malawi Malawi Registered EE households EE households Stoves AMS-II.G. 1 40.7 7 21 0.0 1-Oct-12 11.262 335.582 BV Cert n.a. Eqao 23-Mar-12 21-May-14 30-Dec-99 4 1 6 8 -5 57.600 No Plist 44.869 44.869 44.869 44.869 44.869 44.869 44.869

1159PoA0264 541TK2IJNL55KJZ0B4EFKG2E0D4LLC 8655 Ecoener Small Hydro Programme of Activities Latin America Central America Guatemala Guatemala Ecoener Ingeniería Registered Hydro Hydro Run of river AMS-I.D. 1 24.1 23-Mar-12 28 0.000 128.808 AENOR 0.000 n.a. Ecoener 24-Mar-12 2-Jul-12 10-Dec-12 14-Dec-12 CPA 31-Dec-99CPA 5 8 9 10 11 12.0 MSC

1160CPA0264.01 8655-0001 Las Fuentes II Hydroelectric Project Latin America Central America Guatemala Ecoener Ingeniería Registered Hydro Hydro Run of river AMS-I.D. 1 24.1 7 30 0.0 1-Sep-15 0.000 128.808 AENOR n.a. Ecoener 24-Mar-12 14-Dec-12 30-Dec-99 5 8 9 10 11 3 12.0 50400 0.583 No MSC 9.798 29.395 29.395 29.395 29.395 29.395 29.395 19.597

Benchmark analysis

Antigua and Barbuda, Barbados, Bahamas, Cuba, Dominican Republ ic, Fi ji, Grenada, Haiti, Jamaica, Saint Lucia, Maldives, Malaysia, Panama, Papua New Guinea, Phil ipp ines, Solomon Islands, Singapore, Trin idad and Tobago, Samoa

Antigua and Barbuda, Barbados, Bahamas, Cuba, Dominican Republ ic, Fij i, Grenada, Hai ti, Indonesia, Jamaica, Saint Lucia, Maldives, Malaysia, Panama, P apua New Guinea, Phil ipp ines, Solomon Islands, Singapore, Trinidad and Tobago, Samoa

PT Indonesia Nusantara Makur (Indonesia)

To develop and coordinate pro ject developers to replace kerosene-based lightingwith approved Project Lamps

PT Indonesia Nusantara Makur (Indonesia)

Uni ted Arab Emirates, Albania, Armenia, Argentina, Azerbaijan, Bosnia and Herzegovina, Bangladesh, Bahra in, Bolivia, Brazil , Bhutan, Belize, Chile, China, Costa Rica, Cyprus, Ecuador, Georgia, Guatemala, Guyana, Hunduras, Israel , India , Iran, Jordan

Uni ted Arab Emirates, Albania, Armenia, Argentina, Azerbaijan, Bosnia and Herzegovina, Bangladesh, Bahra in, Bol ivia , Brazil , Bhutan, Belize, Chile, China, Costa Rica, Cyprus, Ecuador, Georgia, Guatemala, Guyana, Hunduras, Israe l, Iran, Jordan

To develop and coordinate pro ject developers to replace kerosene-based lighting with approved Project Lamps

Karnataka, Kerala, Andhra Pradesh, Tamil Nadu

Replacement of kerosene used for lighting purposes wi th LED lamps

To boost the use of renewable energy by domestic consumers and private companies of the RSA

Installation of a solar electrical system, no larger than 0.15 MW

Implementing biogas systems in developingcountries

AMS-III.R.+AMS-I.E.+AMS-I.I.

Netherlands (SimGas), Germany (Sti ftung Zukunft des Kohlenstoffmarktes)

2,752 manure-fed biogas systems and 4,128 organic waste-fed systems

AMS-III.R.+AMS-I.E.+AMS-I.I.

Netherlands (SimGas), Germany (Sti ftung Zukunft des Kohlenstoffmarktes)

To instal l biogas systems in households, small and medium dairy farms (SMEs)

Leon, Matagalpa, Boaco, Chontales, Rio San Juan

To develop a p latform for overcoming insti tu tional, financial and structuralhurdles for the construction of a series of wind power pro jects

Rivas, Paci fic South Region

Benchmark analysis

Biomass Energy Generation through Gasification or Direct Combustion in South Africa

To ensure that a ll potentia l renewable energy pro jects from renewablebiomass wi ll be able to take part in the CDM

AMS-I.C.+AMS-I.D.+AMS-I.F.

FSCGC001 – Under the PoA “Biomass Energy Generation through Gasification or Di rect Combustion in South Africa”.

10.5 MW biomass co-generation pro ject conventional steam Rankine cycle.

AMS-I.C.+AMS-I.D.+AMS-I.F.

Benchmark analysis

Animal Manure Treatment Programme in Shanxi Province, Guizhou Province and Inner Mongolia Autonomous Region

Shanxi, Guizhou, Inner Mongolia

Beij ing Jinhaihuitong Investment Consul ting

To establ ish a sustainable livestock waste management model that would significantly improve rural environment and reduce greenhouse gas emissions

Animal Manure Treatment Programme in Shanxi Province, Guizhou Province and Inner Mongolia Autonomous Region--CPA - 0001

Beij ing Jinhaihuitong Investment Consul ting

Biogas digesters wi th uti lization of methane for energy production

Benchmark analysis

To develop a p latform for overcoming insti tu tional, financial and structuralhurdles for the construction of a series of small hydroelectric power p lants pro jects or increase thegeneration capacity of exiting power plants.

Benchmark analysis

Burundi, Kenya, Sudan, Tanzania

Burundi, Kenya, Sudan, Tanzania, Uganda

Sustainable Promotion of East African Renewables (SPEAR)

To increase renewable energy generation across East Africa

The Maziba Smal l Hydroelectric Power Pro ject (SHPP), Kabale, Uganda (CPA Maziba)

Sustainable Promotion of East African Renewables (SPEAR)

Ingeniería Seawind Sudamérica Ltda

To contribute to the development and promotion of grid connected windfarms

Ingeniería Seawind Sudamérica Ltda

Benchmark analysis

ENERCAP SunLighting™ Africa – Programme to rep lace kerosene lamps wi th micro PV LED systems in the Sub-Sahara region

Angola, Burkina Faso, Benin, Democratic Republ ic of the Congo, Côte d`Ivoire , Cameroon, Eth iop ia, Ghana, Guinea, Kenya, Mauri tania, Niger, Nigeria , Senegal, Chad, Togo

Angola, Burkina Faso, Benin, Democratic Republ ic of the Congo, Côte d`Ivoire , Cameroon, Eth iop ia, Gabon, Ghana, Guinea, Kenya, Mauri tania, Niger, Nigeria , Senegal, Chad, Togo

To replace kerosene-based lighting with special ly designed PV LED systems to households without access to e lectrici ty

Investment;Prevailing practice

Simple cost analysis

CETOP International Environmental Consul ting

Install ing animal manure treatment systems with biogas recovery system and then to util ize the generated biogas as fuel to generate energy across Jiangxi Province

CETOP International Envi ronmental Consulting (Bei jing) Co.

CETOP International Environmental Consul ting

Animal manure treatment systems with biogas recovery

CETOP International Envi ronmental Consulting (Bei jing) Co.

Benchmark analysis

Mabanaft Carbon India Private Limi ted

To encourage the development of grid connected so lar PV power pro jects and increase the supply of renewable energy in to the country’s electricity grid

Mabanaft Carbon India Private Limi ted

1 MW, poly crysta lline or thin film PV solar panels

To reduce CO2 emissions by disseminating efficient cookstoves throughout Democratic Republ ic of the Congo (DRC)

Dissemination of 12749 affordable cookstoves

Enviro fi t In ternational

Investment;Other;Prevail ing practice

Simple cost analysis

Côte d`Ivoi re, Cameroon

To reduce CO2 emissions by disseminating efficient cookstoves throughout Côte d’ Ivo ire and Cameroon

Dissemination of 10143 affordable cookstoves

Enviro fi t In ternational

Investment;Other;Prevail ing practice

Simple cost analysis

Dissemination of 8258 affordable cookstoves

Enviro fi t In ternational

Investment;Other;Prevail ing practice

Simple cost analysis

Côte d ’Ivoire and Cameroon Efficient Cook stoves Program CPA003 – Cameroon 001

Dissemination of 15776 affordable cookstoves

Enviro fi t In ternational

Investment;Other;Prevail ing practice

Simple cost analysis

To constitute a determinant incentive forprivate project promoters to implement small hydropower projects in Colombia

Antioquia department

Benchmark analysis

To use microfinance to expand access to clean energy to mill ions of low income microentrepreneurs and households

AMS-II.G.+AMS-III.AV.+AMS-I.A.

Maharashtra, Karnataka

20,000 water purifiers, 60,435 so lar laterns, 20,000 improved cook stoves

AMS-II.G.+AMS-III.AV.+AMS-I.A.

90,000 Solar lighting systems and 33,000 Efficient cooking stoves

AMS-II.G.+AMS-III.AV.+AMS-I.A.

10,000 Solar lighting system and 33,000 Efficient cooking stoves

AMS-II.G.+AMS-III.AV.+AMS-I.A.

60,000 Solar lighting systems and 30,000 Efficient cooking stoves

AMS-II.G.+AMS-III.AV.+AMS-I.A.

90,000 Solar lighting systems and 31,120 Efficient cooking stoves

AMS-II.G.+AMS-III.AV.+AMS-I.A.

170,000 Solar lighting systems and 60,000 Water puri fication systems

AMS-II.G.+AMS-III.AV.+AMS-I.A.

90,000 Solar lighting systems and 28,795 Efficient cooking stoves

AMS-II.G.+AMS-III.AV.+AMS-I.A.

90,000 Solar lighting systems and 28,795 Efficient cooking stoves

AMS-II.G.+AMS-III.AV.+AMS-I.A.

Involves marketing, d istributing, and financing solar l ighting systems, and water purification devices

AMS-II.G.+AMS-III.AV.+AMS-I.A.

Involves marketing, d istributing, and financing solar l ighting systems, and water purification devices

AMS-II.G.+AMS-III.AV.+AMS-I.A.

Involves marketing, d istributing, and financing solar l ighting systems, and water purification devices

AMS-II.G.+AMS-III.AV.+AMS-I.A.

Union Power Carbon Asset Management

Disposal of the MSW (Municipa l solid waste) through incineration, and simul taneously recovering the thermal heat for power generation

Yulin Village, Bangshan Town, Longhai City

Union Power Carbon Asset Management

Benchmark analysis

To ini tiate at least 500 MW of wind power plant capacity by 2020

19 wind turb ines with an individual capacity of 900 kW each

Benchmark analysis

Kenya, Rwanda, Uganda

To disp lace grid-connected, fossil fuel based electricity generation through the promotion of renewable energy based electricity generation in East Africa

Methane Util isation and Destruction Programme from Industria l Wastewater in DPR Korea

To identify as many sites as possible and to implement methane capture and util isation and/or destruction to reduce the maximum amount o f GHGs

State Academy of Science in Pyongyang

Enclosed flare for the combustion of methane from industrial wastewater

State Academy of Science in Pyongyang

Simple cost analysis

Union Power Carbon Asset Management

To reduce GHG emission by destroying methane conta ined in Coal Mine Methane using CMM power generation units

Shanxi Dubao Clean Energy Investment Co., Ltd. Hongxiang Coal Mine Methane Power Generation Pro ject

Union Power Carbon Asset Management

Benchmark analysis

To support the development of renewable energy pro jects, specifica lly new grid connected run of river power plants

Benchmark analysis

Mozambique, Zimbabwe, Botswana, Namib ia, Zambia, Malawi , Angola

South Africa, Mozambique, Zimbabwe, Botswana, Namibia, Zambia, Malawi, Angola

To increase dissemination of so lar charged, LED based l ighting appl ications at the domestic level , rep lacing the use of fossil fue ls and associated lighting applications.

Henan BCCY New Power Industry

To promote the implementation of LFG capture and usagepro jects in China by offering in tegrated financia l, engineering and CDM services.

Henan BCCY New Power Industry

LFG collection, transmission and pre-treatment system with subsequent electricity generation

Benchmark analysis

To use microfinance to expand access to clean energy to mill ions of low income microentrepreneurs and households

Uni ted K. (MicroEnergy Credi ts), Sweden (Government of Sweden)

MicroEnergy Credi ts – Microfinance for Clean Energy Product Lines - Mongol ia –CPA No.001: XacBank

Efficient stoves, home insulation: ger blankets, vestibu les

Uni ted K. (MicroEnergy Credi ts), Sweden (Government of Sweden)

MicroEnergy Credi ts – Microfinance for Clean Energy Product L ines - Mongol ia – CPA No.002: XacBank LLC

Efficient stoves, home insulation: ger blankets, vestibu les

Uni ted K. (MicroEnergy Credi ts), Sweden (Government of Sweden)

MicroEnergy Credi ts – Microfinance for Clean Energy Product L ines - Mongol ia –CPA No.003: XacBank LLC

Efficient stoves, home insulation: ger blankets, vestibu les

Uni ted K. (MicroEnergy Credi ts), Sweden (Government of Sweden)

To develop a p latform which wil l assist the development of small -scale gridconnected so lar PV power plants in Thai land

C-Quest Capital Malaysia Global Stoves Limited

To make cleaner, more efficient improved cooking stoves more affordable and available to peri-urban and rura l households across Zambia

Netherlands (C-Quest Capital), Germany (Stiftung Zukunft des Kohlenstoffmarktes)

C-Quest Capital Malaysia Global Stoves Limited

5300 domestic fuel efficient cooking stoves

Netherlands (C-Quest Capital), Germany (Stiftung Zukunft des Kohlenstoffmarktes)

C-Quest Capital Malaysia Global Stoves Limited

13,572 domestic fuel efficient cooking stoves

Netherlands (C-Quest Capital), Germany (Stiftung Zukunft des Kohlenstoffmarktes)

C-Quest Capital Malaysia Global Stoves Limited

13,572 domestic fuel efficient cooking stoves

Netherlands (C-Quest Capital), Germany (Stiftung Zukunft des Kohlenstoffmarktes)

C-Quest Capital Malaysia Global Stoves Limited

13,572 domestic fuel efficient cooking stoves

Netherlands (C-Quest Capital), Germany (Stiftung Zukunft des Kohlenstoffmarktes)

Burkina Faso, Senegal , Mal i

Togo, Burkina Faso, Senegal , Mali

Reducing greenhouse gases emissions by disseminating fue lefficientcharcoal and wood stoves throughout West Africa

Promoting Efficient Stove Dissemination and Use in West Africa – CPA 001 Togo

Distribution and d irect instal lation of water saving devices in lowincomeurban households where water is heated via fossi l fuel-fired and/or e lectric water heaters.

Mexico Water, Energy, & Emissions Efficiency Residential Program – CPA.DF.1

Low-flow showerheads and faucet regulators

Improved Cookstoves Program in Honduras “Vida Mejor con Ecofogones de Alto Rendimiento”

To facili ta te the transition away from inefficient conventional firewood stoves by providing high-efficiency and clean burning improved firewood cooking stoves

Improved Cookstoves Project Activi ty in Honduras “Vida Mejor con Ecofogones de Alto Rendimiento” – CPA No 001.

Replacement of fi rewood stoves wi th ICS

Financial ;P revai ling practice;Technological

Improved Cookstoves Project Activi ty in Honduras “Vida Mejor con Ecofogones de Alto Rendimiento” – CPA No 002

Replacement of biomass stoves with ICS

Envirofi t In ternational Ltd

Improved Cookstoves Project Activi ty in Honduras “Vida Mejor con Ecofogones de Alto Rendimiento” – CPA No 003

Replacement of biomass stoves with ICS

Envirofi t In ternational Ltd

Improved Cookstoves Project Activi ty in Honduras “Vida Mejor con Ecofogones de Alto Rendimiento” – CPA No 004

Replacement of biomass stoves with ICS

Envirofi t In ternational Ltd

Improved Cookstoves Project Activi ty in Honduras “Vida Mejor con Ecofogones de Alto Rendimiento” – CPA No 005

Replacement of biomass stoves with ICS

Envirofi t In ternational Ltd

Improved Cookstoves Project Activi ty in Honduras “Vida Mejor con Ecofogones de Alto Rendimiento” – CPA No 006

Replacement of biomass stoves with ICS

Envirofi t In ternational Ltd

Improved Cookstoves Project Activi ty in Honduras “Vida Mejor con Ecofogones de Alto Rendimiento” – CPA No 007

Replacement of biomass stoves with ICS

Envirofi t In ternational Ltd

Improved Cookstoves Project Activi ty in Honduras “Vida Mejor con Ecofogones de Alto Rendimiento” – CPA No 008

Replacement of biomass stoves with ICS

Envirofi t In ternational Ltd

Improved Cookstoves Project Activi ty in Honduras “Vida Mejor con Ecofogones de Alto Rendimiento” – CPA No 009

Replacement of biomass stoves with ICS

Envirofi t In ternational Ltd

CDM Programme for Biogas Recovery and Use from Wastewater and Sludge Treatment

To recover the methane generated from wastewater or sludge

Coverage of the basel ine open lagoon system and the potentia l utilization of the captured biogas

Investment comparison analysis

Biogas recovery pro jects from wastewater generated in agriculture product based industries

To recover this b iogas with or wi thout of the option of putting the recovered biogas to productive use

Biogas recovery pro jects from wastewater generated in agriculture product based industries - CPA-01

Anaerobic digesters with biogas recovery system

Investment;Other;Technological

Benchmark analysis

To make modern LED based lighting technologies available to poorhouseholds in Africa and to expedite the phasing out of fossi l fuel based lamps

RE based LED systems, charged using Nuru PowerCycleTo disp lace e lectrici ty consumption from

the electricity grid , and/or from existing captive power plants, and/or fossilfuels d irectly consumed

To help meet Brazil ’s rising demand for energy due (to economicgrowth) improving the supply of e lectricity and contributing to environmenta l, social and economicsustainabili ty.

Benchmark analysis

SH Corporation Solar photovol ta ic housing complex programme in Republic of Korea

Reducing energy consumption of bui lding sector, Seoul becomes eco-friendly city by 2030, Reduce electricity bas ed on coal, growing and strengthening the solar industry in Republic of Korea

SH Corporation Solar photovol ta ic housing complex programme in Republic of Korea – CPA1

Seoul (Magok and Naegok districts)

To promote the program of centralized system of d igesting organic wasteswith methane recovery for energy use

Anaerobic digestion and b iogas recovery system

Benchmark analysis

To instal l HPs and SWHs in households and industry, thereby disp lacing carbonintensive e lectrici ty from the grid currently used to provide hot water.

2250 heat pumps, 2250 solar water heaters, 500 hybrid solutions

Installation of domestic biodigesters as a clean, sustainable energysource throughout Ind ia.

AMS-I.C.+AMS-III.R.+AMS-I.E.

Family-size biodigester together with a biogas-based cooking stove unit

AMS-I.C.+AMS-III.R.+AMS-I.E.

Guatemala, Honduras, Mexico, Nicaragua, El Salvador

To facili ta te the transition away from inefficient conventional woodfuel stoves by providing high-efficiency and clean burning improved woodfuel cooking stoves to local households.

Universidad Centroamericana "J. S. Cañas"

UpEnergy Open Access Improved Cookstoves Program in Latin America – CPA No 001.

Replacement of conventional firewood stoves wi th h igher efficiency ICS model Ecocina

Universidad Centroamericana "J. S. Cañas"

Programme of Activities to in troduce renewable energy system into col lective housing, Republ ic of Korea

Korea Land & Housing Corporation

68 PV power plants with total capaci ty of 5,826 KW

To develop a p latform for supporting the development of sustainable biomasspower pro jects in Indonesia

Agricultura l residues: rice husk+Bagasse

Investment;Prevailing practice

Benchmark analysis

Methane Util ization and Destruction Programme from Animal Waste Management System (AWMS) in DPR Korea.

To disp lace e lectrici ty from the grid and/or fossil fue l utilization by the promotionof biogas based electricity and/or thermal energy generation systems and chemical fertiliz er with organicfertiliz er in DPR Korea,

AMS-III.D.+AMS-I.C.+AMS-I.F.

State Academy of Science in Pyongyang

Biodigestion system to treat swine waste and the enclosedflaring/combustion system to destruct captured biogas

AMS-III.D.+AMS-I.C.+AMS-I.F.

State Academy of Science in Pyongyang

Investment;Technological

Energy efficiency programme for ceramic ki lns in L iaoning Faku Economic Development Zone

Liaoning Faku Economic Development Zone

To motivate existing ceramic plants and those to be buil t to adopt “BRST” measures to improve kiln energy effic iency by rep lacing, modi fying or retrofitting existing kilns or purchasing new ki lns

Use of “Blackbody Radiation Strengthen Technology” (BRST) to modi fy ceramic kilns

Benchmark analysis

CFL distribution to households and emiss ions reductions

State Academy of Science in Pyongyang

South Hamgyong Province

Estimated co llection and destruc tion of 549,500 ICLs with the replacement of the

State Academy of Science in Pyongyang

Simple cost analysis

Tricorona Carbon Assessment Management

To develop a p latform which wil l assist the development of small -scale gridconnected so lar PV power plants in Israel

Tricorona Carbon Assessment Management

Silicon photovoltaic cel ls, installed in amodular fash ion

Tricorona Carbon Assessment Management

Installation of 19 photovoltaic (PV) solar power plants throughout the state of Israe l.

Tricorona Carbon Assessment Management

Installation of 5 Solar PV instal lations for at total o f 14.255 MW

Tricorona Carbon Assessment Management

Installation of 5 Solar PV instal lations for at total o f 11.26 MW

Developing wind and so lar power p lants to provide renewable energy to the SouthAfrican grid and to reduce greenhouse gas emiss ions

Large-scale adoption of heat retention cooking to domestic and nondomestickitchens in specific Less Developed Countries

Investment;Other;Technological

To promote and support the uptake of vertica l shaft technology in the small andmedium sized (SME) brick manufacturing industry in South Africa

Vertica l Shaft B rick K iln Programme of Activities in South Africa, Langkloof Bricks ,Phase 2

Chengdu Oasis Science & Technology

To to enable livestock farmers in Sichuan to instal l anaerobic digesters onthei r farms in order to avoid methane emiss ions and util ize the capturedbiogas to rep lace e lectrici ty and thermal energy

Oasis Science and Technology Development Bei jing

Sichuan Animal Farms GHG Mi tigation Programme, CPA Nb. SCAFBG-2011-01

Shuanghe Town, Zizhong County

Chengdu Oasis Science & Technology

Oasis Science and Technology Development Bei jing

Benchmark analysis

South Africa, Zimbabwe

To reduce the use of fossil fue ls in thermal energy production equipment and thus to reduce the CO2 emissions associated wi th the use of the thermal energy generation

Fuel Switch for Thermal Energy Production Programme CPA number 001: Impala Platinum Rustenburg SSC CPA

Uni ted Arab Emirates

Dubai Electricity and Water Authority

The generation of electricity through the util ization of the so larpower potential in the UAE

Dubai Electricity and Water Authority

Thin-film panels in a modular fashion in 1 MW sub-p lant blocks

Qatar, United Arab Emirates, Oman, Egypt

Saudi Arabia, Qatar, United Arab Emirates, Oman, Egypt

To provide electricity and meet the cool ing and heat requirements of non industrial bu ild ings in a more efficient and less carbon in tensive way.

CES Energy, South Pole Carbon Asset Management

CES Energy, South Pole Carbon Asset Management

Benchmark analysis

To improve the to ta l energy efficiency of bu ild ings by implementing apackage of ECMs tailor-made to fit each build ing ’s needs.

Energy conservation measures for pumps, cooling towers, bo ilers, ai r handl ing units, ch illers,lighting and heat recovery

To assist the development of small hydro power plants (SHPPs) in the most economically vu lnerable areas in Macedonia: rural , undeveloped areas wi th high rate of unemployment.

To achieve energy efficiency and develop a platform for overcomingregulatory, insti tu tional, financial and structural hurdles for the ro ll-out o f energy efficient projects

Lighting replacement/ redesign (layout), change to h igh efficiency motor (AHU motor and

Prevai ling practice;Technological

To reduce greenhouse gas emissions through the insta lla tion of gridconnectedwind power plants in Kenya

Investment;Prevailing practice

Benchmark analysis

To reduce greenhouse gas emissions through the insta lla tion of gridconnectedwind power plants in South Africa

Western Cape, Northern Cape

Investment;Prevailing practice

Benchmark analysis

To disp lace grid-connected, fossil fuel based electricity generation through the promotion of renewable energy based electricity generation in South Africa,

1998 trackers, each of them wi th 23 PV modules wi th a nominal power of 240 Wp each, to ta l a 45,954 PV modules

Investment;Prevailing practice

43,008 BYD250 photovoltaic (“PV”) modules total ling an insta lled capacity of 10,752kWp

Investment;Prevailing practice

43,008 BYD250 photovoltaic (“PV”) modules total ling an insta lled capacity of 10752kWp

Investment;Prevailing practice

Egypt, Lebanon, Morocco, Tunisia

Renewable Energy for the Medi terranean (REM)Renewable Energy for the Medi terranean (REM)

Benchmark analysis

Decrease methane emissions from anaerobic decay, Reduction of waste quantities, Generation of h igh qual ity compost as va luable material for d ifferent activi ties…

GFA Consul ting Group, Carbon BW Colombia

GFA Consul ting Group, Carbon BW Colombia

Benchmark analysis

To develop a p latform for overcoming insti tu tional, financial and structural hurdles for the construction of smal l hydropower pro jects.

Benchmark analysis

Development of Programmatic CDM Pro ject for SWH insta lla tion under MNRE, UNDP/GEF Global Solar Water Heating Market Transformation and Strengthening Ini tiatives: India Country Programme

Enhancing the outreach and increasing penetration as wel l as usage of Solar water heating technology as a clean and sustainable energy solution to meet the low temperature hot water requi rement

Development of Programmatic CDM Pro ject for SWH insta lla tion under MNRE, UNDP/GEF GlobalSolar Water Heating Market Transformation and Strengthening Initia tives: India Country P rogramme –0001

Maharashtra, Karnataka

Malaysia, Papua New Guinea, Solomon Islands

To reduce the greenhouse gas (GHG) emiss ions from palm oil mi lls by the insta lla tion of biogas recovery system and destroying the b iogas generated

AMS-III.H.+AMS-I.C.+AMS-I.F.+AMS-I.D.+AMS-I.A.

Col lection system with biogas flaring system

AMS-III.H.+AMS-I.C.+AMS-I.F.

Benchmark analysis

To encourage photovol ta ic (PV) power generation activi ties in the Republic o fKorea and produce the renewable energy-based electricity that will be provided to the national grid .

Shinsung CS

Promotion of Energy Efficient Cook Stoves within Southern African Development Communi ty (SADC)

Angola, Botswana, Congo DR, Lesotho, Madagascar, Mauri tius, Mozambique, Namibia, Seychelles, Swazi land, United Republ ic of Tanzania, South Africa, Zambia, Zimbabwe

Angola, Botswana, DRCongo, Lesotho, Madagascar, Mauri tius, Malawi, Mozambique, Namibia, Seychelles, Swazi land, United Republ ic of Tanzania, South Africa, Zambia, Zimbabwe

Southern African Regional Carbon Faci lity

To support the large scale commercial ization of energy efficientcooking devices in the SADC region

Southern African Regional Carbon Faci lity

24000 Energy Efficient Cook Stoves (EECS)

Financial ;Other;Prevail ing practice

Simple cost analysis

To develop a p latform for overcoming insti tu tional, financial and structural hurdles for the construction of a series of small hydro projects.

RetalhuleuQuetza ltenango

A s mall-sca le run-of river (ROR) hydroelectric power sta tion wi th an insta lled capacity o f 12 MW

Financial ;Investment;Other;Prevailing practice;Technological

Simple cost analysis

N1011
Withdrawn before publication

1161PoA0265 ORODGIJZCR81Q7QDSMW0EJ9CB9DI1D Landfill gas programme in Vietnam Asia & Pacific Southeast Asia Vietnam Vietnam PJI-LFGC At Validation Landfill gas Landfill gas Landfill power ACM1 1 30.7 31-Dec-12 28 0.000 542.012 KBS 0.000 France (Bionersis) Bionersis, ecosur afrique 27-Mar-12 CPA 31-Dec-99CPA 11 1 6 3 5 8 1.0

1162CPA0265.01 CPA-1: Landfill Gas Project in Trang Cat 2 Landfill Asia & Pacific Southeast Asia Vietnam Hai An PJI-LFGC At Validation Landfill gas Landfill gas Landfill power ACM1 1 30.7 7 14 -7.3 1-May-03 0.000 542.012 KBS France (Bionersis) Bionersis, ecosur afrique 27-Mar-12 30-Dec-99 11 1 6 3 5 8 1 1.0 4273 0.576 No Financial 4 25.737 43.785 47.676 34.490 25.367 19.060 14.657

1163PoA0266 KVYQJ02CHB8SC7Q5OXQ53EKYGVTB3V Solar LED Lamp Project in Developing Asia Asia & Pacific Southern Asia India ToughStuff Validation Terminated Solar EE households Solar lamps AMS-III.AR. 1 7.8 1-Dec-12 28 0.000 62.197 Carbon Check 0.000 n.a. ToughStuff 29-Mar-12 CPA 31-Dec-99CPA 4 1 6 8 6 7 0.0

1164CPA0266.01 Solar LED Lamp Project in Odisha, India Asia & Pacific Southern Asia India Orissa ToughStuff Validation Terminated Solar EE households Solar lamps AMS-III.AR. 1 7.8 7 7 2.4 1-Jan-13 0.000 62.197 Carbon Check n.a. ToughStuff 29-Mar-12 30-Dec-99 4 1 6 8 6 7 0 No N/A MSC 0.560 1.680 3.360 5.740 9.220 13.920 19.930

1165PoA0267 A0V69QOBSXXIDZ8PPKEBULSZF9YJNI Macedonian Microscale Grid-connected Hydroelectricity Programme Europe & Central Asia Europe Macedonia Macedonia CAMCO Validation Terminated Hydro Hydro Run of river AMS-I.D. 1 10.1 29-Mar-12 28 0.000 101.070 BV Cert 0.000 United K. (CAMCO) CAMCO 29-Mar-12 CPA 31-Dec-99CPA 10 5 7 3.01166CPA0267.01 CPA: MAC0001 – Jablanica Europe & Central Asia Europe Macedonia Southwestern CAMCO Validation Terminated Hydro Hydro Run of river 3.0233 MW run-of-the river plant AMS-I.D. 1 10.1 10 23 0.0 1-Apr-15 0.000 101.070 BV Cert United K. (CAMCO) CAMCO 29-Mar-12 30-Dec-99 10 5 7 0 3.0 10411 0.968 No N/A MSC 10.107 10.107 10.107 10.107 10.107 10.107 10.107 10.107 10.107 10.107 1167PoA0268 34ZFY89OH4JNEIQ2F2UOKDDLERN0X3 8232 Grid Connect SSC Solar PV Power Generation Plant Programme * East Asia China China Registered Solar Solar Solar PV AMS-I.D. 1 14.4 1-Apr-12 28 0.000 115.632 CEPREI 0.000 Japan (Carbon Capital Management) KOE Environmental Consultancy 30-Mar-12 1-Nov-12 22-Nov-12 22-Dec-12 23-Nov-12 CPA 31-Dec-99CPA 10 11 10.0 Plist

1168CPA0268.01 8232-0001 Asia & Pacific East Asia China Ningxia Registered Solar Solar Solar PV AMS-I.D. 1 14.4 7 25 7.0 1-Jan-13 115.632 CEPREI Japan (Carbon Capital Management) KOE Environmental Consultancy 30-Mar-12 23-Nov-12 30-Dec-99 1 5 10 5 11 0 10.0 16120 0.896 No Plist 6.020 14.449 14.449 14.449 14.449 14.449 14.449 8.429

1169PoA0269 HFW0T3MI9XVUXRHNNVADOJTK4IK0SF Latin America South America Peru Peru Repsol Replaced at Validation Fossil fuel switch Fossil fuel switch Oil to LPG AMS-III.AN. 3-Nov-10 28 AENOR n.a. Repsol 4-Nov-10 30-Mar-12 PoA0060 PoA 30-Dec-99PoA 1 6 11 9

1170CPA0269.01 Latin America South America Peru Ica Repsol Replaced at Validation Fossil fuel switch Fossil fuel switch Oil to LPG AMS-III.AN. 1 0.3 10 10 0.0 1-Jul-12 0.107 2.910 AENOR n.a. Repsol 4-Nov-10 30-Mar-12 CPA0060.01 30-Dec-99 1 6 11 9 3 Baltur Italy Ransome USA No Investment 3 0.106 0.212 0.212 0.212 0.212 0.212 0.212 0.212 0.212 0.212 0.212 0.106

1171PoA0270 80Z6MV07MEK89RW58LERLKO0O8AEHR 7596 Latin America South America Chile Chile Solarpack Registered Solar Solar Solar PV ACM2 1 22.8 19-Dec-11 28 0.000 228.300 TÜV-SÜD 0.000 n.a. Solarpack 31-Mar-12 27-Jul-12 4-Oct-12 5-Oct-12 CPA 31-Dec-99CPA 3 11 5 7 9.0

1172CPA0270.01 7596-0001 Calama Solar 1: 9MW Solar Photovoltaic Power Plant Latin America South America Chile Region II Solarpack Registered Solar Solar Solar PV ACM2 1 22.8 10 25 -0.1 1-Jan-14 0.000 228.300 TÜV-SÜD n.a. Solarpack 31-Mar-12 5-Oct-12 30-Dec-99 3 11 5 7 0 9.0 27500 0.799 No N/A Foik 10.985 21.860 21.751 21.642 21.534 21.426 21.319 21.212 21.106 21.001 10.448

1173PoA0271 AUTFH2YLS9ME6NVVTLT4EFMWBS6PKW 9191 Sichuan Province Rural Efficient Biomass Cooking Stoves Programme Project Asia & Pacific East Asia China Sichuan Registered EE households EE households Stoves AMS-II.G. 1 9.7 3-Apr-12 28 4.858 77.941 BV Cert 0.000 Switzerland (Bunge emissions group) 3-Apr-12 1-Jun-12 25-Dec-12 25-Dec-12 PoA 30-Dec-99CPA 1 6 4 5 8 7 0.0 Plist

1174CPA0271.01 9191-0001 Asia & Pacific East Asia China Yuexi county Registered EE households EE households Stoves Tibet stoves AMS-II.G. 1 9.7 7 10 0.0 25-Dec-12 4.858 77.941 BV Cert Switzerland (Bunge emissions group) 3-Apr-12 25-Dec-12 30-Dec-99 1 6 4 5 8 7 -5 No Investment Plist 4.858 9.716 9.716 9.716 9.716 9.716 9.716 9.716 9.716 9.716 4.858

1175PoA0272 MIZAQYWZQOCM87ISDKSBA0INPUS2VE Mexican Housing Commission Sustainable Housing Program of Activities Latin America North America Mexico Mexico CONAVI Replaced at Validation EE service EE service EE new buildings 11-Dec-10 28 DNV n.a. Carbonding Climate Community 3-Apr-12 PoA0068 PoA 30-Dec-99PoA 8

1176CPA0272.01 Sustainable Housing CPA in Mexico – N.1.11122010 Latin America North America Mexico CONAVI Replaced at Validation EE service EE service EE new buildings Solar water heating systems+CFLs 1 0.1 10 10 0.0 10-Dec-12 0.005 1.310 DNV n.a. Carbonding Climate Community 3-Apr-12 CPA0068.01 30-Dec-99 8 0 0.521 0.0 Yes N/A MSC 0.131 0.131 0.131 0.131 0.131 0.131 0.131 0.131 0.131 0.131

1177PoA0273 G47U9J5DOIE44PYCTWWANOP4UI7E1K Renewable Power Advancement Programme Interregional Interregional United Arab Emirates Balderrie Energies Validation Terminated Solar Solar Solar & wind & other ACM2 1 45.8 1-May-12 28 0.000 457.800 ERM CVS 0.000 n.a. Balderrie 4-Apr-12 CPA 31-Dec-99CPA 5 9 11 40.0

1178CPA0273.01 40 MW solar PV power plant in Prince Abdul Aziz bin Mousaed Economic City Middle-East Arabian Peninsula Saudi Arabia Hail Balderrie Energies Validation Terminated Solar Solar Solar PV ACM2 1 45.8 0.0 10 30 0.0 1-Jan-14 0.000 457.800 ERM CVS n.a. Balderrie 4-Apr-12 30-Dec-99 5 7 9 3 40.0 70000 0.654 No Prevailing practice Foik 45.780 45.780 45.780 45.780 45.780 45.780 45.780 45.780 45.780 45.780

1179PoA0274 IIKNA11XGI879ERK1P5YCXBC75EONJ 7887 NuPlanet Small Scale Hydropower PoA Africa Southern Africa South Africa NuPlanet Registered Hydro Hydro Run of river AMS-I.D. 1 24.4 4-Apr-12 28 0.000 243.530 Carbon Check 0.000 n.a. Promethium Carbon 4-Apr-12 19-Sep-12 20-Dec-12 21-Dec-12 CPA 31-Dec-99CPA 5 2 10 9 4.4

1180CPA0274.01 7887-0001 NuPlanet Small Scale Hydropower PoA - CPA1Stortemelk Africa Southern Africa South Africa Free State NuPlanet Registered Hydro Hydro Existing dam AMS-I.D. 1 24.4 10 30 0.0 1-May-14 0.000 243.530 Carbon Check n.a. Promethium Carbon 4-Apr-12 21-Dec-12 30-Dec-99 5 2 10 9 0 4.4 29564 1.021 No Investment 3 16.359 24.539 24.539 24.539 24.539 24.539 24.539 24.539 27.702 27.702

1181PoA0275 IEDW92WLY4YEAVP9FUKUA7OH2UWSFK 9296 South African Large Scale Grid Connected Solar Park Programme Africa Southern Africa South Africa South Africa Registered Solar Solar Solar PV ACM2 1 65.6 1-Mar-13 28 0.000 514.352 Carbon Check 0.000 n.a. Blue World Carbon 5-Apr-12 31-Oct-12 27-Dec-12 26-Jul-13 2-Jan-13 CPA 31-Dec-99CPA 5 9 4 3 25.0

1182CPA0275.01 9296-0001 Africa Southern Africa South Africa Northern Cape Lylaserve Registered Solar Solar Solar PV Several arrays of photovoltaic panels ACM2 1 65.6 7 30 0.0 1-Mar-13 0.000 514.352 Carbon Check n.a. Blue World Carbon 5-Apr-12 2-Jan-13 30-Dec-99 5 9 4 3 1 Jinko Solar China 25.0 66395 0.988 No N/A Foik 68.873 68.332 67.771 67.220 66.669 66.118 65.567 65.016 64.465 63.914

1183PoA0276 3DUV380INDN8GFUEQIWBYDB1VJNWYQ The programme to introduce renewable energy system into Seoul Asia & Pacific East Asia South Korea Seoul Seoul Metropolitan Government Replaced At Validation Solar Solar Solar PV AMS-I.C.+AMS-I.F. 7-Jun-10 28 KSA n.a. Seoul Metropolitan Government 26-Mar-11 7-Apr-12 PoA0079 PoA 30-Dec-99CPA 8 9 8 1

1184CPA0276.01 Asia & Pacific East Asia South Korea Seoul Seoul Metropolitan Government Replaced At Validation Solar Solar Solar PV PV systems to buildings AMS-I.C.+AMS-I.F. 1 0.0 10 0.0 19-Apr-11 0.039 0.223 KSA n.a. Seoul Metropolitan Government 26-Mar-11 7-Apr-12 CPA0079.01 30-Dec-99 8 9 8 1 0 33 0.679 No N/A MSC 0.022 0.022 0.022 0.022 0.022 0.022 0.022 0.022 0.022 0.022

1185PoA0277 48SOJ7O9ARDY5QUPM4CC6EOWS6WLI6 9265 Top Third Ventures Stove Programme Africa East Africa Kenya Kenya Top Third Ventures Registered EE households EE households Stoves AMS-II.G. 1 34.8 1-Feb-13 28 0.476 347.650 BV Cert 0.000 n.a. Green World Campaign 7-Apr-12 25-Jun-12 27-Dec-12 8-May-13 27-Dec-12 PoA 30-Dec-99PoA 4 1 6 0.0

1186CPA0277.01 9265-0001 Top Third Ventures Stove Programme CPA KE001 Africa East Africa Kenya Rift Valley Top Third Ventures Registered EE households EE households Stoves Baker technology AMS-II.G. 1 34.8 10 0.0 27-Dec-12 0.476 347.650 BV Cert n.a. Green World Campaign 7-Apr-12 27-Dec-12 30-Dec-99 4 1 6 -1 No N/A MSC 6.559 26.237 39.356 39.356 39.356 39.356 39.356 39.356 39.356 39.356 1187PoA0278 OE7LV7443YR8ROH2CL3MROQZMV03ZZ 9411 Chilean Small Scale Renewable Energy Programme of Activities (PoA) Latin America South America Chile Chile Carbon Capital Inc. y Cia. Registered Solar Solar Solar & wind & other AMS-I.D. 1 18.1 1-Mar-13 28 0.000 126.736 Carbon Check 0.000 n.a. Carbon Capital inc. y Cia. Limitada 14-Apr-12 14-Jun-12 29-Dec-12 12-Jul-13 31-Dec-12 CPA 31-Dec-99CPA 9 7 8.0

1188CPA0278.01 9411-0001 Latin America South America Chile Region II Carbon Capital Inc. y Cia. Registered Solar Solar Solar PV AMS-I.D. 1 18.1 7 35 0.0 31-Dec-13 0.000 126.736 Carbon Check n.a. Carbon Capital inc. y Cia. Limitada 14-Apr-12 31-Dec-12 30-Dec-99 9 7 0 8.0 23004 0.702 No 18.091 18.091 18.091 18.091 18.091 18.091 18.091

1189PoA0279 541LD84SYRTTXZMOCN23DL5DJWDZDD 8868 Grid Connect Solar PV Power Generation Plant Programme Asia & Pacific East Asia China China Registered Solar Solar Solar PV ACM2 12 668.7 14-Apr-12 28 0.000 3,982.925 BV Cert 0.000 Japan (Carbon Capital Management) KOE Environmental Consultancy 14-Apr-12 1-Oct-12 18-Dec-12 18-Dec-12 CPA 31-Dec-99CPA 1 10 11 5 500.0

1190CPA0279.01 8868-0001 Asia & Pacific East Asia China Inner Mongolia Registered Solar Solar Solar PV Polycrystalline silicon solar cells ACM2 1 13.2 7 25 0.0 15-Feb-13 0.000 104.127 BV Cert Japan (Carbon Capital Management) KOE Environmental Consultancy 14-Apr-12 18-Dec-12 30-Dec-99 1 10 11 5 0 10.0 14636 0.896 No Financial 3 4.370 13.111 13.111 13.111 13.111 13.111 13.111 8.741

1191CPA0279.02 8868-0002 Asia & Pacific East Asia China Inner Mongolia Registered Solar Solar Solar PV Grid connected Solar PV plant ACM2 1 67.1 7 25 0.0 1-Feb-15 397.115 BV Cert KOE Environmental Consultancy 14-Apr-12 4-Feb-15 30-Dec-99 1 10 11 5 0 50.0 74904 0.896 No Financial 3 61.513 67.105 67.105 67.105 67.105 67.105 67.105 5.592

1192CPA0279.03 8868-0003 Asia & Pacific East Asia China Gansu Province Registered Solar Solar Solar PV Grid connected Solar PV plant ACM2 1 71.5 7 25 0.0 1-Feb-15 423.005 BV Cert KOE Environmental Consultancy 14-Apr-12 4-Feb-15 30-Dec-99 1 10 11 5 0 50.0 79735 0.896 No Financial 3 65.523 71.480 71.480 71.480 71.480 71.480 71.480 5.957

1193CPA0279.04 8868-0004 Asia & Pacific East Asia China Gansu Province Registered Solar Solar Solar PV Grid connected Solar PV plant ACM2 1 63.3 7 25 0.0 1-Feb-15 374.757 BV Cert KOE Environmental Consultancy 14-Apr-12 4-Feb-15 30-Dec-99 1 10 11 5 0 50.0 70650 0.896 No Financial 3 63.327 63.327 63.327 63.327 63.327 63.327 63.327

1194CPA0279.05 8868-0005 Asia & Pacific East Asia China Registered Solar Solar Solar PV Grid connected Solar PV plant ACM2 1 27.7 7 25 0.0 1-Feb-15 164.095 BV Cert KOE Environmental Consultancy 14-Apr-12 4-Feb-15 30-Dec-99 1 10 11 5 0 20.0 30936 0.896 No Financial 3 25.418 27.729 27.729 27.729 27.729 27.729 27.729 2.311

1195CPA0279.06 8868-0006 Asia & Pacific East Asia China Gansu Province Registered Solar Solar Solar PV Grid connected Solar PV plant ACM2 1 65.2 7 25 0.0 1-Feb-15 386.119 BV Cert KOE Environmental Consultancy 14-Apr-12 4-Feb-15 30-Dec-99 1 10 11 5 0 50.0 72792 0.896 No Financial 3 65.247 65.247 65.247 65.247 65.247 65.247 65.247

1196CPA0279.07 8868-0007 Asia & Pacific East Asia China Registered Solar Solar Solar PV Grid connected Solar PV plant ACM2 1 23.3 7 25 0.0 1-Feb-15 137.926 BV Cert KOE Environmental Consultancy 14-Apr-12 4-Feb-15 30-Dec-99 1 10 11 5 0 20.0 26003 0.896 No Financial 3 21.365 23.307 23.307 23.307 23.307 23.307 23.307 1.942

1197CPA0279.08 8868-0008 Asia & Pacific East Asia China Gansu Province Registered Solar Solar Solar PV Grid connected Solar PV plant ACM2 1 69.1 7 25 0.0 1-Feb-15 408.636 BV Cert KOE Environmental Consultancy 14-Apr-12 4-Feb-15 30-Dec-99 1 10 11 5 0 50.0 77187 0.896 No Financial 3 63.297 69.052 69.052 69.052 69.052 69.052 69.052 5.754

1198CPA0279.09 8868-0009 Wulan 20MW Grid Connected Solar PV Power Generation Project Asia & Pacific East Asia China Qinghai Province Registered Solar Solar Solar PV Grid connected Solar PV plant ACM2 1 28.0 7 25 0.0 1-Feb-15 165.592 BV Cert KOE Environmental Consultancy 14-Apr-12 4-Feb-15 30-Dec-99 1 10 11 5 0 20.0 31111 0.896 No Financial 3 25.650 27.982 27.982 27.982 27.982 27.982 27.982 2.332

1199CPA0279.10 8868-0010 Asia & Pacific East Asia China Gansu Province Registered Solar Solar Solar PV Grid connected Solar PV plant ACM2 1 41.3 7 25 0.0 1-Feb-15 244.553 BV Cert KOE Environmental Consultancy 14-Apr-12 4-Feb-15 30-Dec-99 1 10 11 5 0 30.0 45117 0.896 No Financial 3 37.881 41.325 41.325 41.325 41.325 41.325 41.325 3.443

1200CPA0279.11 8868-0011 Asia & Pacific East Asia China Gansu Province Registered Solar Solar Solar PV Grid connected Solar PV plant ACM2 1 131.5 7 25 0.0 1-Feb-15 777.925 BV Cert KOE Environmental Consultancy 14-Apr-12 4-Feb-15 30-Dec-99 1 10 11 5 0 100.0 145259 0.896 No Financial 3 120.500 131.455 131.455 131.455 131.455 131.455 131.455 10.954

1201CPA0279.12 8868-0012 Asia & Pacific East Asia China Gansu Province Registered Solar Solar Solar PV Grid connected Solar PV plant ACM2 1 67.4 7 25 0.0 1-Feb-15 399.073 BV Cert KOE Environmental Consultancy 14-Apr-12 4-Feb-15 30-Dec-99 1 10 11 5 0 50.0 75530 0.896 No Financial 3 61.817 67.436 67.436 67.436 67.436 67.436 67.436 5.619

1202PoA0280 HIZS2UA9SIYFJSBKU6SGY82XXCRCXO 9164 Installation of Energy Efficient Transformers (IEET) Africa East Africa Kenya Kenya Additional Energy Registered Energy distribution Energy distribution Efficient electricity distribution AM67 1 23.0 1-Jul-13 28 0.000 172.815 JCI 0.000 n.a. United K. (Standard Bank) Kenya Power and Lighting Company 17-Apr-12 25-Jun-12 19-Jun-14 22-Aug-14 19-Jun-14 PoA 30-Dec-99PoA 10 5 7 9 0.0

1203CPA0280.01 9164-0001 IEET/CPA-001/KENYA/KPLC Africa East Africa Kenya Kenya Additional Energy Registered Energy distribution Energy distribution Efficient electricity distribution EE transformers AM67 1 23.0 7 28 0.0 1-Jul-13 0.000 172.815 JCI n.a. Kenya Power and Lighting Company 17-Apr-12 19-Jun-14 30-Dec-99 10 5 7 9 0 0.651 No Prevailing practice Foik 32.000 32.000 32.000 32.000 32.000 32.000 32.000

1204PoA0281 4GOM79QFZBIAS51NT6FJBIAFIF2T82 10004 City of Cape Town Landfill Gas Extraction and Utilisation Programme Africa Southern Africa South Africa Cape Town City of Cape Town Registered Landfill gas Landfill gas Landfill power ACM1 1 34.1 28-Nov-11 28 0.000 212.976 Carbon Check 0.000 n.a. SLR Consulting 17-Apr-12 16-Oct-12 17-Jul-14 1-Nov-14 16-Sep-14 CPA 31-Dec-99CPA 1 6 11 5 2.0

1205CPA0281.01 10004-0001 Landfill Gas Extraction and Utilisation at Coastal Park Landfill Africa Southern Africa South Africa Western Cape City of Cape Town Registered Landfill gas Landfill gas Landfill power Landfill gas collection and combustion ACM1 1 34.1 7 21 3.8 1-Oct-14 0.000 212.976 Carbon Check n.a. SLR Consulting 17-Apr-12 16-Sep-14 30-Dec-99 1 6 11 5 -2 2.0 15040 0.923 No 27.000 110.000 112.000 115.000 118.000 121.000 125.000 90.000

1206PoA0282 8HR26510NZ6W16Q6TGFWG87ZK44K7N 9217 AeroPod Composting and Co-composting Programme in Malaysia. Asia & Pacific Southeast Asia Malaysia Malaysia Natural Objective Sdn Bhd Registered Methane avoidance Methane avoidance Palm oil waste AMS-III.F. 1 16.7 20-Apr-12 28 0.000 133.722 TÜV-Rhein 0.000 Netherlands (Carbon Partners Asiatica) Carbon Partners Asiatica 20-Apr-12 14-Aug-12 26-Dec-12 27-Dec-12 CPA 30-Dec-99CPA 2 9 3 0.0

1207CPA0282.01 9217-0001 AeroPod Co-composting Programme for Silimpopon Mill in Sabah Asia & Pacific Southeast Asia Malaysia Sabah Natural Objective Sdn Bhd Registered Methane avoidance Methane avoidance Palm oil waste Co-composting of palm oil waste AMS-III.F. 1 16.7 7 10 2.0 27-Dec-12 0.000 133.722 TÜV-Rhein Netherlands (Carbon Partners Asiatica) Carbon Partners Asiatica 20-Apr-12 27-Dec-12 30-Dec-99 2 9 3 0 No 5.000 9.000 12.000 15.000 17.000 18.000 20.000 21.000 22.000 23.000

1208PoA0283 NIPF5RRFPIJB9Q89LNDCRQWB51GBXQ 9007 Distribution of Improved Cook Stoves in Sub-Saharan Africa Africa West Africa Senegal Registered EE households EE households Stoves AMS-II.G. 1 39.1 20-Apr-12 28 19.045 329.415 TÜV-SÜD 0.000 Netherlands (C-Quest Capital) HED Consulting 20-Apr-12 30-Aug-12 25-Apr-13 26-Sep-13 25-Apr-13 PoA 30-Dec-99PoA 6 11 9 4 8 0.0 Plist

1209CPA0283.01 9007-0001 Africa West Africa Senegal Senegal Registered EE households EE households Stoves Fuel efficient cook stoves AMS-II.G. 1 39.1 7 21 0.0 1-Aug-12 19.045 329.415 TÜV-SÜD Netherlands (C-Quest Capital) HED Consulting 20-Apr-12 25-Apr-13 30-Dec-99 4 8 6 9 1 Eco-Zoom China 1.8 No Investment Plist 46.000 46.000 46.000 46.000 46.000 46.000 46.000

1210PoA0284 W6OCJJWDBAR74SYCUOYJQUVYFWR6R9 Organic waste composting programme of activities Latin America South America Chile Chile Carbon United Validation Terminated Methane avoidance Methane avoidance Composting AM25 1 0.5 1-Dec-12 28 0.000 4.041 Carbon Check 0.000 n.a. Carbon United 20-Apr-12 CPA 31-Dec-99CPA 2 5 9 7 11 0.0

1211CPA0284.01 EL TUME Compost Plant Latin America South America Chile Region IX Carbon United Validation Terminated Methane avoidance Methane avoidance Composting Composting of organic waste AM25 1 0.5 7 25 0.0 1-Jan-13 0.000 4.041 Carbon Check n.a. Carbon United 20-Apr-12 30-Dec-99 2 5 1 No Financial;Technological 0.000 0.000 0.000 1.000 1.000 1.000 1.000

1212PoA0285 Z69C4FM2X9XEKARMM5H4RWH5OFOIP2 8432 Latin America South America Brazil Brazil WayCarbon Registered Wind Wind Wind ACM2 1 39.0 1-Feb-13 28 0.000 195.002 TÜV-Nord 0.000 n.a. WayCarbon 20-Apr-12 9-Nov-12 29-Nov-12 24-Jan-13 12-Dec-12 CPA 31-Dec-99CPA 5 10 9 28.8

1213CPA0285.01 8432-0001 Marco dos Ventos I Wind Power Plant Latin America South America Brazil Maranhão WayCarbon Registered Wind Wind Wind 28.8 MW Wind power plant ACM2 1 39.0 7 20 0.0 1-Jan-16 0.000 195.002 TÜV-Nord n.a. WayCarbon 20-Apr-12 12-Dec-12 30-Dec-99 5 10 9 0 28.8 158858 0.394 No Financial 63.000 63.000 63.000 63.000 63.000 63.000 63.000

1214PoA0286 PNHJCCF6XLDIUN53DPEIFIITXZFKEW 9251 PV Project Development in Chile Latin America South America Chile Chile C-Quest Capital Registered Solar Solar Solar PV ACM2 2 407.7 20-Apr-12 28 0.879 3,267.465 TÜV-SÜD 245.275 Sweden (C-Quest Capital) SolarChile 20-Apr-12 13-Dec-12 27-Dec-12 28-Dec-12 CPA 31-Dec-99CPA 5 9 7 171.2

1215CPA0286.01 9251-0001 PV Project in La Tirana, Chile Latin America South America Chile Region I C-Quest Capital Registered Solar Solar Solar PV ACM2 1 80.2 7 20 0.0 28-Dec-12 0.879 642.755 TÜV-SÜD Sweden (C-Quest Capital) SolarChile 20-Apr-12 28-Dec-12 30-Dec-99 5 9 7 -5 First Solar Chile 30.2 90340 0.749 No Prevailing practice 33.420 80.207 80.207 80.207 80.207 80.207 80.207 80.207 80.207 80.207 46.787

1216CPA0286.02 9251-0002 CPA Luz del Norte Latin America South America Chile Region I C-Quest Capital Registered Solar Solar Solar PV ACM2 1 327.5 7 20 0.0 28-Dec-12 2,624.711 TÜV-SÜD 245.275 245.275 18-Oct-17 31-Oct-16 SolarChile 20-Apr-12 17-Aug-15 30-Dec-99 5 9 7 -5 First Solar Chile 141.0 382108 No Prevailing practice 321.951 321.951 321.951 321.951 321.951 321.951 321.951

1217PoA0287 QCNYK1IBZ7DNBRTE3OMKFE4ET3ANZV 7522 Standard Bank Renewable Energy Programme Africa West Africa Ghana Standard Bank Promotion of RE Registered Hybrid renewables Hybrid renewables Solar & wind & other ACM2 1 1.1 22-May-12 28 0.000 10.740 JCI 0.000 n.a. ecosur afrique 20-Apr-12 11-Sep-12 1-Oct-12 30-Nov-12 2-Oct-12 CPA 31-Dec-99CPA 8 11 6 9 9.8

1218CPA0287.01 7522-0001 Africa West Africa Ghana Upper West Standard Bank Registered Solar Solar Solar PV 4 PV units ACM2 1 1.1 10 20 0.0 1-Jan-13 0.000 10.740 JCI n.a. ecosur afrique 20-Apr-12 10-Feb-12 30-Dec-99 8 11 6 9 5 -2 9.8 22574 0.396 No 9.000 9.000 9.000 9.000 9.000 9.000 9.000 9.000 9.000 9.000

1219PoA0288 AXTGCKVZGH2J8VRPAZ2QLFFTHBYIUN Small Scale Biomass Power Plants in Thailand Asia & Pacific Southeast Asia Thailand Thailand CarbonBW (Thailand) Limited Electricity generation from rE Validation Terminated Biomass energy Biomass energy Agricultural residues: rice husk AMS-I.D. 1 25.8 21-Apr-12 28 25.813 258.130 SQS 0.000 n.a. Full Advantage 21-Apr-12 CPA 30-Dec-99CPA 9 8 12 5 7.51220CPA0288.01 B2En Sukhothai Biomass-fired Power Plant project Asia & Pacific Southeast Asia Thailand Sukothai CarbonBW (Thailand) Limited Validation Terminated Biomass energy Biomass energy Agricultural residues: rice husk Steam turbine AMS-I.D. 1 25.8 10 20 0.0 1-Jan-12 25.813 258.130 SQS n.a. Full Advantage 21-Apr-12 30-Dec-99 5 10 8 9 4 0 7.5 53547 0.511 No Financial 26.000 26.000 26.000 26.000 26.000 26.000 26.000 26.000 26.000 26.000

1221PoA0289 IMIIXP1X6B5Q9D8KZ2FX7O494T1G96 9634 Africa East Africa Burundi Burundi Burundi Quality Stoves Reduction of CO2 emissions Registered EE households EE households Stoves AMS-I.E. 1 168.3 15-Apr-12 28 41.137 1,374.751 TÜV-Rhein 0.000 Switzerland (Vitol) ecosur afrique 21-Apr-12 12-Dec-12 15-May-13 19-Oct-13 2-Dec-13 PoA 30-Dec-99PoA 1 11 8 6 0.0 Plist

1222CPA0289.01 9634-0001 Africa East Africa Burundi Bujumbura Mairie Burundi Quality Stoves Registered EE households EE households Stoves Improved cook stoves AMS-I.E. 1 168.3 7 21 0.0 1-Nov-12 41.137 1,374.751 TÜV-Rhein Switzerland (Vitol) ecosur afrique 21-Apr-12 2-Dec-13 30-Dec-99 1 11 8 6 9 3 Turkey No Plist 41.000 247.000 247.000 247.000 247.000 247.000 247.000 206.000

1223PoA0290 W3M1UNKLOJFFO8GJE9JCV62SUXPEV8 Small-Scale Renewable Electricity Advancement Programme Interregional Interregional Saudi Arabia Balderrie Increasing share of RE Validation Terminated Wind Wind Solar & wind & other AMS-I.F.+AMS-I.D. 1 15.7 1-May-12 28 0.000 156.960 ERM CVS 0.000 n.a. 21-Apr-12 CPA 31-Dec-99CPA 5 9 11 10.0

1224CPA0290.01 10 MW Wind Power Project near Zalm Middle-East Arabian Peninsula Saudi Arabia Mekkah Balderrie Validation Terminated Wind Wind Wind Six 1,65 MW wind turbines AMS-I.D. 1 15.7 10 30 0.0 1-Jan-14 0.000 156.960 ERM CVS n.a. 21-Apr-12 30-Dec-99 5 4 11 9 1 10.0 27000 0.654 No Prevailing practice 16.000 16.000 16.000 16.000 16.000 16.000 16.000 16.000 16.000 16.000

1225PoA0291 HJCFHR4E103PM0PS05Z5P9PACOW0XM 9299 Renewable Energy Programme of Activities in Middle East and North Africa Interregional Interregional Saudi Arabia CES Carbon Services Development of RE projects Registered Solar Solar Solar & wind ACM2 1 1.3 1-Sep-12 28 0.014 10.089 re-consult 0.000 Ireland (CES Carbon Services) Swiss Carbon Asset 25-Apr-12 9-Dec-12 28-Dec-12 6-Jun-13 28-Dec-12 CPA 31-Dec-99CPA 4 5 8 10 11 9 1.1

1226CPA0291.01 9299-0001 1 MW Solar Project at Bahrah, Saudi Arabia (CPA Saudi Arabia 1) Middle-East Arabian Peninsula Saudi Arabia Bahrah CES Carbon Services Registered Solar Solar Solar PV Polycrystalline photovoltaic panels ACM2 1 1.3 7 25 0.0 28-Dec-12 0.014 10.089 re-consult Ireland (CES Carbon Services) Swiss Carbon Asset 25-Apr-12 28-Dec-12 30-Dec-99 5 8 9 3 1.1 1926 0.654 No N/A MSC 1.259 1.259 1.259 1.259 1.259 1.259 1.259 1227PoA0292 X41MUSW1HFACI7LE7UC5ZLE8BJZ914 7893 Standard Bank MSW Composting Programme Africa West Africa Ghana Ghana Standard Bank Reduction of methane emissions Registered Methane avoidance Methane avoidance Composting AM25 1 27.9 25-Apr-12 28 0.000 279.400 JCI 0.000 n.a. ecosur afrique 25-Apr-12 21-Dec-12 21-Dec-12 CPA 31-Dec-99CPA 5 6 3 9 1 11 0.0 MSC SUZ1228CPA0292.01 7893-0001 CPA001 Kumasi Composting Plant at Adagya Africa West Africa Ghana Ashanti Standard Bank Registered Methane avoidance Methane avoidance Composting Sorting and aerobic-design composting AM25 1 27.9 10 20 6.0 1-Apr-13 0.000 279.400 JCI n.a. ecosur afrique 25-Apr-12 21-Dec-12 30-Dec-99 5 6 3 9 1 11 3 No MSC SUZ -1.000 4.000 11.000 21.000 29.000 34.000 38.000 42.000 44.000 46.000 12.000

1229PoA0293 UMM092OR6GP4H2EL4I36E05NKQ57V0 9431 Latin America South America Chile Chile Carbon Capital Inc. & Cia. Ltda. Promote development of RE projects Registered Solar Solar ACM2 1 191.1 1-Mar-13 28 0.000 1,259.390 Carbon Check 0.000 n.a. Carbon Capital Inc. y Cia. Limitada 25-Apr-12 1-Aug-12 30-Dec-12 12-Jul-13 31-Dec-12 CPA 31-Dec-99CPA 10 7 110.0

1230CPA0293.01 9431-0001 Latin America South America Chile Region II Carbon Capital Inc. & Cia. Ltda. Registered Solar Solar Solar PV 445,500 solar modules ACM2 1 191.1 7 25 28.5 1-Jun-14 0.000 1,259.390 Carbon Check n.a. Carbon Capital Inc. y Cia. Limitada 25-Apr-12 31-Dec-12 30-Dec-99 10 7 1 Jinko Solar China SMA Germany 110.0 297042 0.787 No 21.237 84.948 180.515 233.608 233.608 233.608 233.608 116.804

1231PoA0294 54SKKU9CY6SBZIOHTGNU7JZ4UZ5KAM 9315 Biomass Renewable Energy Programme of Activities Latin America South America Chile Chile BIOENERGIAS FORESTALES Increased use of RE+displace fossil fuels Withdrawn Biomass energy Biomass energy Agricultural residues: other kinds ACM6 1 36.2 25-Feb-13 28 0.000 284.456 Carbon Check 0.000 n.a. Bioenergías Forestales 25-Apr-12 18-Oct-12 27-Dec-12 Withdrawn CPA 31-Dec-99Both 5 8 9 1.0

1232CPA0294.01 9315-0001 Biomass fired heat and power plant at Papeles Cordillera S.A Latin America South America Chile Metropolitan Region BIOENERGIAS FORESTALES Withdrawn Biomass energy Biomass energy Forest residues: other Co-generation plant ACM6 1 36.2 7 10 0.0 25-Feb-13 0.000 284.456 Carbon Check n.a. Bioenergías Forestales 25-Apr-12 Withdrawn 30-Dec-99 5 8 9 1 USA Energent USA 1.0 7140 0.481 No Financial;Technological 91.000 91.000 91.000 91.000 91.000 91.000 91.000 91.000 91.000 91.000

1233PoA0295 AKHRI0CVA6GK1DGRGIREDRNPVIADS8 Methane avoidance in closed landfill and/or individual cells Programme of Activity Latin America South America Chile Chile Carbon United Validation Terminated Landfill gas Landfill gas Landfill composting AMS-III.AX. 1 0.1 1-Dec-12 28 0.000 0.510 Carbon Check 0.000 n.a. Carbon United 26-Apr-12 CPA 30-Dec-99CPA 1 5 9 0.0

1234CPA0295.01 Los Olivos individual cells MOL Project Latin America South America Chile Los Lagos Carbon United Validation Terminated Landfill gas Landfill gas Landfill composting Methane oxidation layer AMS-III.AX. 1 0.1 10 25 1-Jan-13 0.000 0.510 Carbon Check n.a. Carbon United 26-Apr-12 30-Dec-99 1 5 9 3 No 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000

1235PoA0296 KA7UGD2G2NZGAY4SDAGNUHFHY15ASZ Capture and combustion of Methane in coal mines Africa Southern Africa South Africa South Africa Validation Terminated Coal bed/mine methane Coal bed/mine methane Coal Mine Methane ACM8 1 180.2 31-Dec-12 28 0.000 1,441.726 Carbon Check 0.000 United K. (Gregory Services) 26-Apr-12 CPA 31-Dec-99CPA 1 3 5 0.0

1236CPA0296.01 Makahado Coal Mine Methane Gas Flaring Project Africa Southern Africa South Africa Limpopo Validation Terminated Coal bed/mine methane Coal bed/mine methane Coal Mine Methane ACM8 1 180.2 7 21 1-Jan-13 0.000 1,441.726 Carbon Check United K. (Gregory Services) 26-Apr-12 30-Dec-99 1 3 5 0 1.040 No 105.000 210.000 210.000 210.000 210.000 210.000 210.000

1237PoA0297 LMQL4ZT04JRV5L6U0OXLUDNT5ASFMV 9441 Africa West Africa Nigeria Nigeria Icimi Registered EE households EE households EE public buildings AMS-II.J. 1 28.9 1-Mar-13 28 0.000 288.920 Carbon Check 0.000 n.a. ICIMI 26-Apr-12 10-Oct-11 31-Dec-12 12-Jul-13 31-Dec-12 PoA 30-Dec-99PoA Gold Standard 6 9 0.0 0.630

1238CPA0297.01 9441-0001 Africa West Africa Nigeria Nigeria Icimi Registered EE households EE households Lighting CFLs AMS-II.J. 1 28.9 10 10 1-Mar-13 0.000 288.920 Carbon Check n.a. ICIMI 26-Apr-12 31-Dec-12 30-Dec-99 6 9 3 Icimi Ltd United K. 0.625 35.9 No Financial;Other Plist 37.069 34.539 32.010 29.481 26.951 24.422 21.893 19.799 0.000 0.000

1239PoA0298 LBX8597WY96BIROQHOK0MC4HYCOIL3 Energy efficiency in new buildings in the P. R. of China Asia & Pacific East Asia China China Validation Terminated EE service EE service EE public buildings AMS-II.E. 1 0.1 1-Jun-12 28 0.037 0.640 BV Cert 0.000 n.a. Climate Focus 27-Apr-12 PoA 30-Dec-99CPA 4 9 0.0

1240CPA0298.01 Asia & Pacific East Asia China Fujian, Xiamen Validation Terminated EE service EE service EE public buildings AMS-II.E. 1 0.1 10 20 0.0 1-Jun-12 0.037 0.640 BV Cert n.a. Climate Focus 27-Apr-12 30-Dec-99 4 9 0 0.1 No N/A MSC 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000

1241PoA0299 7DLW421WP4TG4ISYXILUUS8TO0HUIQ 9495 Asia & Pacific East Asia China China Withdrawn Landfill gas Landfill gas Landfill power AMS-III.G.+AMS-I.D. 1 31.9 1-May-12 28 2.563 319.250 SGS 0.000 n.a. First Climate 27-Apr-12 PoA0221 1-Dec-12 31-Dec-12 CPA 31-Dec-99CPA 5 8 2.0

1242CPA0299.01 9495-0001 CPA-01: Shangrao MSW landfill site LFG recovery to power project Asia & Pacific East Asia China Jiangxi Withdrawn Landfill gas Landfill gas Landfill power AMS-III.G.+AMS-I.D. 1 31.9 10 19 3.4 1-Nov-12 2.563 319.250 SGS n.a. First Climate 27-Apr-12 CPA0221.01 30-Dec-99 5 8 0 2.0 6980 0.724 No Financial 3.000 19.000 22.000 25.000 28.000 31.000 34.000 37.000 40.000 43.000 38.000

1243PoA0300 DASBAJQEXMUBIAZ8EW97E84X6UKNAO 8259 Zhongying Changjiang Small-scale Hydropower Programme of Activities Asia & Pacific East Asia China China Registered Hydro Hydro Run of river AMS-I.D. 1 22.0 27-Apr-12 28 0.000 159.613 CEC 0.000 n.a. Innovative Carbon Investment 27-Apr-12 1-Oct-12 18-Nov-12 19-Jan-13 28-Nov-12 CPA 31-Dec-99CPA 10 8 5 9 8.0 MSC

1244CPA0300.01 8259-0001 Asia & Pacific East Asia China Yunnan Registered Hydro Hydro Run of river AMS-I.D. 1 22.0 7 20 0.0 1-Oct-13 0.000 159.613 CEC n.a. Innovative Carbon Investment 27-Apr-12 28-Nov-12 30-Dec-99 10 8 5 9 0 8.0 34795 0.632 No Financial MSC 22.000 22.000 22.000 22.000 22.000 22.000 22.000

1245PoA0301 B8ZIOPGC0FIFR05589PW6TCPY97OE2 Renewable Energy PoA in the Philippines Asia & Pacific Southeast Asia Philippines Philippines American Orient Capital Partners At Validation Biomass energy Biomass energy Solar & wind & other AMS-I.D. 1 20.9 24-Apr-12 28 0.000 209.280 PJRCES 0.000 n.a. American Orient Capital Partners 28-Apr-12 CPA 31-Dec-99Both 5 10 9 5.0

1246CPA0301.01 5 MW Rice Husk Fired Power Plant in Aurora, Isabela, Philippines Asia & Pacific Southeast Asia Philippines American Orient Capital Partners At Validation Biomass energy Biomass energy Agricultural residues: rice husk Rice husk fired power plant AMS-I.D. 1 20.9 10 10 0.0 1-Jul-13 0.000 209.280 PJRCES n.a. American Orient Capital Partners 28-Apr-12 30-Dec-99 1 3 5 9 11 4 0 5.0 37440 0.474 No Investment 10.000 21.000 21.000 21.000 21.000 21.000 21.000 21.000 21.000 21.000 10.000

1247PoA0302 91TRX2YRI718RLBVTB9HUA1K5XJUYJ 9136 Landfill gas capture, flaring and utilization program in Africa Africa Interregional Ghana Puresphere Limited Registered Landfill gas Landfill gas Landfill power ACM1 1 103.2 20-Mar-12 21 6.443 835.044 JCI 0.000 n.a. ClimaLoop 28-Apr-12 20-Dec-12 16-May-14 16-May-14 CPA 31-Dec-99CPA 5 11 1 7 2.0

1248CPA0302.01 9136-0001 CPA-1: Oti Landfill gas capture, flaring and utilization at Kumasi (Ghana) Africa West Africa Ghana Ashanti, Ghana Puresphere Limited Registered Landfill gas Landfill gas Landfill power ACM1 1 103.2 7 21 3.5 1-Dec-12 6.443 835.044 JCI n.a. ClimaLoop 28-Apr-12 16-May-14 30-Dec-99 5 11 1 7 0 2.0 13714 0.542 No 77.000 80.000 92.000 94.000 95.000 97.000 98.000

1249PoA0303 I6OG6YIHO03L5SDOD4X118PDAY3659 8058 HuaQi Livestock Farms Methane Engineering Programme of Activities Asia & Pacific East Asia China Registered Methane avoidance Methane avoidance Manure 1 5.3 28-Apr-12 28 0.000 42.775 CEC 0.000 n.a. Innovative Carbon Investment 28-Apr-12 7-Sep-12 6-Nov-12 4-Jan-13 6-Nov-12 CPA 31-Dec-99PoA 5 6 9 8 0.0 MSC

1250CPA0303.01 8058-0001 Asia & Pacific East Asia China Hunan Registered Methane avoidance Methane avoidance Manure 1 5.3 7 15 0.0 1-Jan-13 0.000 42.775 CEC n.a. Innovative Carbon Investment 28-Apr-12 6-Nov-12 30-Dec-99 5 6 9 8 -1 0.724 No Investment MSC 5.000 5.000 5.000 5.000 5.000 5.000 5.000

1251PoA0304 ZYZTGFOSHOVXI6ERNUHT57TX12YLU4 Installation of energy efficient ventilation fans Africa Southern Africa South Africa South Africa Nedbank Limited Validation Terminated EE industry EE industry Mining AMS-II.C. 1 58.5 30-Apr-12 28 0.000 585.120 DNV 0.000 n.a. Promethium Carbon 28-Apr-12 CPA 31-Dec-99CPA 1 3 9 5 6 0.0

1252CPA0304.01 Africa Southern Africa South Africa North-Eastern Nedbank Limited Validation Terminated EE industry EE industry Mining EE ventilation fans AMS-II.C. 1 58.5 10 10 0.0 1-Jan-13 0.000 585.120 DNV n.a. Promethium Carbon 28-Apr-12 30-Dec-99 1 3 9 5 6 -1 No Investment 59.000 59.000 59.000 59.000 59.000 59.000 59.000 59.000 59.000 59.000

1253PoA0305 O0F8A3I3QB06QX1B6MY1IL10MEB50K ALUPAR Renewable Energy Programme Latin America South America Brazil Brazil AMBIO Replaced At Validation Hydro Hydro Run of river ACM2 23-Apr-12 28 RINA n.a. AMBIO 30-Apr-12 1-Sep-12 CPA 31-Dec-99PoA 4 5 8

1254CPA0305.01 ALUPAR - Água Limpa SHP Latin America South America Brazil Minas Gerais AMBIO Replaced At Validation Hydro Hydro Run of river Run of river plant ACM2 1 49.4 7 30 0.0 1-Jan-13 0.000 395.239 RINA n.a. AMBIO 30-Apr-12 1-Sep-12 30-Dec-99 4 5 8 0 23.0 159555 0.310 No Investment 49.000 49.000 49.000 49.000 49.000 49.000 49.000

1255PoA0306 TTOUR6NFBFOTIK24VSMLZ0K3SY810J 8630 Africa Southern Africa South Africa South Africa The Carbon Protocol of SA Registered Solar Solar Solar PV ACM2 1 18.2 1-May-12 28 0.000 182.410 DNV 0.000 n.a. Promethium Carbon 1-May-12 20-Sep-12 14-Dec-12 18-Dec-12 CPA 31-Dec-99CPA 8 5 11 1 3 10.0 No

1256CPA0306.01 8630-0001 Africa Southern Africa South Africa NorthWest Province The Carbon Protocol of SA Registered Solar Solar Solar PV Solar panels ACM2 1 18.2 10 30 -0.0 9-Jan-15 0.000 182.410 DNV n.a. Promethium Carbon 1-May-12 18-Dec-12 30-Dec-99 8 5 11 1 3 3 10.0 20045 1.016 18.655 18.561 18.468 18.377 18.285 18.194 18.103 18.012 17.922 17.832

1257PoA0307 8VJM0QGXO3L9ILYI45FEC06NV17J4X 9558 Africa East Africa Malawi Tete and Zambezia C-Quest Capital Registered EE households EE households Stoves AMS-II.G. 5 206.3 30-Apr-12 28 6.766 1,190.315 TÜV-SÜD 0.000 250.845 253.503 26-Jan-16 15-Apr-17 HED Consulting, C Quest Capital 1-May-12 25-Jan-13 13-Mar-14 25-Mar-14 13-Mar-14 PoA 30-Dec-99PoA 4 8 6 9 0.0

1258CPA0307.01 9558-0001 Africa East Africa Malawi Tete and Zambezia C-Quest Capital Registered EE households EE households Stoves Ecozoom Dura ICS AMS-II.G. 1 38.9 7 21 0.0 1-Aug-12 6.766 327.250 TÜV-SÜD 0.000 111.294 111.294 26-Jan-16 15-Apr-17 HED Consulting, C Quest Capital 1-May-12 13-Mar-14 30-Dec-99 4 8 6 9 0 60.0 No N/A MSC 16.239 16.239 16.239 16.239 16.239 16.239 16.239

1259CPA0307.02 9558-0002 Africa East Africa Malawi Entire country C-Quest Capital Registered EE households EE households Stoves TLC Rocket Stove AMS-II.G. 1 38.9 7 21 0.0 15-Oct-14 241.552 TÜV-SÜD 0.000 83.401 83.401 26-Jan-16 15-Apr-17 HED Consulting, C Quest Capital 1-May-12 10-Dec-14 30-Dec-99 4 8 6 9 0 No N/A MSC 38.857 38.857 38.857 38.857 38.857 38.857 38.857

1260CPA0307.03 9558-0003 Africa East Africa Malawi Entire country C-Quest Capital Registered EE households EE households Stoves TLC Rocket Stove AMS-II.G. 1 38.9 7 21 0.0 15-Oct-14 241.552 TÜV-SÜD 56.150 56.150 5-Oct-17 15-Apr-17 HED Consulting, C Quest Capital 1-May-12 10-Dec-14 30-Dec-99 4 8 6 9 0 No N/A MSC 38.857 38.857 38.857 38.857 38.857 38.857 38.857

1261CPA0307.04 9558-0004 Africa East Africa Malawi Entire country C-Quest Capital Registered EE households EE households Stoves TLC Rocket Stove AMS-II.G. 1 44.9 7 21 0.0 7-Oct-16 189.980 TÜV-SÜD 2.658 2.658 5-Oct-17 15-Apr-17 HED Consulting, C Quest Capital 1-May-12 6-Oct-16 30-Dec-99 4 8 6 9 0 No N/A MSC 44.853 44.853 44.853 44.853 44.853 44.853 44.853

1262CPA0307.05 9558-0005 Africa East Africa Malawi Entire country C-Quest Capital Registered EE households EE households Stoves AMS-II.G. 1 44.9 7 21 0.0 7-Oct-16 189.980 TÜV-SÜD 5-Oct-17 15-Apr-17 HED Consulting, C Quest Capital 1-May-12 6-Oct-16 30-Dec-99 4 8 6 9 0 N/A MSC 44.853 44.853 44.853 44.853 44.853 44.853 44.853

1263PoA0308 P4EZSJ0APY6UE7287ESA8790YGLFME 6864 Fuel Efficient Stoves in Zambia Africa Southern Africa Zambia Zambia 3 Rocks Ltd. Registered EE households EE households Stoves AMS-II.G. 3 122.1 22-Dec-10 21 0.000 908.981 TÜV-SÜD 0.000 163.789 163.789 10-Jun-16 27-Jan-17 TÜV-SÜD Sweden (Government of Sweden) 3 Rocks Ltd. 1-May-12 15-Apr-11 28-Jan-13 16-Aug-13 28-Jan-13 PoA 30-Dec-99PoA 4 8 6 5 0.0 Plist Yes

1264CPA0308.01 6864-0001 Fuel Efficient Stoves in Zambia (3RL CPA No.01) Africa Southern Africa Zambia 3 Rocks Ltd. Registered EE households EE households Stoves ICS AMS-II.G. 1 40.7 7 21 0.0 1-Jan-13 0.000 325.583 TÜV-SÜD 69.598 69.598 10-Jun-16 27-Jan-17 TÜV-SÜD Sweden (Government of Sweden) 3 Rocks Ltd. 1-May-12 28-Jan-13 PoA 30-Dec-99PoA 4 8 6 5 9 0 180.0 No Plist Yes 46.712 46.712 46.712 46.712 46.712 46.712 46.712

1265CPA0308.02 6864-0002 Fuel Efficient Stoves in Zambia (3RL CPA No.02) Africa Southern Africa Zambia 3 Rocks Ltd. Registered EE households EE households Stoves ICS AMS-II.G. 1 40.7 7 21 0.0 1-Nov-13 0.000 291.699 TÜV-SÜD 57.391 57.391 10-Jun-16 27-Jan-17 TÜV-SÜD Sweden (Government of Sweden) 3 Rocks Ltd. 1-May-12 1-Nov-13 PoA 30-Dec-99PoA 4 8 6 5 9 0 No N/A Plist 40.684 40.684 40.684 40.684 40.684 40.684 40.684 1266CPA0308.03 6864-0003 Fuel Efficient Stoves in Zambia (3RL CPA No.03) Africa Southern Africa Zambia 3 Rocks Ltd. Registered EE households EE households Stoves ICS AMS-II.G. 1 40.7 7 21 0.0 1-Nov-13 0.000 291.699 TÜV-SÜD 36.800 36.800 10-Jun-16 27-Jan-17 TÜV-SÜD Sweden (Government of Sweden) 3 Rocks Ltd. 1-May-12 1-Nov-13 PoA 30-Dec-99PoA 4 8 6 5 9 0 No N/A Plist 40.684 40.684 40.684 40.684 40.684 40.684 40.684 1267PoA0309 44D3EYF9433O195ZFWZM8Q1VTVVG75 CDM Africa Sustainable Energy Programme Africa Interregional Senegal Zambia, Malawi C-Quest Capital Replaced At Validation EE households EE households Stoves AMS-I.E. 30-Apr-12 28 TÜV-SÜD n.a. HED Consulting, C Quest Capital 1-May-12 9-Feb-13 PoA 31-Dec-99PoA 4 8 6 9 5

1268CPA0309.01 CDM Africa Sustainable Energy Programme in Dakar, Senegal CPA-001 Africa West Africa Senegal Dakar C-Quest Capital Replaced At Validation EE households EE households Stoves EcoZoom Dura ICS AMS-I.E. 1 138.6 10 10 0.0 1-Aug-12 57.733 1,385.590 TÜV-SÜD n.a. HED Consulting, C Quest Capital 1-May-12 9-Feb-13 30-Dec-99 4 8 6 9 5 0 No Investment;Other 138.559 138.559 138.559 138.559 138.559 138.559 138.559 138.559 138.559 138.559

1269PoA0310 07IVK61B3YJZ830VFI148O40OB8BTQ Compressed Air Energy Efficiency PoA Africa Southern Africa South Africa South Africa Nedbank Validation Terminated EE industry EE industry Mining AMS-II.D. 1 26.8 30-Apr-12 28 0.000 268.320 DNV 0.000 n.a. Nedbank 1-May-12 CPA 31-Dec-99CPA 10 5 0.0

1270CPA0310.01 CPA 1 under PoA ‘Compressed Air Energy Efficiency PoA’ Africa Southern Africa South Africa Nedbank Validation Terminated EE industry EE industry Mining Compressed air energy efficiency AMS-II.D. 1 26.8 10 20 0.0 1-Jan-14 0.000 268.320 DNV n.a. Nedbank 1-May-12 30-Dec-99 10 5 3 11.0 No 26.832 26.832 26.832 26.832 26.832 26.832 26.832 26.832 26.832 26.832

1271PoA0311 J059M6ER9FJW6BLWZUYM8C74UL057U Green Power for East Africa Programme Africa East Africa Kenya Uganda Kenya, Uganda Standard Bank At Validation Hybrid renewables Hybrid renewables Solar & wind & hydro ACM2 1 101.8 20-Sep-11 28 0.000 1,017.700 JCI 0.000 n.a. Standard Bank of South Africa 2-May-12 CPA 31-Dec-99CPA 1 4 5 11 3 40.5

1272CPA0311.01 Isiolo Wind CPA-001 (“IW CPA-001”). Africa East Africa Kenya Eastern region Standard Bank At Validation Wind Wind Wind 1.5 MW wind turbines ACM2 1 101.8 10 20 0.0 1-Jan-13 0.000 1,017.700 JCI n.a. Standard Bank of South Africa 2-May-12 30-Dec-99 1 3 6 5 3 40.5 165086 0.620 No 101.770 101.770 101.770 101.770 101.770 101.770 101.770 101.770 101.770 101.770

1273PoA0312 7C0F2GMJ2TWTY6OTKJ2U2JMSJ00NL1 8640 Energy Efficient Cook stoves in South Africa Africa Southern Africa South Africa South Africa Clean Air Renewable Energy Registered EE households EE households Stoves AMS-II.G. 1 31.6 4-May-12 28 0.000 251.483 TÜV-Rhein 0.000 n.a. 4-May-12 28-Aug-12 10-Dec-12 25-Jan-13 12-Dec-12 PoA 30-Dec-99CPA 1 6 4 5 8 11 0.0 Plist

1274CPA0312.01 8640-0001 Africa Southern Africa South Africa Eastern Cape Clean Air Renewable Energy Registered EE households EE households Stoves ICS in 11242 households AMS-II.G. 1 31.6 7 10 0.0 15-Jan-13 0.000 251.483 TÜV-Rhein n.a. 4-May-12 12-Dec-12 30-Dec-99 1 6 4 5 8 11 0 No Plist 34.381 31.576 31.576 31.576 31.576 31.576 31.576 31.576 31.576 31.576

1275PoA0313 9R2Y94IFSW03BU0VPJFARVVVPBSR5D 8949 National Programme for Improved Cookstoves in India Asia & Pacific Southern Asia India India Registered EE households EE households Stoves AMS-II.G. 1 46.8 30-Apr-12 28 0.000 468.140 TÜV-SÜD 0.000 n.a. 9-May-12 16-Aug-12 20-Dec-12 11-Jun-13 28-Dec-12 2 PoA 30-Dec-99Both 8 6 4 9 5 11 0.0 Plist

1276CPA0313.01 8949-0001 CPA No. 001, “SAMUHA” Asia & Pacific Southern Asia India Karnataka Registered EE households EE households Stoves CHULIKA ICS in 21500 households AMS-II.G. 1 46.8 10 10 0.0 1-Aug-13 0.000 468.140 TÜV-SÜD n.a. 9-May-12 28-Dec-122 30-Dec-99 8 6 4 9 5 11 0 175.0 No Plist 4 15.605 46.814 46.814 46.814 46.814 46.814 46.814 46.814 46.814 46.814 31.209

1277PoA0314 6YC4C29L8PVSD6LM48WHU2LI1LPQ94 National CDM Programme for Solar Energy Lebanon Fertile Crescent Lebanon Lebanon At Validation Solar Solar Solar water heating AMS-I.J. 1 2.6 3-May-12 28 0.000 26.080 LRQA 0.000 Switzerland (Mercuria Energy Trading) Green Pact Sal 10-May-12 PoA 30-Dec-99PoA 1 4 0.0

1278CPA0314.01 National CDM project for Solar Energy Lebanon- Residential CPA 1 Fertile Crescent Lebanon Lebanon At Validation Solar Solar Solar water heating AMS-I.J. 1 2.6 10 15 0.0 31-Dec-12 0.000 26.080 LRQA Switzerland (Mercuria Energy Trading) Green Pact Sal 10-May-12 30-Dec-99 1 4 0 GFL Lebanon 0.3 No N/A MSC 2.608 2.608 2.608 2.608 2.608 2.608 2.608 2.608 2.608 2.608

1279PoA0315 4BLM59JBXPPCQ4EWTLKHGPYMMGJW5L 8261 Welspun Renewable Energy Program Asia & Pacific Southern Asia India India Registered Hybrid renewables Hybrid renewables Solar & Wind ACM2+AMS-I.D. 1 37.7 12-May-12 28 0.000 292.813 TÜV-Rhein 0.000 n.a. n.a. 12-May-12 11-Oct-12 6-Nov-12 28-Dec-12 19-Nov-12 CPA 31-Dec-99CPA 5 9 10 4 8 25.0

1280CPA0315.01 8261-0001 Grid Connected Solar PV Power Project in Neemuch, Madhya Pradesh Asia & Pacific Southern Asia India Madhya Pradesh Registered Solar Solar Solar PV ACM2+AMS-I.D. 1 37.7 7 25 -0.2 31-Mar-13 0.000 292.813 TÜV-Rhein n.a. n.a. 12-May-12 19-Nov-12 30-Dec-99 5 9 10 4 8 -1 25.0 40449 0.953 No Financial 3 38.544 38.351 38.160 37.969 37.779 37.590 37.402

1281PoA0316 WZ82P6CHV8127G6TPKP7Q29RJ67UG0 6825 Small Hydropower Programme of Activities in Albania and Serbia Europe & Central Asia Europe Albania Serbia Albania, Serbia enso hydro Registered Hydro Hydro Run of river+new dam AMS-I.D. 1 9.1 16-May-12 28 0.000 54.805 GLC 0.000 Austria (Energy Changes+denkstatt) enso hydro 16-May-12 24-Dec-12 31-Dec-12 28-Jun-13 31-Dec-12 CPA 31-Dec-99CPA 9 8 5 11 9.0

1282CPA0316.01 6825-0001 Small Hydropower PoA in Albania and Serbia- Lengarica Hydropower Project Europe & Central Asia Europe Albania Gjirokaster enso hydro Registered Hydro Hydro Run of river AMS-I.D. 1 9.1 7 35 0.0 1-Jan-15 0.000 54.805 GLC Austria (Energy Changes+denkstatt) enso hydro 16-May-12 31-Dec-12 30-Dec-99 9 8 5 11 0 9.0 32193 0.284 No Investment 9.130 9.130 9.130 9.130 9.130 9.130 9.130

1283PoA0317 EBLEOFIHTSK50V9JJ0AUDJY6N024L1 Southern African Fuel Switch Programme Africa Southern Africa South Africa Zimbabwe, Botswana Validation Terminated Biomass energy Biomass energy Agricultural residues: other kinds AMS-I.C. 1 53.7 1-Jul-13 28 0.000 537.270 DNV 0.000 n.a. n.a. 19-May-12 CPA 31-Dec-99CPA 5 9 0.0

1284CPA0317.01 CPA number 001: Impala Platinum Rustenburg SSC CPA Africa Southern Africa South Africa Limpopo Validation Terminated Biomass energy Biomass energy Biomass briquettes Switch from coal to biomass briquettes AMS-I.C. 1 53.7 10 28 0.0 1-Jul-13 0.000 537.270 DNV n.a. n.a. 19-May-12 30-Dec-99 5 9 0 No Prevailing practice Foik 26.863 53.727 53.727 53.727 53.727 53.727 53.727 53.727 53.727 53.727 26.864

1285PoA0318 AR0M0WD30GE01XRVP4WKRRAK0K8V9L 8742 South African Wind Power Projects Africa Southern Africa South Africa South Africa Carbon Protocol of South Africa n.a. Registered Wind Wind Wind ACM2 1 93.1 17-May-12 28 0.000 930.930 DNV 0.000 n.a. Cennergi 19-May-12 20-Sep-12 14-Dec-12 18-Dec-12 CPA 31-Dec-99CPA 3 10 11 5 40.0

1286CPA0318.01 8742-0001 CPA1 under PoA ‘South African Wind Power Projects’ Africa Southern Africa South Africa Western Cape Carbon Protocol of South Africa Registered Wind Wind Wind 26 wind turbines ACM2 1 93.1 10 20 0.0 1-Jan-14 0.000 930.930 DNV n.a. Cennergi 19-May-12 18-Dec-12 30-Dec-99 10 11 5 3 40.0 102300 0.910 No Prevailing practice 93.093 93.093 93.093 93.093 93.093 93.093 93.093 93.093 93.093 93.093

1287PoA0319 XNI2QDXFOLFJJUPZJUJ7HCMYMD491U 9188 Qinghai Province Solar PV Power Generation Programme Asia & Pacific East Asia China Qinghai Registered Solar Solar Solar PV ACM2 1 30.8 19-May-12 28 0.000 233.796 BV Cert 0.000 United K. (Blue World Carbon) n.a. 19-May-12 1-Dec-12 25-Dec-12 26-Apr-13 27-Dec-12 CPA 31-Dec-99CPA 5 9 1 20.0

1288CPA0319.01 9188-0001 Qinghai Province Solar PV Power Generation Programme-CPA1 Asia & Pacific East Asia China Wulan County Registered Solar Solar Solar PV ACM2 1 30.8 7 25 0.0 1-Jun-13 0.000 233.796 BV Cert United K. (Blue World Carbon) n.a. 19-May-12 27-Dec-12 30-Dec-99 1 5 -1 20.0 34369 0.896 No Prevailing practice 3 15.967 31.742 31.361 30.985 30.612 30.246 29.882 14.851

1289PoA0320 DRT35R0N987GB2AKUK886QYJCCY7QY 9416 Promotion of renewable energy generation in India- Programme of Activities Asia & Pacific Southern Asia India India Registered Hybrid renewables Hybrid renewables Solar & Wind ACM2 16 1,260.4 23-May-12 28 0.000 7,044.915 PJRCES 0.000 n.a. ReNew Wind Energy 23-May-12 12-Dec-12 31-Dec-12 12-Jul-13 31-Dec-12 CPA 30-Dec-99CPA 5 8 9 4 733.1

1290CPA0320.01 9416-0001 Wind Power Project at Bakhrani, Rajasthan Asia & Pacific Southern Asia India Rajasthan Registered Wind Wind Wind ACM2 1 48.6 10 25 0.0 1-Mar-13 0.000 485.850 PJRCES n.a. ReNew Wind Energy 23-May-12 31-Dec-12 30-Dec-99 5 9 4 1 Enercon Germany 25.6 50993 0.953 No Investment 3 48.952 48.952 48.952 48.952 48.952 48.952 48.952 48.952 48.952 48.952

1291CPA0320.02 9416-0002 Jamb Wind Power Project, Maharashtra Asia & Pacific Southern Asia India Maharashtra Registered Wind Wind Wind ACM2 1 47.0 7 20 0.0 1-Aug-14 0.000 301.663 PJRCES ReNew Wind Energy 23-May-12 4-Aug-14 30-Dec-99 5 9 4 -1 28.0 49301 0.953 No Investment 3

1292CPA0320.03 9416-0003 Vaspet-II and Vaspet III Wind Power Project, Maharashtra Asia & Pacific Southern Asia India Maharashtra Registered Wind Wind Wind ACM2 1 85.7 7 20 0.0 1-Aug-14 0.000 550.230 PJRCES ReNew Wind Energy 23-May-12 4-Aug-14 30-Dec-99 5 9 4 -1 49.5 89925 0.953 No Investment 3 46.974 46.974 46.974 46.974 46.974 46.974 46.974

1293CPA0320.04 9416-0004 Wind power project at Chikodi, Karnataka Asia & Pacific Southern Asia India Karnataka Registered Wind Wind Wind ACM2 1 33.3 7 20 0.0 20-Sep-14 209.005 PJRCES ReNew Wind Energy 23-May-12 30-Sep-14 30-Dec-99 5 9 4 -1 18.0 37073 0.897 No Investment 3 33.255 33.255 33.255 33.255 33.255 33.255 33.255

1294CPA0320.05 9416-0005 Welturi I wind power project in Maharashtra Asia & Pacific Southern Asia India Maharashtra Registered Wind Wind Wind ACM2 1 81.6 7 20 0.0 3-Oct-14 510.000 PJRCES ReNew Wind Energy 23-May-12 3-Oct-14 30-Dec-99 5 9 4 -1 50.4 85652 0.953 No Investment 3 81.609 81.609 81.609 81.609 81.609 81.609 81.609

1295CPA0320.06 9416-0006 Bhud wind power project, Maharashtra Asia & Pacific Southern Asia India Maharashtra Registered Wind Wind Wind ACM2 1 90.1 7 20 0.0 29-Dec-14 541.389 PJRCES ReNew Wind Energy 23-May-12 29-Dec-14 30-Dec-99 5 9 4 -1 49.5 94529 0.953 No Investment 3 90.067 90.067 90.067 90.067 90.067 90.067 90.067

1296CPA0320.07 9416-0007 Welturi II wind power project in Maharashtra Asia & Pacific Southern Asia India Maharashtra Registered Wind Wind Wind ACM2 1 42.1 7 20 0.0 8-Jan-14 293.771 PJRCES ReNew Wind Energy 23-May-12 8-Jan-15 30-Dec-99 5 9 4 -1 25.2 44 0.953 No Investment 3 42.066 42.066 42.066 42.066 42.066 42.066 42.066

1297CPA0320.08 9416-0008 Dangri Wind Power Project, Rajasthan Asia & Pacific Southern Asia India Rajasthan Registered Wind Wind Wind ACM2 1 48.8 7 20 0.0 1-Mar-15 285.203 PJRCES ReNew Wind Energy 23-May-12 23-Mar-15 30-Dec-99 5 9 4 -1 30.0 51246 0.953 No Investment 3 48.827 48.827 48.827 48.827 48.827 48.827 48.827

1298CPA0320.09 9416-0009 Vaspet-IV Wind Power Project, Maharashtra Asia & Pacific Southern Asia India Maharashtra Registered Wind Wind Wind ACM2 1 91.3 7 20 0.0 1-Apr-15 525.336 PJRCES ReNew Wind Energy 23-May-12 1-Apr-15 30-Dec-99 5 9 4 -1 49.5 95787 0.953 No Investment 3 91.265 91.265 91.265 91.265 91.265 91.265 91.265

1299CPA0320.10 9416-0010 Pratapgarh Wind Power Project, Rajasthan Asia & Pacific Southern Asia India Rajasthan Registered Wind Wind Wind ACM2 1 92.8 7 20 0.0 1-Jul-15 511.014 PJRCES ReNew Wind Energy 23-May-12 23-Jul-15 30-Dec-99 5 9 4 -1 51.0 97394 0.953 No Investment 3 92.796 92.796 92.796 92.796 92.796 92.796 92.796

1300CPA0320.11 9416-0011 Sheopur Solar Power Project, Madhya Pradesh Asia & Pacific Southern Asia India Madhya Pradesh Registered Solar Solar Solar PV ACM2 1 84.0 7 20 0.0 14-Sep-15 445.575 PJRCES ReNew Wind Energy 23-May-12 14-Sep-15 30-Dec-99 5 9 4 8 -1 50.0 88213 0.953 No 84.049 84.049 84.049 84.049 84.049 84.049 84.049

1301CPA0320.12 9416-0012 Bhesada Wind Power Project in Rajasthan Asia & Pacific Southern Asia India Rajasthan Registered Wind Wind Wind ACM2 1 192.8 7 20 0.0 31-Mar-16 916.784 PJRCES ReNew Wind Energy 23-May-12 31-Mar-16 30-Dec-99 5 9 4 -1 100.8 202306 0.984 No Investment 192.757 192.757 192.757 192.757 192.757 192.757 192.757

1302CPA0320.13 9416-0013 Mandsaur Wind Power Project in Madhya Pradesh Asia & Pacific Southern Asia India Madhya Pradesh Registered Wind Wind Wind ACM2 1 86.6 7 20 0.0 15-Mar-16 415.723 PJRCES ReNew Wind Energy 23-May-12 1-Apr-16 30-Dec-99 5 9 4 -1 55.2 90900 0.984 No Investment 86.609 86.609 86.609 86.609 86.609 86.609 86.609

1303CPA0320.14 9416-0014 Rajgarh Wind Power Project in Rajasthan Asia & Pacific Southern Asia India Rajasthan Registered Wind Wind Wind ACM2 1 73.5 7 20 0.0 2-May-16 343.083 PJRCES ReNew Wind Energy 23-May-12 2-May-16 30-Dec-99 5 9 4 -1 50.4 77130 0.984 No Investment 73.489 73.489 73.489 73.489 73.489 73.489 73.489

1304CPA0320.15 9416-0015 Lingasugur Wind Power Project in Karnataka Asia & Pacific Southern Asia India Karnataka Registered Wind Wind Wind ACM2 1 72.8 7 25 0.0 31-Jul-16 321.845 PJRCES ReNew Wind Energy 23-May-12 5-Aug-16 30-Dec-99 5 9 4 -1 40.0 567994 0.897 No Investment 72.784 72.784 72.784 72.784 72.784 72.784 72.784

1305CPA0320.16 9416-0016 ReNew Solar Power Project in AP Asia & Pacific Southern Asia India Andhra Pradesh Registered Solar Solar Solar PV ACM2 1 89.6 7 20 0.0 1-Sep-16 388.444 PJRCES ReNew Wind Energy 23-May-12 28-Sep-16 30-Dec-99 5 9 4 -1 60.0 99914 0.897 No Investment 89.622 89.622 89.622 89.622 89.622 89.622 89.622

1306PoA0321 7RY6JXGNIQCVK5IX3XMX8K48484C8L 8132 Latin America North America Mexico Mexico Registered Methane avoidance Methane avoidance Waste water AMS-III.H.+AMS-I.C. 1 5.2 15-May-12 28 0.000 52.430 LGAI 0.000 n.a. n.a. 23-May-12 15-Jun-12 29-Jan-13 14-Jun-13 29-Jan-13 CPA 30-Dec-99CPA 1 3 6 2 0.0 85.680 85.680 85.680 85.680 85.680 85.680 85.680

1307CPA0321.01 8132-0001 Advanced wastewater treatment system at Casa San Matias Latin America North America Mexico Jalisco Registered Methane avoidance Methane avoidance Waste water AMS-III.H.+AMS-I.C. 1 5.2 10 10 0.0 29-Jan-13 0.000 52.430 LGAI n.a. n.a. 23-May-12 29-Jan-13 30-Dec-99 2 11 5 0 Yes Investment 4 4.806 5.243 5.243 5.243 5.243 5.243 5.243 5.243 5.243 5.243 5.243 0.437

1308PoA0322 GJR46OV14DM5X59NJ4ROU1ZVCWXWW9 9071 TATS Solar Lantern Programme of Activities Africa East Africa Kenya Kenya Total Access to Solar (TATS) scaling up the deployment of solar lanterns Registered Solar EE households Solar lamps AMS-III.AR. 1 13.8 1-Aug-12 28 0.000 138.230 ERM CVS 0.000 n.a. TOTAL Kenya 23-May-12 7-Nov-12 31-Dec-12 28-Jun-13 31-Dec-12 PoA 30-Dec-99CPA 10 9 8 5 0.0 Plist

1309CPA0322.01 9071-0001 TATS Solar Lantern Programme of Activities Kenya – CPA-01 Africa East Africa Kenya Many Total Access to Solar (TATS) Registered Solar EE households Solar lamps Solar laterns AMS-III.AR. 1 13.8 10 1 0.0 1-Feb-13 0.000 138.230 ERM CVS n.a. TOTAL Kenya 23-May-12 31-Dec-12 30-Dec-99 10 9 8 5 0 No Prevailing practice Plist 2.578 9.921 16.688 18.888 18.990 19.008 19.016 18.765 11.792 2.588 1310PoA0323 XK1XTB6G0XNK4UZVUPXS4E6DURQDIB 8864 Asia & Pacific Southern Asia India India Husk Power Systems Registered Biomass energy Biomass energy Agricultural residues: rice husk AMS-I.L. 1 0.2 24-May-12 28 0.000 2.150 ERM CVS 0.000 Switzerland (Shell trading) Husk Power System 24-May-12 22-Nov-12 24-Dec-12 26-Mar-13 24-Dec-12 PoA 30-Dec-99PoA 5 8 10 9 0.0

1311CPA0323.01 8864-0001 Asia & Pacific Southern Asia India Bihar Husk Power Systems Registered Biomass energy Biomass energy Agricultural residues: rice husk AMS-I.L. 1 0.2 10 20 0.0 1-Feb-13 0.000 2.150 ERM CVS Switzerland (Shell trading) Husk Power System 24-May-12 24-Dec-12 30-Dec-99 5 8 10 9 -1 0.0 0 No N/A MSC 0.215 0.215 0.215 0.215 0.215 0.215 0.215 0.215 0.215 0.215

1312PoA0324 INFBISBH5UBP51QR8YOTXQU3NA9H6A 8331 Implementation of Grid connected Wind Farm Projects in Chile Latin America South America Chile Chile Andes Mainstream SpA. Registered Wind Wind Wind ACM2 1 41.9 30-Dec-12 10 0.000 262.376 TÜV-Nord 0.000 n.a. AM Eolica Laguna Verde 25-May-12 18-Oct-12 22-Nov-12 23-Jan-13 29-Nov-12 CPA 31-Dec-99CPA 12 19.5

1313CPA0324.01 8331-0001 Laguna Verde Wind Farm Project Latin America South America Chile Region V Andes Mainstream SpA. Registered Wind Wind Wind 13 wind turbines of 1.5 MW ACM2 1 41.9 7 20 0.0 1-Oct-14 0.000 262.376 TÜV-Nord n.a. AM Eolica Laguna Verde 25-May-12 29-Nov-12 30-Dec-99 12 3 Goldwind China China 19.5 62725 0.694 No Investment 3 10.271 41.085 41.085 41.085 41.085 41.085 41.085 30.814

1314PoA0325 3XNAZBFBKNOTWIUN5PBVG6NIIV4AT9 9096 BWC Sustainable Biogas Recovery Programme of Activities in Indonesia Asia & Pacific Southeast Asia Indonesia Indonesia Blue World Carbon Registered Methane avoidance Methane avoidance Palm oil waste AMS-III.H.+AMS-I.D. 1 19.8 25-May-12 28 0.000 198.440 TÜV-Rhein 0.000 Netherlands (Blue World Carbon) Blue World Carbon 25-May-12 29-Oct-12 22-Dec-12 27-Mar-13 24-Dec-12 CPA 30-Dec-99CPA 3 1 4 5 9 11 1.0 MSC

1315CPA0325.01 9096-0001 CPA 1.1 – Maris – PTPN VII Biogas Project Asia & Pacific Southeast Asia Indonesia Lampung Blue World Carbon Registered Methane avoidance Methane avoidance Palm oil waste AMS-III.H.+AMS-I.D. 1 19.8 10 15 0.0 24-Dec-12 0.000 198.440 TÜV-Rhein Netherlands (Blue World Carbon) Blue World Carbon 25-May-12 24-Dec-12 30-Dec-99 3 1 4 5 9 11 3 1.0 3699 0.748 No Investment MSC 3 19.004 19.004 19.004 19.004 19.004 19.004 19.004 19.004 19.004 19.004

1316PoA0326 6L8UVZ5UFQXFVFNY0IA0DUB20NZ76P Oando Low Cost LPG Cook Stove Initiative Nigeria Africa West Africa Nigeria Nigeria Oando Marketing PLC At Validation EE households EE households Stoves AMS-II.C. 1 63.7 26-Apr-12 28 43.471 553.761 BV Cert 0.000 n.a. n.a. 30-May-12 PoA 30-Dec-99PoA 1 6 4 8 5 0.0

1317CPA0326.01 Oando Low Cost LPG Cook Stove Initiative in Lagos State Nigeria Africa West Africa Nigeria Lagos Oando Marketing PLC At Validation EE households EE households Stoves AMS-II.C. 1 63.7 7 21 16.3 26-Apr-12 43.471 553.761 BV Cert n.a. n.a. 30-May-12 30-Dec-99 1 6 4 8 5 0 No 5.292 19.306 40.822 69.897 103.624 103.624 103.624

1318PoA0327 VXH9U705A45MCCG3TNVJ0EG3WUIR70 8389 Asia & Pacific Southeast Asia Indonesia Indonesia PT. Riset Perkebunan Nusantara Registered Methane avoidance Methane avoidance Palm oil waste AMS-III.H.+AMS-I.D. 1 18.4 1-Oct-12 28 0.000 137.916 JCI 0.000 Japan (Shimizu) n.a. 31-May-12 29-Oct-12 1-Apr-13 27-Sep-13 29-Nov-13 CPA 30-Dec-99CPA 1 6 5 11 1.1

1319CPA0327.01 8389-0001 Asia & Pacific Southeast Asia Indonesia Jambi PT. Riset Perkebunan Nusantara Registered Methane avoidance Methane avoidance Palm oil waste AMS-III.H.+AMS-I.D. 1 18.4 7 14 0.0 1-Jul-13 0.000 137.916 JCI Japan (Shimizu) n.a. 31-May-12 29-Nov-13 30-Dec-99 1 6 5 11 -2 1.1 5255 0.743 No Investment 3 7.985 15.970 15.970 15.970 15.970 15.970 15.970 7.985

1320PoA0328 KNHXXFXXY9ZRBIH7QE1ECLKDPVNFTN 9160 Solar PV Power Development Programme in Shandong Province Asia & Pacific East Asia China Shandong Promote RE development in Shandong Registered Solar Solar Solar PV AMS-I.F.+AMS-I.D. 1 8.9 31-May-12 28 0.000 71.651 ERM CVS 0.000 United K. (Blue World Carbon) 31-May-12 1-Oct-12 27-Dec-12 26-Apr-13 27-Dec-12 CPA 30-Dec-99CPA 5 8 1 7.1

1321CPA0328.01 9160-0001 “Datang Qingyun Solar PV Power Project” CPA-001 Asia & Pacific East Asia China Qingyun County Registered Solar Solar Solar PV AMS-I.F.+AMS-I.D. 1 8.9 7 25 0.0 27-Dec-12 0.000 71.651 ERM CVS United K. (Blue World Carbon) 31-May-12 27-Dec-12 30-Dec-99 1 8 5 -1 7.1 9977 0.896 No N/A MSC 4.469 8.938 8.938 8.938 8.938 8.938 8.938 4.469

1322PoA0329 7C97KOCS4E6UOHDY2L5AEZO768R64G Biomass Based Thermal Energy Projects Asia & Pacific Southeast Asia Malaysia Malaysia Integra Carbon Sdn Bhd At Validation Biomass energy Biomass energy Agricultural residues: other kinds AMS-I.C.+AMS-III.E. 1 57.0 25-May-12 28 0.000 570.430 GHD 0.000 Canada (Landfill Gas Canada) n.a. 31-May-12 CPA 31-Dec-99CPA 5 8 1.01323CPA0329.01 Asia & Pacific Southeast Asia Malaysia Johor Bahru Integra Carbon Sdn Bhd At Validation Biomass energy Biomass energy Palm oil solid waste AMS-I.C.+AMS-III.E. 1 57.0 10 20 0.0 1-Sep-13 0.000 570.430 GHD Canada (Landfill Gas Canada) n.a. 31-May-12 30-Dec-99 5 8 -1 1.0 0.683 No Investment 3 57.043 57.043 57.043 57.043 57.043 57.043 57.043 57.043 57.043 57.043

1324PoA0330 O2DIKHRHCHBBLIONKXRRF7KGZBEX3T 9683 Implementation of Grid connected Solar Photovoltaic Power Projects in Chile Latin America South America Chile Chile Andes Mainstream SpA Registered Solar Solar Solar PV ACM2 1 134.9 1-Oct-12 7 0.000 888.829 TÜV-Nord 0.000 n.a. n.a. 2-Jun-12 22-May-13 12-Jun-13 31-Jan-14 6-Dec-13 CPA 31-Dec-99CPA 12 75.0

1325CPA0330.01 9683-0001 Almonte Solar PV Project Latin America South America Chile Tamarugal province Andes Mainstream SpA Registered Solar Solar Solar PV ACM2 1 134.9 7 25 -0.5 1-Jun-14 0.000 888.829 TÜV-Nord n.a. n.a. 2-Jun-12 6-Dec-13 30-Dec-99 11 12 2 75.0 148691 0.707 No Investment 3 62.667 106.355 105.823 105.294 104.767 104.243 103.722 43.001

1326PoA0331 DXXKB9VLEA3F7Z90H8GVO6SP6W4EKR 6386 Renewable Energy Carbon Programme for Africa (RECPA) Africa Southern Africa South Africa South Africa Carbon Africa Limited Registered Hybrid renewables Hybrid renewables Solar & wind ACM2 1 132.5 2-Jun-12 28 0.000 1,325.260 ERM CVS 0.000 n.a. n.a. 2-Jun-12 31-Oct-12 24-Dec-12 28-Dec-12 CPA 31-Dec-99CPA 5 9 11 82.5

1327CPA0331.01 6386-0001 Haverfontein 82.5 MW Wind Power Project (CPA-001) Africa Southern Africa South Africa Mpumalanga Carbon Africa Limited Registered Wind Wind Wind ACM2 1 132.5 10 20 0.0 1-Mar-15 0.000 1,325.260 ERM CVS n.a. n.a. 2-Jun-12 28-Dec-12 30-Dec-99 5 9 11 3 Goldwind China China 82.5 140180 0.970 No Investment 3 111.104 132.526 132.526 132.526 132.526 132.526 132.526 132.526 132.526 132.526 21.422 1328PoA0332 H1J0SGF4SESWDA5FMY9ZLC2GRG1R59 Philippine Electric Vehicle Project Asia & Pacific Southeast Asia Philippines Philippines At Validation Transport Transport More efficient vehicles AMS-III.S. 1 11.1 12-Jun-12 28 0.000 111.110 RINA 0.000 n.a. n.a. 2-Jun-12 PoA 30-Dec-99PoA 12 5 0.0

1329CPA0332.01 Quezon City Electric Tricycle Project Asia & Pacific Southeast Asia Philippines Quezon City At Validation Transport Transport More efficient vehicles Electric tricycles AMS-III.S. 1 11.1 10 10 0.0 15-Mar-13 0.000 111.110 RINA n.a. n.a. 2-Jun-12 30-Dec-99 12 5 0 Yes Investment 11.111 11.111 11.111 11.111 11.111 11.111 11.111 11.111 11.111 11.111

1330PoA0333 V873XEPINC8Q0QX3JYA3LJ2DQJAC1P 8678 Green Commercial Vehicles Projects Asia & Pacific Southeast Asia Malaysia Malaysia Integra Carbon Sdn Bhd Registered Transport Transport More efficient vehicles AMS-III.S. 1 2.9 25-May-12 28 0.000 29.170 BV Cert 0.000 Canada (Landfill Gas Canada) n.a. 6-Jun-12 7-Sep-12 12-Jun-13 12-Oct-13 12-Jun-13 CPA 31-Dec-99PoA 1 8 7 9 5 11 0.0

1331CPA0333.01 8678-0001 Green Vessel Project (2OSV 4331142-1) Asia & Pacific Southeast Asia Malaysia East Malaysia Integra Carbon Sdn Bhd Registered Transport Transport More efficient vehicles AMS-III.S. 1 2.9 10 30 0.0 1-Jan-14 0.000 29.170 BV Cert Canada (Landfill Gas Canada) n.a. 6-Jun-12 12-Jun-13 30-Dec-99 1 8 7 9 5 11 1 Wartsila Finland No Foik 17.919 17.919 17.919 17.919 17.919 17.919 17.919 17.919 17.919 17.919 1332PoA0334 QDBLUHD97L3GBJJ20D01J20MTXLC3K Thermal Energy Production Based on Solar Energy and Waste Heat Recovery Asia & Pacific East Asia China China Marukyu Shanghai Environment Validation Terminated Solar Solar Solar thermal AMS-III.Q.+AMS-I.J. 1 3.8 1-Dec-12 28 0.312 37.500 BV Cert 0.000 Japan (J-TEC) n.a. 6-Jun-12 CPA 31-Dec-99CPA 11 5 0.0

1333CPA0334.01 Asia & Pacific East Asia China Jiangsu Marukyu Shanghai Environment Validation Terminated Solar Solar Solar water heating AMS-III.Q.+AMS-I.J. 1 3.8 10 15 0.0 1-Dec-12 0.312 37.500 BV Cert Japan (J-TEC) n.a. 6-Jun-12 30-Dec-99 11 5 0 0.749 No Investment 3.750 3.750 3.750 3.750 3.750 3.750 3.750 3.750 3.750 3.750

1334PoA0335 I62XFPVLU545X085PDI6L5ANE2ITSE 8535 Solar Energy Programme for South Africa Africa Southern Africa South Africa South Africa Carbon Protocol of South Africa Registered Solar Solar Solar thermal power ACM2 1 347.6 7-Jun-12 28 0.000 3,475.570 DNV 0.000 n.a. n.a. 7-Jun-12 20-Sep-12 4-Dec-12 18-Dec-12 CPA 31-Dec-99CPA 3 10 11 5 100.0

1335CPA0335.01 8535-0001 Solar Energy Programme for South Africa CPA 1 Africa Southern Africa South Africa Northern Cape Carbon Protocol of South Africa Registered Solar Solar Solar thermal power ACM2 1 347.6 10 25 0.0 1-Jan-16 0.000 3,475.570 DNV n.a. n.a. 7-Jun-12 18-Dec-12 30-Dec-99 3 10 11 5 0 100.0 381930 0.910 No Prevailing practice Foik 360.622 351.145 355.137 329.405 355.421 350.425 313.587 354.869 349.936 355.019

1336PoA0336 LQN17S3DJKV1VR5WKRLWSJ6OYU0QZS Bionersis Landfill Gas Flare & Energy Program in Chile Latin America South America Chile Chile Bionersis SA At Validation Landfill gas Landfill gas Landfill power ACM1 1 32.0 1-Jan-13 28 0.000 234.461 GHD 0.000 France (Bionersis) n.a. 7-Jun-12 PoA 30-Dec-99CPA 6 11 1 5 3 12 1.0

1337CPA0336.01 Bionersis Santiago Cerros La Leona Energy Landfill Gas Program in Chile CPA1 Latin America South America Chile Metropolitan Region Bionersis SA At Validation Landfill gas Landfill gas Landfill power ACM1 1 32.0 7 15 7.8 1-Sep-13 0.000 234.461 GHD France (Bionersis) n.a. 7-Jun-12 30-Dec-99 6 11 1 5 3 12 0 1.0 0.481 No Investment 4 2.543 14.922 21.923 28.600 34.891 40.686 46.079 34.051

1338PoA0337 CF7N6YM3O5OLN66WYW0MQRXVJ5I6E8 9801 Transport Programme of Activities in the Cement Industry, Chile Latin America South America Chile Chile Cementos Bicentenario Registered Transport Transport Mode shift: Road to rail AM90 1 5.7 1-Dec-12 28 0.000 34.042 PJRCES 0.000 n.a. n.a. 7-Jun-12 2-Oct-12 12-Dec-13 3-Oct-14 1-Aug-14 PoA 31-Dec-99CPA 1 6 9 8 11 0.0

1339CPA0337.01 9801-0001 Railway Project West Aconcagua River to Quilicura Latin America South America Chile Region V Cementos Bicentenario Registered Transport Transport Mode shift: Road to rail AM90 1 5.7 7 15 0.3 1-Jan-15 0.000 34.042 PJRCES n.a. n.a. 7-Jun-12 1-Aug-14 30-Dec-99 1 6 9 8 11 0 No Financial 3 3.388 3.899 4.142 4.349 4.566 4.795 5.010 1340PoA0338 PGPIE9H17E0EDZ4Q26NOQ0XAWDQGYW Bionersis Landfill Gas Flare & Energy Program in Argentina Latin America South America Argentina Argentina Bionersis SA At Validation Landfill gas Landfill gas Landfill flaring ACM1 1 64.6 1-Jan-13 28 0.000 473.632 GHD 0.000 France (Bionersis) n.a. 7-Jun-12 PoA 30-Dec-99CPA 11 1 6 3 5 8 2.0

1341CPA0338.01 Bionersis Rosario La Gallega Energy Landfill Gas Program in Argentina CPA1 Latin America South America Argentina Santa Fe Bionersis SA At Validation Landfill gas Landfill gas Landfill power ACM1 1 64.6 7 15 13.8 1-Sep-13 0.000 473.632 GHD France (Bionersis) n.a. 7-Jun-12 30-Dec-99 11 1 6 3 5 8 0 2.0 0.482 No Financial 4 17.333 55.631 59.211 62.627 65.903 69.060 72.118 49.993

1342PoA0339 GUTQFL4K6CLFVI5XRLH1HCC5FIV5DZ Wind Power Programme of Activities in India Asia & Pacific Southern Asia India India Inox Renewables Limited (IRL) At Validation Wind Wind Wind AMS-I.D.+ACM2 1 88.5 1-Jun-12 28 0.000 671.509 TÜV-Nord 0.000 n.a. n.a. 11-Jun-12 CPA 30-Dec-99PoA 5 11 10 50.01343CPA0339.01 Asia & Pacific Southern Asia India Rajasthan Inox Renewables Limited (IRL) At Validation Wind Wind Wind AMS-I.D.+ACM2 1 88.5 7 20 0.0 1-Jun-13 0.000 671.509 TÜV-Nord n.a. n.a. 11-Jun-12 30-Dec-99 5 11 10 0 Inox India 50.0 91980 0.962 No Investment 88.484 88.484 88.484 88.484 88.484 88.484 88.484

1344PoA0340 1KU9BE1IHM0D4XFJUGCPV3JJJQRQUB 8824 Programme for SSC Hydropower Plants in rural areas Asia & Pacific East Asia China China Registered Hydro Hydro Run of river+new dam AMS-I.D. 1 18.2 11-Jun-12 28 0.000 97.283 ERM CVS 0.000 n.a. n.a. 11-Jun-12 1-Sep-12 17-Dec-12 20-Dec-12 CPA 31-Dec-99CPA 10 9 5 6.0

1345CPA0340.01 8824-0001 Programme for SSC Hydropower Plants in rural areas, CPA # 1 Asia & Pacific East Asia China Sichuan Registered Hydro Hydro Run of river 6 MW run-of river hydro plant AMS-I.D. 1 18.2 7 20 0.0 1-Sep-15 0.000 97.283 ERM CVS n.a. n.a. 11-Jun-12 20-Dec-12 30-Dec-99 10 9 5 0 6.0 25164 0.724 No Investment 2 6.076 18.228 18.228 18.228 18.228 18.228 18.228 12.152

1346PoA0341 KJY9OPHA7HTZIV9WO00H8L64ESO4A5 Asia & Pacific East Asia China China Validation Terminated Hydro Hydro Run of river+New dam AMS-I.D. 1 18.8 8-Jun-12 28 0.000 122.602 ERM CVS 0.000 n.a. n.a. 11-Jun-12 CPA 31-Dec-99CPA 10 9 5 5.7

1347CPA0341.01 Asia & Pacific East Asia China Sichuan Validation Terminated Hydro Hydro Run of river 5.7 MW run-of river hydro plant AMS-I.D. 1 18.8 7 20 0.0 1-Jul-14 0.000 122.602 ERM CVS n.a. n.a. 11-Jun-12 30-Dec-99 10 9 5 0 5.7 26011 0.724 No Investment 3 18.842 18.842 18.842 18.842 18.842 18.842 18.842

1348PoA0342 ZUW7036S60AS8DYHHNRXNXSRB9WKFV 9059 Small Scale Renewable Energy Carbon Programme (SRECP) Africa Southern Africa South Africa South Africa Carbon Africa Limited Registered Hybrid renewables Hybrid renewables Solar & wind & hydro AMS-I.D. 1 23.4 12-Jun-12 28 0.000 149.971 ERM CVS 0.000 n.a. n.a. 12-Jun-12 29-Oct-12 21-Dec-12 28-Dec-12 CPA 31-Dec-99CPA 5 9 11 9.5

1349CPA0342.01 9059-0001 Toitdale Concentrated Photovoltaic Project (CPA-001) Africa Southern Africa South Africa Northern Cape Carbon Africa Limited Registered Solar Solar Solar PV AMS-I.D. 1 23.4 7 25 0.0 1-Aug-14 0.000 149.971 ERM CVS n.a. n.a. 12-Jun-12 28-Dec-12 30-Dec-99 5 9 11 12 3 Amonix USA USA 9.5 25006 0.970 No N/A MSC 9.850 23.545 23.451 23.354 23.258 23.160 25.061 13.790

1350PoA0343 XM9G8PJXI0U01SDE38OE0BTIN4MLCO 9432 Water Purifiers Programme in India Asia & Pacific Southern Asia India India Registered EE households EE households Appliances AMS-III.AV. 1 0.9 1-Sep-12 28 0.000 8.990 BV Cert 0.000 n.a. n.a. 13-Jun-12 22-Nov-12 30-Dec-12 25-Jun-13 30-Dec-12 CPA 30-Dec-99CPA SD Tool 3 6 8 9 4 0.0 MSC

1351CPA0343.01 9432-0001 CPA 001 – Water Purifiers programme in India Asia & Pacific Southern Asia India Maharashtra Registered EE households EE households Appliances AMS-III.AV. 1 0.9 10 10 0.0 30-Jan-13 0.000 8.990 BV Cert n.a. n.a. 13-Jun-12 30-Dec-12 30-Dec-99 SD Tool 3 6 8 9 4 0 No MSC 0.899 0.899 0.899 0.899 0.899 0.899 0.899 0.899 0.899 0.899

1352PoA0345 W859BW52MFVF7NGTON5Q8L4647QXEA 8963 BWC Wind Farm Power Programme of Activities in Viet Nam Asia & Pacific Southeast Asia Vietnam Vietnam Blue World Vietnam Registered Wind Wind Wind ACM2 1 49.0 13-Jun-12 28 0.000 342.917 TÜV-Rhein 0.000 Netherlands (Blue World Carbon) n.a. 13-Jun-12 28-Aug-12 20-Dec-12 21-Mar-13 CPA 31-Dec-99CPA 5 8 10 9 11 30.0

1353CPA0345.01 8963-0001 CPA B12001 – Phuong Mai 1 Wind Farm Asia & Pacific Southeast Asia Vietnam Binh Dinh Blue World Vietnam Registered Wind Wind Wind 12 2500 kW wind turbines ACM2 1 49.0 7 20 0.0 1-Jan-14 0.000 342.917 TÜV-Rhein Netherlands (Blue World Carbon) n.a. 13-Jun-12 21-Mar-13 30-Dec-99 5 8 10 9 11 1 Avantis Germany 30.0 89631 0.575 No Investment 3 48.969 48.969 48.969 48.969 48.969 48.969 48.969

1354PoA0346 2FNC3OVOZ4HWGQXSKVDJOBLOXLG0UM 9292 Wind Energy Project PoA Asia & Pacific Southern Asia India India Core CarbonX Solutions Registered Wind Wind Wind AMS-I.D. 4 83.5 12-Jun-12 20 0.218 736.732 TÜV-Rhein 0.000 n.a. n.a. 13-Jun-12 21-Dec-12 27-Dec-12 12-Jun-13 28-Dec-12 PoA 30-Dec-99PoA 1 3 5 9 46.2

1355CPA0346.01 9292-0001 10 MW wind CPA in Theni: CPA001 Asia & Pacific Southern Asia India Chennai Core CarbonX Solutions Registered Wind Wind Wind AMS-I.D. 1 19.9 10 10 0.0 28-Dec-12 0.218 198.790 TÜV-Rhein n.a. n.a. 13-Jun-12 28-Dec-12 30-Dec-99 9 5 4 11 -2 Kenersys India 10.0 22162 0.951 No Investment 3 19.879 19.879 19.879 19.879 19.879 19.879 19.879 19.879 19.879 19.879

1356CPA0346.02 9292-0002 7.2 MW wind CPA in Rajasthan: CPA002 Asia & Pacific Southern Asia India Rajasthan Core CarbonX Solutions Registered Wind Wind Wind AMS-I.D. 1 12.8 10 20 0.0 1-Sep-14 0.000 127.510 TÜV-Rhein n.a. 13-Jun-12 18-Jul-14 30-Dec-99 9 5 4 11 -2 India 7.2 13078 0.975 No Investment 3 12.751 12.751 12.751 12.751 12.751 12.751 12.751 12.751 12.751

1357CPA0346.03 9292-0003 Asia & Pacific Southern Asia India Maharashtra Core CarbonX Solutions Registered Wind Wind Wind AMS-I.D. 1 28.7 10 20 0.0 1-Mar-15 286.540 TÜV-Rhein n.a. 13-Jun-12 26-Feb-15 30-Dec-99 9 5 4 11 -2 India 15.0 29634 0.975 No Investment 3 28.654 28.654 28.654 28.654 28.654 28.654 28.654 28.654 28.654 28.654

1358CPA0346.04 9292-0004 14 MW wind CPA in Maharashtra: CPA 004 Asia & Pacific Southern Asia India Maharashtra Core CarbonX Solutions Registered Wind Wind Wind 7 wind turbines of 2 MW AMS-I.D. 1 22.2 7 20 0.0 1-Jun-15 123.892 TÜV-Rhein BMD Power Pvt. Limited 13-Jun-12 8-May-15 30-Dec-99 9 5 4 11 -2 Inox Wind India 14.0 22688 0.977 No Investment 3 22,167.000 22,167.000 22,167.000 22,167.000 22,167.000 ### ###

1359PoA0347 B89Z68MKCUBD4ADJ9H9BLFDQ6WP05T 9103 Asia & Pacific East Asia China Beijing Huayu Xinda Consultation Registered Methane avoidance Methane avoidance Manure 1 3.9 22-Dec-12 28 0.000 38.820 TÜV-Nord 0.000 n.a. n.a. 14-Jun-12 1-Nov-12 22-Dec-12 22-Dec-12 CPA 31-Dec-99PoA 1 3 6 5 8 0.1 MSC

1360CPA0347.01 9103-0001 Asia & Pacific East Asia China Anhui Beijing Huayu Xinda Consultation Registered Methane avoidance Methane avoidance Manure 1 3.9 10 15 0.0 1-Feb-13 0.000 38.820 TÜV-Nord n.a. n.a. 14-Jun-12 22-Dec-12 30-Dec-99 1 3 6 5 8 0 0.1 213 0.837 No Investment MSC 3 0.682 4.090 4.090 4.090 4.090 4.090 4.090 4.090 4.090 4.090 3.408

1361PoA0348 1FEFMTUZDQ52SAQRMAH14G3AJTKLV3 Sustainable Promotion of East African Renewables (SPEAR) Africa East Africa Kenya At Validation Hybrid renewables Hybrid renewables Solar & wind & other ACM2 1 17.8 30-May-12 28 0.000 130.312 Carbon Check 0.000 n.a. n.a. 14-Jun-12 CPA 31-Dec-99CPA 5 9 10 11 10.0

1362CPA0348.01 The Ol Ndanyat wind project, Kajiado County, Kenya (CPA Ol Ndanyat) Africa East Africa Kenya Nairobi At Validation Wind Wind Wind ACM2 1 17.8 7 21 0.0 1-Sep-13 0.000 130.312 Carbon Check n.a. n.a. 14-Jun-12 30-Dec-99 1 9 11 5 10 12 -2 10.0 26000 0.680 No Prevailing practice Foik 17.761 17.761 17.761 17.761 17.761 17.761 17.761

1363PoA0349 A5DQHQHCCXF56TEMTAUPMK9UL83XMC 7636 Solar Power Programme of Activities Asia & Pacific Southeast Asia Thailand Thailand EDF South East Asia Limited Registered Solar Solar Solar PV AMS-I.D. 1 5.8 1-Nov-12 28 0.000 57.840 TÜV-Rhein 0.000 Netherlands (Blue World Carbon) n.a. 16-Jun-12 21-Sep-12 9-Oct-12 8-Dec-12 9-Oct-12 CPA 30-Dec-99CPA 12 1 5 11 9 7.51364CPA0349.01 7636-0001 CPA 1.1 – Korat 6 Solar Power Project Asia & Pacific Southeast Asia Thailand Nakhon Ratchasima EDF South East Asia Limited Registered Solar Solar Solar PV AMS-I.D. 1 5.8 10 20 -0.1 1-Jan-13 0.000 57.840 TÜV-Rhein Netherlands (Blue World Carbon) n.a. 16-Jun-12 9-Oct-12 30-Dec-99 12 1 5 11 9 1 Kyocera Japan SME Germany 7.5 10035 0.555 No 5.915 5.886 5.856 5.827 5.798 5.768 5.740 5.711 5.682 5.654

To reduce the greenhouse gas (GHG) emiss ions from sol id waste landfi lls bycapturing and destroying the LFG produced

A landfill gas collection and flaring system on the Trang Cat 2 Landfill .

Benchmark analysis

Bangladesh, Bhutan, Indonesia, Cambodia, Laos, Sri Lanka, Myanmar, Pakistan, Vietnam

Bangladesh, Bhutan, Indonesia, Ind ia, Cambodia, Laos, Sri Lanka, Myanmar, Pakistan, Vietnam

To increase dissemination of so lar charged LED lamps for lighting appl ications at the domestic leve l.

A ToughStuff kit, consisting of the solar panel and the LED lamp

To assist the development of small hydro power plants (SHPPs) in the most economically vu lnerable areas in Macedonia

Union Power Carbon Asset Management

To develop a p latform for overcoming insti tu tional and financial

Ningxia Chint Taiyangshan Phase I 10MWp Grid Connect Solar PV Power Plant Pro ject

Union Power Carbon Asset Management

180 MWp monocrystal line silicon solar cells

Programme of activities to switch from residual fuel o il to LPG in manufacturing industries in Peru

To provide the necessary incentives to industria l consumers of residual fue l oil to undertake a fue l switch to a low-carbon fuel : liquefied petro leum gas (LPG)

Project activity to swi tch from residual fuel o il to LPG at Agroindustrias AIB food processing p lant in Peru

Replacing residual fuel o il wi th liquefied petro leum gas (LPG).

Benchmark analysis

Programme for the promotion and development o f grid-connected so lar PV pro jects in Latin America

To transfer technology and know-how for theconversion of a widely avai lab le renewable energy source, so lar energy, in to clean, sustainable electricity.

133,056 so lar panels with a total insta lled capacity o f around 9MW

Sichuan Wuhai Envi ronmental Protection & Bioengineering

To instal l the efficient cooking stoves orretrofit traditional stoves in rural households of Sichuan Province

Sichuan Clean Development Mechanism Center

Yuexi County Rural Efficient Biomass Cooking Stoves Pro ject-CPA No.01(yuexi)

Sichuan Wuhai Envi ronmental Protection & Bioengineering

Sichuan Clean Development Mechanism Center

Simple cost analysis

To promote susta inable development and, in particular, a susta inable use of energy in the housing sector in Mexico

AMS-III.AE.+AMS-I.J.+AMS-II.C.

Aguascalientes, Guanajuato, Jalisco, Querétaro

AMS-III.AE.+AMS-I.J.+AMS-II.C.

Albania, Bahrain, Cyprus, Egypt, Jordan, Kuwai t, Lebanon, L ibya, Morocco, Oman, Pakistan, Qatar, Saudi Arabia, Tunisia

Uni ted Arab Emirates, Albania, Bahra in, Cyprus, Egypt, Jordan, Kuwait, Lebanon, Libya, Morocco, Oman, Pakistan, Qatar, Saudi Arabia, Tunisia

To facili ta te the development of renewable energy pro jects in thehost countries

10 MW P V panels, inverters and transformers

Angola, DR Congo, Lesotho, Mozambique, Namibia, Swaziland, Zambia, Zimbabwe

Angola, DR Congo, Lesotho, Mozambique, Namibia, Swazi land, South Africa, Zambia, Zimbabwe

To support the development of hydroelectricity renewable energy generation units in the countries that form part of the Southern African Power Pool (SAPP)

New hydroelectric power p lant in an existing reservoir

Benchmark analysis

Blue World Carbon Asset Management

To establ ish a CDM framework to which solar power projects can be added as CPAs thus overcoming some politica l and financia l barriers that so lar park developers face in the RSA

CPA 001 under PoA ‘South African Large Scale Grid Connected Solar Park Programme

To supply natura l renewable energy system to publ ic sector

The programme to in troduce renewable energy system in to Seoul – SSC-CPA (2011-1)

To achieve widespread d istribution and effective use of efficient cookingtechnologies in low-income rural and urban households as well as institutions

To incentivize the development of small scale renewable energy pro jects

Sol del Norte Photovoltaic Power Plant Project (P royecto Huerta Solar Fotovol tá ica Sol del Norte)

34,816 solar panels (240Wp each) grouped in 64 sun-following devices

Union Power Carbon Asset Management (Beij ing)

To develop a p latform for overcoming insti tu tional and financialbarriers for the construction of a series of solar PV projects by searching for financial support

Inner Mongolia GD Power Alxazuoqi 10MW Grid Connect Solar PV Phase I Project

Union Power Carbon Asset Management (Beij ing)

Benchmark analysis

CECEP Alxa League Solar Power Generation Co., L td . Luanj ingtan GridConnected Solar PV Power Generation P hase II 50 MWp Pro ject

Union Power Carbon Asset Management (Beij ing)

Benchmark analysis

CECEP Dunhuang 50 MW Grid Connected Solar PV Power GenerationProject

Union Power Carbon Asset Management (Beij ing)

Benchmark analysis

Yongchang County Dazhai tan 50MW Grid Connected Solar PV PowerGeneration Pro ject

Union Power Carbon Asset Management (Beij ing)

Benchmark analysis

Three Gorges New E nergy Hami 20MW Grid Connected PV Power Generation Pro ject

XinJiang Uygur Region

Union Power Carbon Asset Management (Beij ing)

Benchmark analysis

Yongchang County Heqingtan Phase II 50MW Grid Connected Solar PVPower Generation Pro ject

Union Power Carbon Asset Management (Beij ing)

Benchmark analysis

Three Gorges New E nergy Hetian Pishan Phase II 20MW Grid Connected Solar PV PowerGeneration Pro ject

Xinj iang Uygur Region

Union Power Carbon Asset Management (Beij ing)

Benchmark analysis

Suzhou Sanyang Dongdongtan Phase II 50MW Grid Connected Solar PV Power GenerationProject

Union Power Carbon Asset Management (Beij ing)

Benchmark analysis

Union Power Carbon Asset Management (Beij ing)

Benchmark analysis

Wuwei Liangzhou Phase III 30MW Grid Connected Solar PV Power Generation Pro ject

Union Power Carbon Asset Management (Beij ing)

Benchmark analysis

Wuwei Liangzhou Phase IV 100MW Grid Connected Solar PV Power Generation Pro ject

Union Power Carbon Asset Management (Beij ing)

Benchmark analysis

Suzhou Zhaoyang Dongdongtan Phase I 50MW Grid Connected Solar PV Power GenerationProject

Union Power Carbon Asset Management (Beij ing)

Benchmark analysis

To instal l high energy efficient transformers across nationalelectricity distribution grids

To contribute to susta inable development with in Cape Town Municipal ity

Financial ;P revai ling practice;Technological

Benchmark analysis

To introduce a zero-waste concept to palm oi l mi lls by introducing an advanced technology for co-composting

Financial ;P revai ling practice;Technological

Benchmark analysis

Ghana, Nigeria, Zambia

Ghana, Nigeria, Senegal, Zambia

C-Quest Capital Malaysia Global Stoves Limited

To make cleaner, more efficient improved cook stoves more affordable andavailable to urban, peri -urban and rural households, across the Afric an continent

Distribution of Improved Cook Stoves in Sub-Saharan Africa in Senegal – CPA-001

C-Quest Capital Malaysia Global Stoves Limited

To develop a p latform for supporting the development of composting p lants inChile in order to reduce organic waste and associated pollution generated by the MSW and/or OIW

Grid connected electricity generation from wind source under Programme of Activities in Brazil

To del iver renewable e lectrici ty to the National In terconnected System (Sistema Interligado Nacional - SIN) by means of the implementation ofGreenfield p lants

Genera l Electrics

Benchmark analysis

To bring a vital clean energy resource to Chile that currently has li ttle PV development

Cadmium tel luride (CdTe) thin-film solar modulesCadmium tel luride (CdTe) thin-film solar modules

Ghana, Kenya, mauri tius

Standard Bank Renewable Energy Programme –Solar Bundled CPA in SADA zone

Benchmark analysis

Renewable biomass fired improved cookstoves programme for households in Burundi by BQSRenewable biomass fired improved cookstoves programme for households in Burundi byBQS – CPA_BUJM01

Sabah Enamel & Stove Industry

Financial ;P revai ling practice;Technological

Uni ted Arab Emirates, Albania, Bahra in, Egypt, Jordan, Kuwai t, Lebanon, L ibya, Morocco, Mauritius, Oman, Pakistan, Qatar, Tunisia

Uni ted Arab Emirates, Albania, Bahra in, Egypt, Jordan, Kuwait, Lebanon, Libya, Morocco, Mauri tius, Oman, Pakistan, Qatar, Saudi Arabia, Tunisia

Ministry of Water and Electricity Saudi Arabia

Ministry of Water and Electricity Saudi Arabia

Uni ted Arab Emirates, Egypt, Oman, Qatar

Uni ted Arab Emirates, Egypt, Oman, Qatar, Saudi Arabia

Financial ;P revai ling practice;Technological

Chilean Programme of Activities for Integrated Non Conventional Renewable Energies

Geothermal electricity+Wind+Tidal+Solar PV+Solar thermal power

Sol del Loa Photovoltaic Power Plant Pro ject (Proyecto Central Fotovoltáica Sol del Loa) CPA Serial Number 001

Benchmark analysis

Babcock & Wi lcox

Supporting the development ofsustainable management of SWDSs and spread MOL technology in Chile

Prevai ling practice;Technological

Environmental Intermediaries & Trading Group

Contribution to loca l envi ronment and sustainable development

Environmental Intermediaries & Trading Group

Environmental Intermediaries & Trading Group

Coalbed methane well, flaring, combustioon and p ipe line distribution

Environmental Intermediaries & Trading Group

Financial ;P revai ling practice

Benchmark analysis

Energy Efficiency of Nigeria’s Residential L ighting Stock by Distributing up to 40 Mi llion Compact Fluorescent Lamps (CFLs) to Residentia l Households Connected to the National Grid

Nationwide change to energy efficient lighting and provide cheaper energy

Nigeria Energy Efficiency CFL Lighting Scheme - ICIMI-PoA – CPA 1 – Ikorodu-Ijede

Simple cost analysis

Beij ing Huayi Leye Energy Saving Service Company

Reduced EE consumption through EE in bu ild ings

CPA-1 Guankou County Citizen Center under the PoA: Energy efficiency in new bui ldings in the P. R. of China

Beij ing Huayi Leye Energy Saving Service Company

Improved insulation and efficient cooling systems

Henan BCCY New Power Industry Co., Ltd. LFG recovery to power Programme of Activities

Henan BCCY New Power Industry

Promote implementation of LFG captura and usage

Henan BCCY New Power Industry

LFG collection, transmission and pre-treatment system, with subsequent electricity generation

Benchmark analysis

Zhongying Changj iang In ternational New Energy Investment

Promote the development of rural hydropower resources

Zhongying Changjiang Smal l-scale Hydropower Programme of Activities-CPA-001

Zhongying Changj iang In ternational New Energy Investment

A dam, division tunnel , penstock, powerhouse and substation

Benchmark analysis

Facilo tate development of small sca le RE pro jects

Isabela, Central Luzon

Angola, Burkina Faso, Benin, Côte d`Ivoire , Cameroon, Eth iop ia, Kenya, Liberia , Nigeria, Sierra Leone, Senegal , Togo

Angola, Burkina Faso, Benin, Côte d`Ivoire , Cameroon, Eth iop ia, Ghana, Kenya, L iberia, Nigeria , Sierra Leone, Senegal, Togo

Avoiding methane emissions from Municipal Waste landfills

Landfil l gas col lection and flaring/use system

Investment;Technological

Benchmark analysis

Hunan, Henan, Guangxi

HuaQi E nvironmenta l Clean Technologies

Install ing animal manure treatment systems with biogas recovery system

AMS-III.D.+AMS-I.C.+AMS-I.F.

HuaQi Livestock Farms Methane Engineering Programme of Activities---CPA-001

HuaQi E nvironmenta l Clean Technologies

Manure treatment systems with biogas recovery system and electricity generation

AMS-III.D.+AMS-I.C.+AMS-I.F.

Benchmark analysis

Reducing greenhouse gas emissions through the insta lla tion of energy efficiency venti lation fans

CPA 001 under the reg istered PoA ‘ Installation of energy efficient ventilation fans’

Promote the investment on Small Hydro Plants (SHPs)

Benchmark analysis

Grid Connected Photovoltaic (PV) Renewable Electrici ty Generating Facil ities PoA

to support the development and implementation of PV renewable e lectrici ty generation facil ities in South Africa

Grid Connected Photovoltaic (PV) Renewable Electrici ty Generating Facil ities Programme CPA 1 (One)Improved Cookstoves Program for Malawi and cross-border regions of Mozambique

to make cleaner, more efficient improved cook stoves more affordable and available to peri -urban and rural households,

Sweden (Government of S weden), Netherlands (C-Quest Capi ta l)

Improved Cookstoves Program for Malawi and cross-border regions of Mozambique – CPA – MAL - 001

Sweden (Government of S weden), Netherlands (C-Quest Capi ta l)

Improved Cookstoves Program for Malawi and cross-border regions of Mozambique – CPA – MAL - 002

Sweden (Government of S weden), Netherlands (C-Quest Capi ta l)

Improved Cookstoves Program for Malawi and cross-border regions of Mozambique – CPA – MAL - 003

Sweden (Government of S weden), Netherlands (C-Quest Capi ta l)

Improved Cookstoves Program for Malawi and cross-border regions of Mozambique – CPA – MAL - 004

Sweden (Government of S weden), Netherlands (C-Quest Capi ta l)

Improved Cookstoves Program for Malawi and cross-border regions of Mozambique – CPA – MAL - 005

TLC Rocket Stove (up to 20,763 stoves)

Sweden (Government of S weden), Netherlands (C-Quest Capi ta l)

To instal l fuel efficient cooking stoves throughout Zambia

Simple cost analysis

Senegal, Zambia, Malawi

To make cleaner, more efficient improved cooking stoves using renewable biomass affordable and available to households

To reduce greenhouse gas emissions through the implementation of energy efficiency measures in the compressed air system

Free State, Gauteng

Financial ;P revai ling practice;Technological

To provide renewable energy into the respective East African grid systems and reduce greenhouse gas(“GHG”) emissions

Financial ;P revai ling practice;Technological

improve the indoor a ir pol lution and reduce harmfu l GHG emission evolved into the atmosphere

Clean Ai r Renewable Energy, Core CarbonX Solutions

Installation of Energy Efficient Cookstoves in Umtata, Butterworth, King Will iams town and Mqanduliin Eastern Cape, South Africa: CPA 001

Clean Ai r Renewable Energy, Core CarbonX Solutions

Investment;Technological

Sardar Swaran Singh National Institu te of Renewable Energy

To promote the widespread use of improved b iomass cookstoves in India by making them available to the households and community institutions across India

Sardar Swaran Singh National Insti tu te of Renewable Energy

Sardar Swaran Singh National Institu te of Renewable Energy

Sardar Swaran Singh National Insti tu te of Renewable Energy

Investment;Technological

Benchmark analysis

Middle EastMiddle-East

Green Future Lebanon Hold ing Sal

Increasing the use of s olar water heaters (SWH) in residential and commercial facil ities throughout Lebanon

Middle EastMiddle-East

Green Future Lebanon Hold ing Sal

1000 SWH of a typical aperture are of 2.8 m2

Welspun Renewables Energy Limi ted (WREL)

To support the development of new grid-connected renewable energy power plants in Ind ia

Welspun Renewables Energy Limi ted (WREL)

Crystall ine technology based so lar photo voltaic modules

Benchmark analysis

To promote the development ofrenewable energy and faci litate the abatement of greenhouse gas emissions through rep lacement of fossilfuel based e lectrici ty in Albania and Serb ia

2 hydro power uni ts in the run-of-river hydro power plant

South Africa, Zimbabwe, Botswana

African Susta inabil ity Ini tiative (ASI)

To reduce the use of fossil fue ls in thermal energy production equipment

African Susta inabil ity Ini tiative (ASI)

Qinghai Chaidamu Energy Investment & Development Co.

To promote the total capacity o f solar power in Qinghai province to 4000MW at the end of 2015 and reach 10GW in 2020

Qinghai Chaidamu Energy Investment & Development Co.

Polycrysta lline sil icon so lar cel ls of to tal capacity of 20 MW

Benchmark analysis

General Carbon Advisory Services P vt. Ltd. Mumbai

To develop a p latform for overcoming hurdles for estab lishment of new RE p lants or increasing generation capaci ty for the existing ones

General Carbon Advisory Services P vt. Ltd. Mumbai

32 wind turb ine generators (WTG) with ind ividual capacity o f 800 kW

Benchmark analysis

General Carbon Advisory Services P vt. Ltd. Mumbai

14 wind turb ines with an individual capacity of 2MW

Benchmark analysis

General Carbon Advisory Services P vt. Ltd. Mumbai

33 wind turb ines with an individual capacity of 1 .5MW

Benchmark analysis

General Carbon Advisory Services P vt. Ltd. Mumbai

9 wind turbines wi th an ind ividual capacity of 2MW

Benchmark analysis

General Carbon Advisory Services P vt. Ltd. Mumbai

24 wind turb ines with an individual capacity of 2 .1 MW

Benchmark analysis

General Carbon Advisory Services P vt. Ltd. Mumbai

33 wind turb ines with an individual capacity of 1 .5 MW

Benchmark analysis

General Carbon Advisory Services P vt. Ltd. Mumbai

12 wind turb ines with an individual capacity of 2 .1 MW

Benchmark analysis

General Carbon Advisory Services P vt. Ltd. Mumbai

15 wind turb ines with an individual capacity of 2 MW

Benchmark analysis

General Carbon Advisory Services P vt. Ltd. Mumbai

33 wind turb ines with an individual capacity of 1 .5 MW

Benchmark analysis

General Carbon Advisory Services P vt. Ltd. Mumbai

34 wind turb ines with an individual capacity of 1 .5 MW

Benchmark analysis

General Carbon Advisory Services P vt. Ltd. Mumbai

Fi rst Solar series 4 PV modules, advanced th in film solar PV technology

Investment;Technological

General Carbon Advisory Services P vt. Ltd. Mumbai

2.1 MW x 48 number of individual un its, Suzlon Energy Limi ted make S97/2.1 MWmodel

Benchmark analysis

General Carbon Advisory Services P vt. Ltd. Mumbai

0.8 MW x 69 number of individual un its, Wind World (India) L td make WW53/0.8 MW model

Benchmark analysis

General Carbon Advisory Services P vt. Ltd. Mumbai

0.8 MW x 63 number of individual un its, Wind World (India) L td make WW53/0.8 MW model

Benchmark analysis

General Carbon Advisory Services P vt. Ltd. Mumbai

2 MW x 20 number of individual uni ts, Gamesa make G97/2 MW model

Benchmark analysis

General Carbon Advisory Services P vt. Ltd. Mumbai

Hareon 305 W and 310 W, Poly-Crystall ine s olar PV technology

Benchmark analysis

FIRA Wastewater Treatment System, Methane Capture and Uti lisation Programme in Mexico

Fideicomisos Insti tu idos en Relación con la Agricu ltura, FIRA

To promote advanced wastewater treatment for FIRA's clients, and a llparticipants in agro-industrial sectors that generate methane emissions

Fideicomisos Insti tu idos en Relación con la Agricu ltura, FIRA

Enclosed anaerobic reactors with biogas recovery

Simple cost analysis

Sustainable Development Programme of Rural Electri fication by Husk Power Systems

to provide electricity primarily in the off-grid villages of Ind ia forlighting purpose, by producing power from a surp lus renewable source rice husk

Sustainable Development Programme of Rural Electri fication by Husk Power Systems CPA-001

Gas based generators, 30 units of 32-100 kW, to ta l capacity 960 kw

to promote the development of grid-connected e lectrici ty generationfrom wind energy in Chile

Benchmark analysis

to reduce greenhouse gas emissions from wastewater treatment and promote the consumption of renewable energy by using biogas

Covered b io digester wi th methane collection point

Benchmark analysis

to help low-income households inNigeria switch from the use of less efficient fuels such as kerosene, charcoal and firewood toLPG

Liquefied Petroleum Gas (LPG) cook stoves

Power generation using biogas from state-owned palm o il mil ls in the Republic of Indonesia

To collect b iogas which is currenty discharged in to the atmosphere and using for power generation

PTPN VI Pinang Tinggi Mill POME Biogas Project in Jambi Province, Sumatera in Indonesia

Wastewater treatment, biogas collection and uti lization

Benchmark analysis

SinoCarbon Innovation & Investment Co.

Datang Shandong Electricity Generation Co.

SinoCarbon Innovation & Investment Co.

Seven modules of polycrysta lline silicon so lar cel ls with total capacity of 7.084 MW

Datang Shandong Electricity Generation Co.

to generate thermal and/or electricity generation byBiomass based thermal energy generation at Tanjung Langsat Steam Plant

(12710359-1)45 TPH (design specification) biomass boiler,

Benchmark analysis

To promote the development of grid-connected e lectrici ty generationfrom solar energy source in Chile

Photovoltaic panels made of po lycrysta lline, total capacity 75 MWcells

Benchmark analysis

To support the development and implementation of large-scale renewable energy pro jects in South A frica 33 Goldwind GW100/2500 turb ines,

capacity of 2 .5 MW eachBenchmark analysisDepartment of Energy,

Government of PhilippinesTo reduce greenhouse gas (GHG) emiss ions from fossil fue l and to impact the health and quali ty of life of residents

Department of Energy, Government of Philippines

To promote, encourage and expand more green vehicles to be used in the host country as an alternative to the current conventional vehicles.

2 new LNG powered offshore support vessels (OSV)

Investment;Prevailing practice;TechnologicalTo replace fossil fue l fi red equipment or

energy supply source and to encourage the use of renewable energy and waste energy by implementation

Thermal Energy Production Based on Solar Energy and Waste Heat Recovery CPA-0001

Vacuum collector tube solar water heaters with the total insta lled collection area of 1,033.2 m2To develop grid connected CSP and PV

power generation facil ities in South Africa.

CSP parabolic trough technology, total capacity 100 MW

To reduce the greenhouse gas (GHG) emiss ions from sol id waste landfi lls bycapturing and destroying the landfill gas (LFG) produced

LFG collection system and flaring system

Benchmark analysis

To develop a p latform for overcoming insti tu tional, financial and structuralhurdles for the implementation of freight transport based on rail systems

Shi ft from road transportation using trucks to ra il

Benchmark analysisTo reduce the greenhouse gas (GHG)

emiss ions from sol id waste landfi lls bycapturing and destroying the landfill gas (LFG)

A a gas col lection network, an extraction and flaring station includ ing high temperature enclosed flare andmoni toring and control systems

Benchmark analysis

To develop an organised framework fordeveloping its Wind energy pro jects in India

Wind Energy Project in Jaisalmer District o f Rajasthan under Wind Power Programme of Activities inIndia

25 number of Wind turb ine generators of Inox make of 2 MW

Zhongtannengtou Technology (Beij ing) Co.

To promote the development of renewable energy and facili ta te the abatement ofgreenhouse gas (GHG) emissions

Zhongtannengtou Technology (Beij ing) Co.

Benchmark analysisProgramme for GHG Reduction Promotion of Grid Connected SSC

Hydropower PlantsRui feng Huating In ternational Consulting (Bei jing) Co.

To promote the development of renewable energy and facili ta te the abatement of greenhouse gas (GHG) emissionsProgramme for GHG Reduction Promotion of Grid Connected SSC

Hydropower Plants, CP A # 1Rui feng Huating In ternational Consulting (Bei jing) Co.

Benchmark analysis

To support the development and implementation of smal l-scale renewable energy pro jects inSouth Africa

19.52 MW csp plant with 40 units, each with an AC capaci ty of (+/-5%) of 68 KW at PTC

General Carbon Advisory Services P vt

To reduce the carbon emission by a llowing the famil ies to puri fy the water avoiding dependency on biomass or fossil fue lGeneral Carbon Advisory

Services P vtLow/zero greenhouse gas emitting water purifications system

To contribute to the development and promotion of grid connected wind farms

Benchmark analysis

To facili ta te the installation of Wind Turbine Generators to generate electricity from renewable wind energy source by providing access to carbon revenu

5 numbers of 2000 kW each Kenersys make Wind Turbine Genertors

Benchmark analysis

6 wind turbines of 850kW capaci ty and 1 wind turbine of 2.1MW capaci ty

Gamesa & Suzlon

Benchmark analysis

15 MW wind CPA in Maharashtra and AndhraPradesh: CPA 003

8 wind turbines (3 of 1.5 MW, 5 of 2.1 MW)

Re Gen & Suzlon

Benchmark analysis

Benchmark analysis

Animal Manure Treatment Programme in Anhui Province, Jiangsu Province and Yunnan Province

Anhui, Jiangsu, Yunan

To enable l ivestock farmers in Anhui Province, Jiangsu Province and Yunan Province to instal l animal manure treatment systems with recovery of b iogas and the utilization of the generated biogas as fuel for energy generation

AMS-III.D.+AMS-I.C.+AMS-I.F.+AMS-I.D.

Animal Manure Treatment Programme in Anhui Province, Jiangsu Province and Yunnan Province--CPA0001

Manure treatment system, b iogas recovery system and biogas uti lization system

AMS-III.D.+AMS-I.C.+AMS-I.F.+AMS-I.D.

Benchmark analysis

Burundi, Rwanda, Uganda

Burundi, Kenya, Rwanda, Uganda

Sustainable Promotion of East African Renewables (SPEAR)

To increase renewable energy generation across East Africa by providingaccess to the carbon market to pro ject implementers.Sustainable Promotion of East

African Renewables (SPEAR)Five wind turbine generators (WTG) to a total insta lled capacity o f 10MW

To encourage the development of grid connected so lar PV power pro jects and increase the supply of renewable energy in to the country’s electricity grid

Kyocera modules, with a power rating of 240 Wp

1365PoA0350 VIDWKAM5TOQHX6N7F4AT0SXFOT354M 8438 Clean Cook Stoves in Sub-Saharan Africa by ClimateCare Limited Africa West Africa Ghana ClimateCare Limited Registered EE households EE households Stoves AMS-II.G. 3 322.2 16-Jun-12 28 0.000 2,024.695 RINA 0.000 278.514 293.500 1 10-Jul-15 31-Jul-15 Sweden (Government of Sweden) n.a. 16-Jun-12 19-Oct-12 28-Nov-12 1-Jan-13 30-Nov-12 PoA 31-Dec-99CPA Gold Standard 1 6 5 8 10 6 0.0

1366CPA0350.01 8438-0001 CookClean Ghana Limited —CPA01 Africa West Africa Ghana Ghana ClimateCare Limited Registered EE households EE households Stoves AMS-II.G. 1 136.7 7 21 0.0 1-Jan-13 0.000 1,094.247 RINA 278.514 278.514 3 10-Jul-15 30-Jun-16 Carbon Check Sweden (Government of Sweden) n.a. 16-Jun-12 30-Nov-12 30-Dec-99 1 6 5 8 10 6 0 Ghana 180.0 No 55.950 151.721 136.734 136.734 136.734 136.734 136.734 136.734

1367CPA0350.02 8438-0002 CookClean Ghana Limited - CPA02 Africa West Africa Ghana Ghana ClimateCare Limited Registered EE households EE households Stoves AMS-II.G. 1 145.5 7 21 1-Dec-15 0.000 740.007 RINA 14.986 14.986 1 26-Apr-17 30-Jun-16 Carbon Check Sweden (Government of Sweden) n.a. 16-Jun-12 12-Feb-16 30-Dec-99 1 6 5 8 10 6 0 Ghana 180.0 No 11.843 56.508 101.173 145.837 178.659 178.659 178.659 166.816

1368CPA0350.03 8438-0003 Improved Jikos Project -CPA03 Africa East Africa Kenya Naivasha, Timau ClimateCare Limited Registered EE households EE households Stoves AMS-II.G. 1 40.1 7 21 1-Apr-16 190.441 RINA Sweden (Government of Sweden) n.a. 16-Jun-12 30-Dec-99 1 6 5 8 10 6 0 180.0 No 10.307 27.244 40.243 54.055 63.064 67.569 17.969

1369PoA0351 0MNI34QQZIQX2SF7Z0ATT62N52XISW Waste and Renewable Energy Technologies Programme Latin America North America Mexico Mexico Islan Group At Validation Methane avoidance Methane avoidance Manure 1 12.1 1-Aug-12 28 1.104 121.250 PJRCES 0.000 n.a. n.a. 19-Jun-12 PoA 30-Dec-99PoA 6 4 8 0.0

1370CPA0351.01 Biogas Programme in Central Mexico 01 Latin America North Africa Mexico Islan Group At Validation Methane avoidance Methane avoidance Manure 1 12.1 10 10 -0.3 1-Dec-12 1.104 121.250 PJRCES n.a. n.a. 19-Jun-12 30-Dec-99 6 4 8 0 No 13.257 12.992 12.732 12.477 12.228 11.983 11.744 11.509 11.279 11.053

1371PoA0352 8F8DVCU59M4OH5BVAAGMLKMLQOF39R 9339 PoA for fuel switching at micro and small-sized enterprises in Egypt Africa North Africa Egypt Egypt CDM-APU/EEAA Registered Fossil fuel switch Fossil fuel switch Oil to natural gas AMS-III.B.+AMS-III.Z. 1 0.2 1-Jun-12 28 0.000 1.550 BV Cert 0.000 n.a. n.a. 26-Jun-12 1-Jun-12 28-Dec-12 15-Jun-13 28-Dec-12 CPA 31-Dec-99CPA 1 6 9 0.0

1372CPA0352.01 9339-0001 Fuel switching at two bakeries in EL-Zawya El-Hamra Africa North Africa Egypt Cairo CDM-APU/EEAA Registered Fossil fuel switch Fossil fuel switch Oil to natural gas AMS-III.B.+AMS-III.Z. 1 0.2 10 15 0.0 1-Mar-13 0.000 1.550 BV Cert n.a. n.a. 26-Jun-12 28-Dec-12 30-Dec-99 1 6 9 0 No Investment MSC 0.155 0.155 0.155 0.155 0.155 0.155 0.155 0.155 0.155 0.155

1373PoA0353 X5FDM7M9IL63SMJGUOLUWZCC9TD0OT Asia & Pacific Southeast Asia Malaysia Malaysia QL Carbon At Validation Methane avoidance Methane avoidance Palm oil solid waste 1 36.1 26-Jun-12 28 0.000 360.630 TÜV-Rhein 0.000 n.a. n.a. 28-Jun-12 CPA 30-Dec-99CPA 5 9 6 1 3 4 1.0

1374CPA0353.01 Asia & Pacific Southeast Asia Malaysia Selangor QL Carbon At Validation Methane avoidance Methane avoidance Palm oil solid waste 1 36.1 10 15 0.0 1-Apr-13 0.000 360.630 TÜV-Rhein n.a. n.a. 28-Jun-12 30-Dec-99 5 9 6 1 3 4 0 1.0 9648 0.683 No 4 27.047 36.063 36.063 36.063 36.063 36.063 36.063 36.063 36.063 36.063 9.016

1375PoA0354 QSIYBIS9VCVN0BLW6PQM0T1TQPHG7X 9146 Residential Hot Water Efficiency Programme in South Africa Africa Southern Africa South Africa South Africa eThekwini Municipality Registered Solar Solar Solar water heating AMS-I.J.+AMS-II.C. 1 28.8 1-Jan-13 28 0.000 288.080 TÜV-Nord 0.000 n.a. n.a. 28-Jun-12 21-Sep-12 24-Dec-12 26-Jun-13 31-Dec-12 CPA 30-Dec-99CPA 9 10 5 8 0.0

1376CPA0354.01 9146-0001 eThekwini Municipality Residential Hot Water Efficiency Programme – CPA1 Africa Southern Africa South Africa eThekwini Municipality Registered Solar Solar Solar water heating AMS-I.J.+AMS-II.C. 1 28.8 10 10 0.0 1-Feb-13 0.000 288.080 TÜV-Nord n.a. n.a. 28-Jun-12 31-Dec-12 30-Dec-99 9 10 5 8 0 60.0 No MSC 26.362 28.808 28.808 28.808 28.808 28.808 28.808 28.808 28.808 28.808 2.447

1377PoA0355 I6O0OD59C4F7QEXDW82Y1T58IHVPR3 Energy Efficiency Improvement Programme for Motor System Asia & Pacific East Asia China China Validation Terminated EE industry EE industry Chemicals AMS-II.D. 1 7.9 1-Dec-12 28 0.065 78.520 JCI 0.000 Japan (J-TEC) n.a. 30-Jun-12 CPA 31-Dec-99CPA 5 0.0

1378CPA0355.01 Asia & Pacific East Asia China Shanghai Validation Terminated EE industry EE industry Chemicals Installation of Variable-frequency Drives AMS-II.D. 1 7.9 10 10 0.0 1-Dec-12 0.065 78.520 JCI Japan (J-TEC) n.a. 30-Jun-12 30-Dec-99 5 0 China 0.749 10.5 No Investment 3 7.852 7.852 7.852 7.852 7.852 7.852 7.852 7.852 7.852 7.852

1379PoA0356 REWC8TJ0S3OME1URLSLK4H8E9B8HOC Heat Retention Cooking in South Africa Africa Southern Africa South Africa South Africa Natural Balance Pty Validation Terminated EE households EE households Stoves AMS-II.C. 1 53.0 5-Jul-12 28 13.261 437.867 DNV 0.000 n.a. n.a. 7-Jul-12 PoA 30-Dec-99PoA 8 0.0

1380CPA0356.01 Heat Retention Cooking in South Africa CPA1 (SWGauteng) Africa Southern Africa South Africa Gauteng Natural Balance Pty Validation Terminated EE households EE households Stoves AMS-II.C. 1 53.0 7 21 0.0 1-Oct-12 13.261 437.867 DNV n.a. n.a. 7-Jul-12 30-Dec-99 8 0 South Africa 53.4 No Investment 53.044 53.044 53.044 53.044 53.044 53.044 53.044

1381PoA0357 IB4G5A5Y7W3YHLLDN5FL2PRVASG8Z7 Interregional Interregional United Arab Emirates Egypt, Pakistan Avanceon Validation Terminated EE industry EE industry Chemicals AMS-II.D. 1 16.3 6-Jul-12 28 0.000 130.557 TÜV-Rhein 0.000 Switzerland (First Climate) n.a. 7-Jul-12 30-Dec-99PoA 8 5 9 11 0.0

1382CPA0357.01 Energy Optimization Solutions for Industries in Pakistan – CPA-01 Asia & Pacific Southern Asia Pakistan Pakistan Avanceon Validation Terminated EE industry EE industry Chemicals AMS-II.D. 1 16.3 7 28 0.0 1-Jan-13 0.000 130.557 TÜV-Rhein Switzerland (First Climate) n.a. 7-Jul-12 30-Dec-99 8 5 9 11 0 Avanceon Pakistan 0.466 37.8 No 16.314 16.314 16.314 16.314 16.314 16.314 16.314

1383PoA0358 5ZP7Q4267J0131OQXYY63FDQRHM1JG PoA for small scale renewable energy development in Egypt Africa North Africa Egypt Egypt Validation Terminated Hybrid renewables Hybrid renewables Solar & wind 1 0.0 1-Sep-12 28 0.395 0.470 BV Cert 0.000 n.a. n.a. 11-Jul-12 CPA 31-Dec-99CPA 7 1 11 9 12 0.1

1384CPA0358.01 Installing PV panels at the New Basaisa Village Guest House Africa North Africa Egypt South Sinai Validation Terminated Solar Solar Solar PV 5 kW PV panels 1 0.0 10 25 0.0 1-Dec-12 0.395 0.470 BV Cert n.a. n.a. 11-Jul-12 30-Dec-99 7 1 11 9 12 0 0.1 8 0.569 No MSC 0.395 4.734 4.734 4.734 4.734 4.734 4.734 4.734 4.734 4.734 4.340

1385PoA0359 LZ1UH3DFYV4XESKQZW0QKCFZA96KV9 BWC Sustainable Mini Hydropower Programme of Activities in Indonesia Asia & Pacific Southeast Asia Indonesia Indonesia Blue World Carbon At Validation Hydro Hydro Run of river AMS-I.D. 1 34.2 1-Oct-12 28 0.000 239.690 TÜV-Rhein 0.000 Netherlands (Blue World Carbon) n.a. 12-Jul-12 CPA 30-Dec-99CPA 5 8 10 11 9 9.0

1386CPA0359.01 CPA 1.1 – Parmonangan Hydroelectric Power Plant Asia & Pacific Southeast Asia Indonesia North Sumatra Blue World Carbon At Validation Hydro Hydro Run of river AMS-I.D. 1 34.2 7 25 0.0 1-Jan-14 0.000 239.690 TÜV-Rhein Netherlands (Blue World Carbon) n.a. 12-Jul-12 30-Dec-99 5 8 10 11 9 0 9.0 45760 0.748 No Investment 3 34.228 34.228 34.228 34.228 34.228 34.228 34.228

1387PoA0360 XYBUIJXVO6H99GKUYQRQETWPTZBRBA 9698 Latin America Caribbean Haiti Haiti D&E Green Enterprises Inc. Registered EE households EE households Stoves AMS-II.G. 1 41.2 14-Jul-12 28 0.000 412.270 AENOR 0.000 Italy (ENEL) n.a. 13-Jul-12 2-Apr-13 26-Jul-13 18-Oct-13 26-Jul-13 PoA 30-Dec-99PoA 4 6 1 8 5 11 0.0

1388CPA0360.01 9698-0001 Replacement of traditional stoves with efficient EcoRecho stoves – CPA No. 01 Latin America Caribbean Haiti Haiti D&E Green Enterprises Inc. Registered EE households EE households Stoves EcoRecho cook stoves AMS-II.G. 1 41.2 10 10 0.0 1-Jan-13 0.000 412.270 AENOR Italy (ENEL) n.a. 13-Jul-12 26-Jul-13 30-Dec-99 4 6 1 8 5 11 -5 D&E Haiti 180.0 No Foik 43.383 43.383 43.383 43.383 43.383 43.383 43.383 43.383 43.383 43.383

1389PoA0361 244YJHGN6B25Y5Y9HTJM9UEF98TTIE AANE Biogas for Indonesia Programme Asia & Pacific Southeast Asia Indonesia Indonesia At Validation Methane avoidance Methane avoidance Palm oil waste 1 61.9 1-Jan-12 28 0.000 619.110 GLC 0.000 Germany (Aufwind Schmack Asia Holding) n.a. 14-Jul-12 CPA 31-Dec-99CPA 9 12 5 11 1.8

1390CPA0361.01 CPA 1.2 - AANE Binanga Biogas Project Asia & Pacific Southeast Asia Indonesia North Sumatra At Validation Methane avoidance Methane avoidance Palm oil waste 1 61.9 10 10 0.0 1-Dec-13 0.000 619.110 GLC Germany (Aufwind Schmack Asia Holding) n.a. 14-Jul-12 30-Dec-99 9 12 5 11 1 3 1.8 10798 0.748 No Investment 3 61.911 61.911 61.911 61.911 61.911 61.911 61.911 61.911 61.911 61.911

1391PoA0362 WVZA0RBRQDHGZP8N3EEN4PIM7JU34G 8486 Biomass residues power generation Programme Africa Southern Africa South Africa South Africa Standard Bank Plc Registered Biomass energy Biomass energy Agricultural residues: other kinds ACM6 1 4.2 1-Jul-12 28 0.000 42.170 JCI 0.000 n.a. Ecosur Afrique 14-Jul-12 31-Oct-12 7-Nov-13 9-Jan-14 15-Nov-13 CPA 31-Dec-99CPA 5 10 9 12 11 1 91.0

1392CPA0362.01 8486-0001 Amatikulu CPA - Renewable Energy Generation Facility Africa Southern Africa South Africa KwaZulu-Natal Standard Bank Plc Registered Biomass energy Biomass energy Bagasse power ACM6 1 4.2 10 25 0.0 1-Jan-16 0.000 42.170 JCI n.a. Ecosur Afrique 14-Jul-12 15-Nov-13 30-Dec-99 5 10 9 12 11 1 -2 91.0 291692 0.948 No Prevailing practice Foik 267.255 267.255 267.255 267.255 267.255 267.255 267.255 267.255 267.255 267.255

1393PoA0363 FXNQIXUMQOETGJ4DJKIPJSFLMP79QR 9206 RE2Grid PoA Asia & Pacific Southeast Asia Philippines Philippines Registered Hybrid renewables Hybrid renewables Solar & wind & other ACM2 1 53.5 17-Jul-12 28 0.000 429.224 TÜV-SÜD 0.000 Sweden (Cornland International) n.a. 17-Jul-12 29-Nov-12 26-Dec-12 25-Apr-13 27-Dec-12 CPA 31-Dec-99CPA 5 8 10 9 33.4

1394CPA0363.01 9206-0001 CPA #1 Bulalacao Wind Farm Asia & Pacific Southeast Asia Philippines Central Luzon Registered Wind Wind Wind 33.4MW wind farm ACM2 1 53.5 7 21 0.0 27-Dec-12 0.000 429.224 TÜV-SÜD Sweden (Cornland International) n.a. 17-Jul-12 27-Dec-12 30-Dec-99 5 8 10 9 0 33.4 73146 0.747 No 3 13.642 53.543 53.543 53.543 53.543 53.543 53.543 39.901

1395PoA0364 Z7L2PLGBWD5UZYRSYD9XASYPER691D 9491 ONE Wind Program of Activity, Morocco Africa North Africa Morocco Morocco Office National de l'Electricité Registered Wind Wind Wind ACM2 1 653.6 19-Jul-12 28 0.000 4,577.047 DNV 0.000 n.a. n.a. 19-Jul-12 3-Aug-12 31-Dec-12 27-Jul-13 31-Dec-12 CPA 31-Dec-99CPA 9 5 7 301.3

1396CPA0364.01 9491-0001 Tarfaya Wind Farm Project (300 MW) - ONE/MAROC/WIND/TARFAYA 300 Africa North Africa Morocco Laâyoune Office National de l'Electricité Registered Wind Wind Wind ACM2 1 653.6 7 28 0.0 1-Jan-14 0.000 4,577.047 DNV n.a. n.a. 19-Jul-12 31-Dec-12 30-Dec-99 9 5 7 1 Germany 301.3 1018000 0.584 No Investment 3 653.608 653.608 653.608 653.608 653.608 653.608 653.608

1397PoA0365 P2DFYFBJ5TVJOH43246SR2AACG7UAW 9337 FIRA AWMS1 Programme Mexico Latin America North America Mexico Mexico Registered Methane avoidance Methane avoidance Manure 1 2.2 1-Jan-13 28 0.000 15.504 DNV 0.000 n.a. n.a. 20-Jul-12 15-Jun-12 11-Sep-13 15-Nov-13 11-Sep-13 CPA 30-Dec-99PoA 1 8 2 7 9 5 1.5

1398CPA0365.01 9337-0001 FIRA, AWMS Programme Mexico - CPA Granja GAMA Latin America North America Mexico Sonora Registered Methane avoidance Methane avoidance Manure 1 2.2 7 10 0.0 1-Jan-14 0.000 15.504 DNV n.a. n.a. 20-Jul-12 11-Sep-13 30-Dec-99 1 8 2 7 9 5 0 1.5 220 0.484 No Investment 3 1.624 3.111 3.111 3.111 3.111 3.111 3.111

1399PoA0366 HWJNJJIBXOBQO8B4O4COT7XANXODQG Africa Interregional Angola ENERCAP SAS Validation Terminated EE households EE households Lighting AMS-III.AR. 1 60.0 5-Jan-12 28 0.000 15.504 BV Cert 0.000 n.a. n.a. 20-Jul-12 CPA 31-Dec-99CPA 6 8 1 0.0

1400CPA0366.01 Africa Central Africa Chad Chad ENERCAP SAS Validation Terminated EE households EE households Lighting AMS-III.AR. 1 60.0 2 2 0.0 24-Dec-13 0.000 15.504 BV Cert n.a. n.a. 20-Jul-12 30-Dec-99 6 8 1 0 60.0 No 60.000 60.000

1401PoA0367 E96QAJWGJJ08KQ1SA3DPTI86NRZXER 6422 CFLs Distribution Programme in Guizhou Province Asia & Pacific East Asia China Guizhou Registered EE households EE households Lighting AMS-II.J. 1 28.9 31-Jan-13 28 0.000 15.504 CEC 0.000 n.a. n.a. 23-Jul-12 1-Sep-12 29-Dec-12 28-Dec-12 PoA 31-Dec-99CPA 4 8 1 7 0.0 Plist

1402CPA0367.01 6422-0001 “CFLs Distribution Programme in Guizhou Province” CPA 1 Asia & Pacific East Asia China Registered EE households EE households Lighting AMS-II.J. 1 28.9 8 8 -4.0 31-Jan-13 0.000 15.504 CEC n.a. n.a. 23-Jul-12 28-Dec-12 30-Dec-99 4 8 1 7 -1 0.1 No Investment Plist 4 37.673 35.103 32.532 29.961 27.391 24.820 22.250 16.650

1403PoA0368 FTP9Q7DAARQG87FNC3CKDEIV44OSXN 8497 CFL Distribution Programme in Heilongjiang Province Asia & Pacific East Asia China Heilongjiang Registered EE households EE households Lighting AMS-II.J. 1 38.4 31-Jan-13 28 0.000 15.504 CEC 0.000 n.a. n.a. 23-Jul-12 1-Sep-12 28-Dec-12 28-Dec-12 PoA 31-Dec-99CPA 4 8 1 7 0.0 Plist

1404CPA0368.01 8497-0001 “CFLs Distribution Programme in Heilongjiang Province” CPA 1 Asia & Pacific East Asia China Yichun City Registered EE households EE households Lighting AMS-II.J. 1 38.4 8 8 -4.0 31-Jan-13 0.000 15.504 CEC n.a. n.a. 23-Jul-12 28-Dec-12 30-Dec-99 4 8 1 7 -1 0.1 No Investment Plist 4 50.099 46.681 43.262 39.844 36.425 33.007 29.589 22.141

1405PoA0369 8UGJLT3FSD5JOOQXLBH7CMTZCOCZ4U 8463 CFL Distribution Programme in Hunan Province Asia & Pacific East Asia China Hunan Registered EE households EE households Lighting AMS-II.J. 1 31.0 31-Jan-13 28 0.000 15.504 CEC 0.000 n.a. n.a. 23-Jul-12 1-Oct-12 29-Dec-12 28-Dec-12 PoA 31-Dec-99CPA 4 8 1 7 0.0 Plist

1406CPA0369.01 8463-0001 “CFLs Distribution Programme in Hunan Province” CPA 1 Asia & Pacific East Asia China Registered EE households EE households Lighting AMS-II.J. 1 31.0 8 8 -3.1 31-Jan-13 0.000 15.504 CEC n.a. n.a. 23-Jul-12 28-Dec-12 30-Dec-99 4 8 1 7 -1 0.1 No Investment Plist 4 40.345 37.592 34.839 32.086 29.333 26.581 23.828 17.830

1407PoA0370 60JF5L0SLCJTLAGBLIHG9LGC36MJZU 6424 CFL Distribution Programme in Jiangxi Province Asia & Pacific East Asia China Jiangxi Registered EE households EE households Lighting AMS-II.J. 1 30.8 23-Jul-12 28 0.000 15.504 CEC 0.000 n.a. n.a. 23-Jul-12 1-Sep-12 29-Dec-12 1-May-13 28-Dec-12 PoA 31-Dec-99CPA 4 8 1 7 0.0 Plist

1408CPA0370.01 6424-0001 “CFLs Distribution Programme in Jiangxi Province” CPA 1 Asia & Pacific East Asia China Ji’an City Registered EE households EE households Lighting AMS-II.J. 1 30.8 8 8 -3.1 28-Dec-12 0.000 15.504 CEC n.a. n.a. 23-Jul-12 28-Dec-12 30-Dec-99 4 8 1 7 -1 0.1 No Investment Plist 4 40.144 37.405 34.666 31.926 29.187 26.448 23.709 17.742

1409PoA0371 2B5O8ULWCLRH9MI4822W0ETZJQ4TLT 8029 CFL Distribution Programme in the Guangxi Zhuang Autonomous Region Asia & Pacific East Asia China Guangxi Registered EE households EE households Lighting AMS-II.J. 1 28.1 23-Jul-12 28 0.000 15.504 CEC 0.000 n.a. n.a. 23-Jul-12 1-Aug-12 27-Dec-12 10-Apr-13 27-Dec-12 PoA 31-Dec-99CPA 4 8 1 7 0.0 Plist

1410CPA0371.01 8029-0001 Asia & Pacific East Asia China Hechi City Registered EE households EE households Lighting AMS-II.J. 1 28.1 8 8 -3.0 27-Dec-12 0.000 15.504 CEC n.a. n.a. 23-Jul-12 27-Dec-12 30-Dec-99 4 8 1 7 -1 0.1 No Investment Plist 4 36.636 34.136 31.637 29.137 26.637 24.137 21.637 16.191

1411PoA0372 GRM7FV0TYLTODR7VTZL2MJCOTEC5NR 8387 CFL Distribution Programme in Liaoning Province Asia & Pacific East Asia China Liaoning Registered EE households EE households Lighting AMS-II.J. 1 34.3 31-Jan-13 28 0.000 15.504 CEC 0.000 n.a. n.a. 23-Jul-12 1-Aug-12 29-Dec-12 28-Dec-12 PoA 31-Dec-99CPA 4 8 1 7 0.0 Plist

1412CPA0372.01 8387-0001 “CFLs Distribution Programme in Liaoning Province” CPA 1 Asia & Pacific East Asia China Chaoyang City Registered EE households EE households Lighting AMS-II.J. 1 34.3 8 8 -3.6 31-Jan-13 0.000 15.504 CEC n.a. n.a. 23-Jul-12 28-Dec-12 30-Dec-99 4 8 1 7 -1 0.1 No Investment Plist 4 44.639 41.593 38.547 35.501 32.455 29.409 26.364 19.728

1413PoA0373 SL5GS49IZFF03OOX9SP5PL1V37OC79 8498 CFLs Distribution Programme in Henan Province Asia & Pacific East Asia China Henan Registered EE households EE households Lighting AMS-II.J. 1 29.6 1-Oct-12 28 0.000 15.504 CEC 0.000 n.a. n.a. 23-Jul-12 1-Sep-12 29-Dec-12 13-Jun-13 28-Dec-12 PoA 31-Dec-99CPA 4 8 1 7 0.0 Plist

1414CPA0373.01 8498-0001 “CFLs Distribution Programme in Henan Province” CPA 1 Asia & Pacific East Asia China Zhoukou City Registered EE households EE households Lighting AMS-II.J. 1 29.6 8 8 -3.0 31-Jan-13 0.000 15.504 CEC n.a. n.a. 23-Jul-12 28-Dec-12 30-Dec-99 4 8 1 7 -1 0.1 No Investment Plist 4 38.498 35.871 33.244 30.617 27.990 25.364 22.737 17.014

1415PoA0374 XZ6X5SOTB82ZRR5UAOTGOTM40GR5SC 8384 CFL Distribution Programme in Inner Mongolia Autonomous Region Asia & Pacific East Asia China Inner Mongolia Registered EE households EE households Lighting AMS-II.J. 1 37.5 31-Jan-13 28 0.000 15.504 CEC 0.000 n.a. n.a. 24-Jul-12 1-Sep-12 29-Dec-12 28-Dec-12 PoA 31-Dec-99CPA 4 8 1 7 0.0 Plist

1416CPA0374.01 8384-0001 CFL Distribution Programme in Inner Mongolia Autonomous Region Asia & Pacific East Asia China Hinggan League Registered EE households EE households Lighting AMS-II.J. 1 37.5 8 8 -3.9 31-Jan-13 0.000 15.504 CEC n.a. n.a. 24-Jul-12 28-Dec-12 30-Dec-99 4 8 1 7 -1 0.1 No Investment Plist 4 48.816 45.485 42.154 38.823 35.492 32.161 28.830 21.574

1417PoA0375 LRZ412MG6LYO8O45FSNJT1JNI2Q3WL 7068 CFL Distribution Programme in Shaanxi Province Asia & Pacific East Asia China Shaanxi Registered EE households EE households Lighting AMS-II.J. 1 36.6 1-Oct-12 28 0.000 15.504 CEC 0.000 n.a. n.a. 24-Jul-12 1-Oct-12 29-Dec-12 28-Dec-12 PoA 31-Dec-99CPA 4 8 1 7 0.0 Plist

1418CPA0375.01 7068-0001 “CFLs Distribution Programme in Shaanxi Province” CPA 1 Asia & Pacific East Asia China Weinan City Registered EE households EE households Lighting AMS-II.J. 1 36.6 8 8 -4.0 31-Jan-13 0.000 15.504 CEC n.a. n.a. 24-Jul-12 28-Dec-12 30-Dec-99 4 8 1 7 -1 0.1 No Investment Plist 4 47.626 44.377 41.127 37.877 34.627 31.378 28.128 21.048

1419PoA0376 VZQXOLM50CMFHSFEXTY7OMWVKFWWTP 8462 CFL Distribution Programme in Shanxi Province Asia & Pacific East Asia China Shanxi Registered EE households EE households Lighting AMS-II.J. 1 36.6 31-Jan-13 28 0.000 15.504 CEC 0.000 n.a. n.a. 24-Jul-12 1-Aug-12 29-Dec-12 28-Dec-12 PoA 31-Dec-99CPA 4 8 1 7 0.0 Plist

1420CPA0376.01 8462-0001 “CFLs Distribution Programme in Shanxi Province” CPA 1 Asia & Pacific East Asia China Lvliang Registered EE households EE households Lighting AMS-II.J. 1 36.6 8 8 -4.4 31-Jan-13 0.000 15.504 CEC n.a. n.a. 24-Jul-12 28-Dec-12 30-Dec-99 4 8 1 7 -1 0.1 No Investment Plist 4 45.405 42.306 39.208 36.110 33.012 29.914 26.816 20.066

1421PoA0377 8DW1NU237AO5ALTKRVMDVBUM230EF4 9260 The programme to introduce renewable energy system into Seoul Asia & Pacific East Asia South Korea South Korea Seoul Metropolitan Government Diffusion of renewable energy use in Seoul Registered Solar Solar Solar PV AMS-I.F. 2 1.9 7-Jun-10 28 0.000 18.780 KSA 0.000 n.a. Seoul Metropolitan Government 7-Apr-12 PoA0276 5-Dec-12 22-Dec-12 9-May-13 27-Dec-12 PoA 30-Dec-99CPA 9 8 2.1

1422CPA0377.01 9260-0001 Asia & Pacific East Asia South Korea Seoul Seoul Metropolitan Government Registered Solar Solar Solar PV 24 kw solar pv system AMS-I.F. 1 0.0 10 10 0.0 27-Dec-12 0.000 0.200 KSA n.a. Seoul Metropolitan Government 7-Apr-12 CPA0276.01 27-Dec-12 30-Dec-99 9 8 0 0.0 31 0.679 N/A Plist 0.002 0.002 0.002 0.002 0.002 0.002 0.002 0.002 0.002 0.002

1423CPA0377.02 9260-0002 Asia & Pacific East Asia South Korea Seoul Seoul Metropolitan Government Registered Solar Solar Solar PV 2042 kW Solar PV System AMS-I.F. 1 1.9 10 20 0.0 1-Feb-14 0.000 18.580 KSA Seoul Metropolitan Government 7-Apr-12 28-Jan-14 30-Dec-99 9 8 0 2.0 2737 N/A Plist 1.858 1.858 1.858 1.858 1.858 1.858 1.858 1.858 1.858 1.858

1424PoA0378 UGREN3VN3PONTDMM2ZF29VWTOT0957 9094 PoA Solar PV in Pakistan Asia & Pacific Southern Asia Pakistan Pakistan Registered Solar Solar Solar PV ACM2 1 32.1 1-Aug-12 28 0.000 257.351 TÜV-Rhein 0.000 n.a. Think Carbon 1-Aug-12 16-Oct-12 22-Dec-12 29-Mar-13 24-Dec-12 CPA 31-Dec-99Both Gold Standard 5 10 12 50.0

1425CPA0378.01 9094-0001 50MW Photovoltaic Power Project in Cholistan, Islamic Republic of Pakistan Asia & Pacific Southern Asia Pakistan Punjab Registered Solar Solar Solar PV 208350 solar modules of 240Wp ACM2 1 32.1 7 25 0.0 24-Dec-12 0.000 257.351 TÜV-Rhein n.a. Think Carbon 1-Aug-12 24-Dec-12 30-Dec-99 5 10 12 1 Germany 50.0 78000 0.539 No Financial;Other 32.070 32.070 32.070 32.070 32.070 32.070 32.070 32.070 32.070 32.070

1426PoA0379 BRUXI8QNMD9IH6YXHFMQZQ3YIXSCBM 8659 Latin America South America Colombia Colombia Registered Fugitive Fugitive Oil field flaring reduction AM9 1 159.6 2-Aug-12 28 0.000 1,596.400 GHD 0.000 n.a. n.a. 2-Aug-12 21-Dec-12 31-Dec-12 11-Jul-13 31-Dec-12 CPA 31-Dec-99CPA 5 7 9 0.0

1427CPA0379.01 8659-0001 CPA-DD for the recovery of associated gas at the Corralles oil field Latin America South America Colombia Boyacá Registered Fugitive Fugitive Oil field flaring reduction AM9 1 159.6 10 12 0.0 1-Sep-13 0.000 1,596.400 GHD n.a. n.a. 2-Aug-12 31-Dec-12 30-Dec-99 5 7 9 0 No 3 84.407 145.653 171.810 171.810 171.810 171.810 171.810 171.810 171.810 171.810

1428PoA0380 32Z3TT7LC70PMDWOEW1706HJ0ZJLN7 9626 DelAgua Public Health Program in Eastern Africa Africa East Africa Burundi Improving public health in Eastern Africa Registered EE households EE households Stoves AMS-II.G. 16 433.9 1-Oct-12 28 0.000 2,578.649 DNV 0.000 136.806 136.806 1 29-Oct-15 14-Sep-15 33.825 Sweden (Government of Sweden) DelAgua Health Rwanda 2-Aug-12 10-Oct-12 21-Nov-13 11-Feb-14 21-Nov-13 PoA 30-Dec-99Both 6 9 8 1 0.0 Plist

1429CPA0380.01 9626-0001 Africa East Africa Rwanda Rwanda Registered EE households EE households Stoves AMS-II.G. 1 67.7 7 21 0.0 1-Jan-13 0.000 541.433 DNV 14.706 14.706 1 29-Oct-15 14-Sep-15 Sweden (Government of Sweden) DelAgua Health Rwanda 2-Aug-12 21-Nov-13 30-Dec-99 6 9 8 1 1 Switzerland No Investment Plist 11.639 11.639 11.639 11.639 11.639 11.639 11.639

1430CPA0380.02 9626-0002 Africa East Africa Rwanda Western Province Registered EE households EE households Stoves AMS-II.G. 1 26.6 7 21 0.0 15-Sep-14 0.000 167.777 DNV 19.678 19.678 1 29-Oct-15 14-Sep-15 DelAgua Health Rwanda 2-Aug-12 15-Sep-14 30-Dec-99 6 9 8 1 1 Plist 26.637 26.637 26.637 26.637 26.637 26.637 26.637

1431CPA0380.03 9626-0003 Africa East Africa Rwanda Western Province Registered EE households EE households Stoves AMS-II.G. 1 33.3 7 21 0.0 15-Sep-14 0.000 209.858 DNV 24.395 24.395 1 29-Oct-15 14-Sep-15 DelAgua Health Rwanda 2-Aug-12 15-Sep-14 30-Dec-99 6 9 8 1 1 Plist 33.318 33.318 33.318 33.318 33.318 33.318 33.318

1432CPA0380.04 9626-0004 Africa East Africa Rwanda Western Province Registered EE households EE households Stoves AMS-II.G. 1 19.5 7 21 0.0 15-Sep-14 0.000 122.603 DNV 14.517 14.517 1 29-Oct-15 14-Sep-15 DelAgua Health Rwanda 2-Aug-12 15-Sep-14 30-Dec-99 6 9 8 1 1 Plist 19.465 19.465 19.465 19.465 19.465 19.465 19.465

1433CPA0380.05 9626-0005 Africa East Africa Rwanda Western Province Registered EE households EE households Stoves AMS-II.G. 1 25.3 7 21 0.0 15-Sep-14 0.000 159.620 DNV 18.494 18.494 1 29-Oct-15 14-Sep-15 DelAgua Health Rwanda 2-Aug-12 15-Sep-14 30-Dec-99 6 9 8 1 1 Plist 25.342 25.342 25.342 25.342 25.342 25.342 25.342

1434CPA0380.06 9626-0006 Africa East Africa Rwanda Western Province Registered EE households EE households Stoves AMS-II.G. 1 32.8 7 21 0.0 15-Sep-14 0.000 206.400 DNV 22.971 22.971 1 29-Oct-15 14-Sep-15 DelAgua Health Rwanda 2-Aug-12 15-Sep-14 30-Dec-99 6 9 8 1 1 Plist 32.769 32.769 32.769 32.769 32.769 32.769 32.769

1435CPA0380.07 9626-0007 Africa East Africa Rwanda Western Province Registered EE households EE households Stoves AMS-II.G. 1 29.6 7 21 0.0 15-Sep-14 0.000 186.219 DNV 22.045 22.045 1 29-Oct-15 14-Sep-15 DelAgua Health Rwanda 2-Aug-12 15-Sep-14 30-Dec-99 6 9 8 1 1 Plist 29.565 29.565 29.565 29.565 29.565 29.565 29.565

1436CPA0380.08 9626-0008 Africa East Africa Rwanda Eastern Province Registered EE households EE households Stoves AMS-II.G. 1 30.1 7 21 0.0 22-Jan-16 0.000 149.048 DNV DelAgua Health Rwanda 2-Aug-12 19-Apr-16 30-Dec-99 6 9 8 1 1 Plist 30.140 30.140 30.140 30.140 30.140 30.140 30.140

1437CPA0380.09 9626-0009 Africa East Africa Rwanda Northern Province Registered EE households EE households Stoves AMS-II.G. 1 27.9 7 21 0.0 22-Jan-16 0.000 137.798 DNV DelAgua Health Rwanda 2-Aug-12 19-Apr-16 30-Dec-99 6 9 8 1 1 Plist 27.865 27.865 27.865 27.865 27.865 27.865 27.865

1438CPA0380.10 9626-0010 Africa East Africa Rwanda Eastern Province Registered EE households EE households Stoves AMS-II.G. 1 26.9 7 21 0.0 29-Jan-16 0.000 132.343 DNV DelAgua Health Rwanda 2-Aug-12 19-Apr-16 30-Dec-99 6 9 8 1 1 Plist 26.866 26.866 26.866 26.866 26.866 26.866 26.866

1439CPA0380.11 9626-0011 Africa East Africa Rwanda Northern Province Registered EE households EE households Stoves AMS-II.G. 1 21.6 7 21 0.0 29-Jan-16 0.000 106.451 DNV DelAgua Health Rwanda 2-Aug-12 19-Apr-16 30-Dec-99 6 9 8 1 1 Plist 21.610 21.610 21.610 21.610 21.610 21.610 21.610

1440CPA0380.12 9626-0012 Africa East Africa Rwanda Eastern Province Registered EE households EE households Stoves AMS-II.G. 1 16.9 7 21 0.0 15-Jan-16 0.000 83.948 DNV DelAgua Health Rwanda 2-Aug-12 19-Apr-16 30-Dec-99 6 9 8 1 1 Plist 16.910 16.910 16.910 16.910 16.910 16.910 16.910

1441CPA0380.13 9626-0013 Africa East Africa Rwanda Eastern Province Registered EE households EE households Stoves AMS-II.G. 1 17.3 7 21 0.0 29-Jan-16 0.000 85.373 DNV DelAgua Health Rwanda 2-Aug-12 19-Apr-16 30-Dec-99 6 9 8 1 1 Plist 17.331 17.331 17.331 17.331 17.331 17.331 17.331

1442CPA0380.14 9626-0014 Africa East Africa Rwanda Eastern Province Registered EE households EE households Stoves AMS-II.G. 1 19.9 7 21 0.0 15-Jan-16 0.000 98.697 DNV DelAgua Health Rwanda 2-Aug-12 19-Apr-16 30-Dec-99 6 9 8 1 1 Plist 19.881 19.881 19.881 19.881 19.881 19.881 19.881

1443CPA0380.15 9626-0015 Africa East Africa Rwanda Eastern Province Registered EE households EE households Stoves AMS-II.G. 1 19.3 7 21 0.0 15-Jan-16 0.000 95.733 DNV DelAgua Health Rwanda 2-Aug-12 19-Apr-16 30-Dec-99 6 9 8 1 1 Plist 19.284 19.284 19.284 19.284 19.284 19.284 19.284

1444CPA0380.16 9626-0016 Africa East Africa Rwanda Eastern Province Registered EE households EE households Stoves AMS-II.G. 1 19.3 7 21 0.0 22-Jan-16 0.000 95.349 DNV DelAgua Health Rwanda 2-Aug-12 19-Apr-16 30-Dec-99 6 9 8 1 1 Plist 19.281 19.281 19.281 19.281 19.281 19.281 19.281

1445PoA0381 PI8K1FKKZH13FMHSHDP1RTGFA7FE6X 9358 Petrotrin Oil Fields Associated Gas Recovery and Utilization PoA Latin America Caribbean Trinidad and Tobago Registered Fugitive Fugitive Oil field flaring reduction AM9 1 82.3 3-Aug-12 28 0.000 576.199 ERM CVS 0.000 n.a. n.a. 3-Aug-12 4-Sep-12 31-Dec-12 16-Jul-13 31-Dec-12 CPA 30-Dec-99CPA 9 5 11 0.0

1446CPA0381.01 9358-0001 Petrotrin Oilfield Associated Gas Recovery and Utilization Project – CPA1 Latin America Caribbean Trinidad and Tobago Registered Fugitive Fugitive Oil field flaring reduction AM9 1 82.3 7 25 0.7 1-Jan-14 0.000 576.199 ERM CVS n.a. n.a. 3-Aug-12 31-Dec-12 30-Dec-99 9 5 11 0 No Financial 3 91.123 87.969 84.945 82.045 79.263 76.595 74.035

1447PoA0382 MSLDWBYDRE11T28ELC9M9RNX20ITPH Small Hydropower Programme of Activities in Armenia Europe & Central Asia Central Asia Armenia Armenia At Validation Hydro Hydro Run of river AMS-I.D. 1 1.6 3-Aug-12 28 0.000 11.155 GLC 0.000 n.a. n.a. 4-Aug-12 CPA 31-Dec-99CPA 4 9 8 11 5 1 1.2

1448CPA0382.01 Europe & Central Asia Central Asia Armenia Lori At Validation Hydro Hydro Run of river AMS-I.D. 1 1.6 7 30 0.0 1-Jan-14 0.000 11.155 GLC n.a. n.a. 4-Aug-12 30-Dec-99 4 9 8 11 5 1 1 1.2 4177 0.381 No Financial 1.593 1.593 1.593 1.593 1.593 1.593 1.593

1449PoA0383 9HL693JLCUTSWSTN848J6RSV151WK3 8855 Solar Water Heater Program in India Asia & Pacific Southern Asia India India Neutech Solar Systems Registered Solar Solar Solar water heating AMS-I.C. 4 146.3 2-Jul-07 28 0.000 912.992 TÜV-SÜD 297.481 297.481 1 28-Dec-15 31-Mar-17 1.563Earthhood Germany (Carbonbay) Netherlands (Mabanaft) Climate Focus 3-Aug-11 10-Oct-12 31-Dec-12 27-Mar-13 31-Dec-12 PoA 30-Dec-99PoA 10 9 1 5 11 0.0 MSC

1450CPA0383.01 8855-0001 Solar Water Heater Program in India- “CPA 1” Asia & Pacific Southern Asia India India Neutech Solar Systems Registered Solar Solar Solar water heating AMS-I.C. 1 31.5 7 15 0.0 31-Dec-12 0.000 252.173 TÜV-SÜD 102.560 102.560 1 28-Dec-15 31-Mar-17 Earthhood Germany (Carbonbay) Netherlands (Mabanaft) Climate Focus 3-Aug-11 31-Dec-12 30-Dec-99 10 9 1 5 11 -5 Nuetech India 0.890 36.7 No MSC 31,500.000 31,500.000 31,500.000 31,500.000 31,500.000 31,500.000 31,500.000

1451CPA0383.02 8855-0002 Solar Water Heater Program in India-“CPA-2” Asia & Pacific Southern Asia India India Neutech Solar Systems Registered Solar Solar Solar water heating AMS-I.C. 1 38.5 7 21 0.0 1-Apr-15 221.825 TÜV-SÜD 67.484 67.484 1-Dec-16 31-Mar-17 Earthhood Climate Focus 3-Aug-11 31-Mar-15 30-Dec-99 10 9 1 5 11 -5 Nuetech India No MSC 38.537 38.537 38.537 38.537 38.537 38.537 38.537

1452CPA0383.03 8855-0003 Solar Water Heater Program in India- “CPA-3” Asia & Pacific Southern Asia India India Neutech Solar Systems Registered Solar Solar Solar water heating AMS-I.C. 1 38.1 7 21 0.0 1-Apr-15 219.540 TÜV-SÜD 65.344 65.344 1-Dec-16 31-Mar-17 Earthhood Climate Focus 3-Aug-11 13-Apr-15 30-Dec-99 10 9 1 5 11 -5 Nuetech India No MSC 38.140 38.140 38.140 38.140 38.140 38.140 38.140

1453CPA0383.04 8855-0004 Solar Water Heater Program in India- “CPA-4” Asia & Pacific Southern Asia India India Neutech Solar Systems Registered Solar Solar Solar water heating AMS-I.C. 1 38.1 7 21 0.0 1-Apr-15 219.454 TÜV-SÜD 62.093 62.093 1-Dec-16 31-Mar-17 Earthhood Climate Focus 3-Aug-11 13-Apr-15 30-Dec-99 10 9 1 5 11 -5 Nuetech India No MSC 38.125 38.125 38.125 38.125 38.125 38.125 38.125

1454PoA0384 GUMWVJJOF0XIAJDZKJJPKOIMHFUKLJ 5997 Standard Bank Low Pressure Solar water heater Programme for South Africa Africa Southern Africa South Africa South Africa Standard Bank Registered Solar Solar Solar water heating AMS-I.C. 5 201.3 1-Apr-11 28 200.000 2,012.640 JCI 0.000 n.a. United K. (Standard Bank) International Carbon 3-Feb-11 PoA0077 9-Sep-11 3-Apr-12 22-Jun-12 24-Apr-12 PoA 30-Dec-99PoA 5 7 8 0.0

1455CPA0384.01 5997-0001 Africa Southern Africa South Africa KwaZulu-Natal Standard Bank Registered Solar Solar Solar water heating Solar Water Heaters AMS-I.C. 1 38.6 10 15 0.0 2-May-12 200.000 385.630 JCI n.a. United K. (Standard Bank) International Carbon 3-Feb-11 CPA0077.01 24-Apr-12 30-Dec-99 5 7 8 0 0.955 No N/A MSC 2,047.000 ### 35,569.000 41,762.000 41,762.000 41,762.000 41,762.000 41,762.000 41,762.000 ### ###

1456CPA0384.02 5997-0002 Africa Southern Africa South Africa Gauteng Standard Bank Registered Solar Solar Solar water heating Solar Water Heaters AMS-I.C. 1 36.3 10 15 0.0 1-Jan-13 0.000 362.910 JCI International Carbon 3-Feb-11 29-Dec-12 30-Dec-99 5 7 8 0 0.977 No N/A MSC 36.291 36.291 36.291 36.291 36.291 36.291 36.291 36.291 36.291 36.291

1457CPA0384.03 5997-0003 Africa Southern Africa South Africa Gauteng Standard Bank Registered Solar Solar Solar water heating Solar Water Heaters AMS-I.C. 1 39.3 10 15 0.0 1-Jan-13 0.000 392.830 JCI International Carbon 3-Feb-11 29-Dec-12 30-Dec-99 5 7 8 0 0.977 No N/A MSC 39.283 39.283 39.283 39.283 39.283 39.283 39.283 39.283 39.283 39.283

1458CPA0384.04 5997-0004 Africa Southern Africa South Africa KwaZulu-Natal Standard Bank Registered Solar Solar Solar water heating Solar Water Heaters AMS-I.C. 1 43.6 10 15 0.0 1-Jan-14 0.000 436.270 JCI International Carbon 3-Feb-11 29-Nov-13 30-Dec-99 5 7 8 0 0.977 No N/A MSC 42.864 43.711 43.711 43.711 43.711 43.711 43.711 43.711 43.711 43.711

1459CPA0384.05 5997-0005 Africa Southern Africa South Africa KwaZulu-Natal Standard Bank Registered Solar Solar Solar water heating Solar Water Heaters AMS-I.C. 1 43.5 10 15 0.0 1-Jan-14 0.000 435.000 JCI International Carbon 3-Feb-11 29-Nov-13 30-Dec-99 5 7 8 0 0.977 No N/A MSC 41.595 43.711 43.711 43.711 43.711 43.711 43.711 43.711 43.711 43.711

1460PoA0385 6Z2C6STXAAGJJS0CQCUC0PPPXPHNG7 Africa North Africa Egypt Egypt Validation Terminated EE service EE service Water pumping AMS-II.C. 1 8.6 1-Oct-12 28 1.430 70.343 BV Cert 0.000 n.a. Integral Consult 8-Aug-12 CPA 30-Dec-99PoA 3 2 9 8 5 0.0

1461CPA0385.01 Nassr 5 Irrigation Station Africa North Africa Egypt Qaryah Validation Terminated EE service EE service Water pumping Rehabilitation of water pumping station AMS-II.C. 1 8.6 7 25 0.0 1-Nov-12 1.430 70.343 BV Cert n.a. Integral Consult 8-Aug-12 30-Dec-99 3 2 9 8 5 0 8.9 No Investment 5 8.610 8.610 8.610 8.610 8.610 8.610 8.610

1462PoA0386 D7ZYQ7XT0V8YRUYVW8TJP7I3UM9YEC Implementation of efficient lighting LED PoA scheme in India Asia & Pacific Southern Asia India India Energetic Lighting India Validation Terminated EE service EE service Street lighting AMS-II.C. 1 2.2 15-May-12 28 0.000 22.140 TÜV-Rhein 0.000 n.a. n.a. 11-Aug-12 PoA 30-Dec-99CPA 2 9 7 5 0.0

1463CPA0386.01 Asia & Pacific Southern Asia India Delhi Energetic Lighting India Validation Terminated EE service EE service Street lighting 5000 LED streetlights AMS-II.C. 1 2.2 10 11 0.0 1-Apr-13 0.000 22.140 TÜV-Rhein n.a. n.a. 11-Aug-12 30-Dec-99 2 9 7 5 0 1.9 No MSC 2.214 2.214 2.214 2.214 2.214 2.214 2.214 2.214 2.214 2.214

1464PoA0387 2ICH6V7HVFXG3NNZFBQNOYATN1E5PS Impact Carbon Safe Water Access Program Africa East Africa Rwanda Rwanda Impact Carbon Validation Terminated EE service EE service Water purification AMS-III.AV. 1 13.9 6-Aug-12 28 0.480 116.528 DNV 0.000 n.a. n.a. 14-Aug-12 PoA 30-Dec-99CPA 4 1 6 8 9 5 0.0

1465CPA0387.01 Impact Carbon Safe Water Access Program: CPA 1 Africa East Africa Rwanda Eastern Districts Impact Carbon Validation Terminated EE service EE service Water purification AMS-III.AV. 1 13.9 7 21 3.3 14-Aug-12 0.480 116.528 DNV n.a. n.a. 14-Aug-12 30-Dec-99 4 1 6 8 9 5 0 No N/A MSC 0.480 4.798 11.994 19.999 19.999 19.999 19.999

1466PoA0388 QEZ4Q8JL3HHUFKLIXHZ59OWOAWSYIX Implementation of efficient lighting CFL PoA scheme in India Asia & Pacific Southern Africa India India Energetic Lighting India Validation Terminated EE households EE households Lighting AMS-II.J. 1 1.6 15-May-12 28 0.000 12.169 TÜV-Rhein 0.000 n.a. n.a. 14-Aug-12 PoA 30-Dec-99CPA 9 7 5 11 0.0

1467CPA0388.01 CFLP-CPA-001: First CPA for CFL distribution Asia & Pacific Southern Africa India Haryana Energetic Lighting India Validation Terminated EE households EE households Lighting Installation of CFLs to 5000 households AMS-II.J. 1 1.6 7 8 -0.2 1-Apr-13 0.000 12.169 TÜV-Rhein n.a. n.a. 14-Aug-12 30-Dec-99 9 7 5 11 0 1.8 No N/A MSC 1.973 1.839 1.704 1.569 1.435 1.300 1.166

1468PoA0389 3J0ZD6PPEZ3DEZQO0OMBFCMN8DWI48 City of Cape Town Treatment of Organic Waste Streams CDM Projects Africa Southern Africa South Africa South Africa City of Cape Town Validation Terminated Methane avoidance Methane avoidance Waste water AMS-I.C.+AMS-III.H. 1 21.4 1-Jul-13 28 0.000 118.034 Carbon Check 0.000 n.a. n.a. 21-Aug-12 28-May-13 CPA 31-Dec-99CPA 9 0.0

1469CPA0389.01 Cape Flats Anaerobic Digestion Facility (CPA01) Africa Southern Africa South Africa Western Cape City of Cape Town Validation Terminated Methane avoidance Methane avoidance Waste water AMS-I.C.+AMS-III.H. 1 21.4 7 21 1.3 1-Jul-15 0.000 118.034 Carbon Check n.a. n.a. 21-Aug-12 28-May-13 30-Dec-99 9 0 No Prevailing practice 6.482 15.660 18.190 20.580 22.830 24.950 26.940 14.409

1470PoA0390 DTYFA2C351YZZ75XHNC66K8M2OB6MH 9276 Energy Efficiency Program in Rural Bangladesh Asia & Pacific Southern Asia Bangladesh Bangladesh Registered EE service EE service Water purification AMS-III.AV. 1 55.2 22-Aug-12 28 0.000 551.980 ERM CVS 0.000 n.a. n.a. 22-Aug-12 1-Jan-13 7-Jun-13 11-Oct-13 7-Jun-13 PoA 30-Dec-99PoA 3 6 4 9 0.0 MSC Yes

1471CPA0390.01 9276-0001 Asia & Pacific Southern Asia Bangladesh Chandpur Registered EE service EE service Water purification AMS-III.AV. 1 55.2 10 10 0.0 1-Jan-13 0.000 551.980 ERM CVS n.a. n.a. 22-Aug-12 7-Jun-13 30-Dec-99 3 6 4 9 1 Switzerland No Investment MSC Yes 57.798 57.798 57.798 57.798 57.798 57.798 57.798 57.798 57.798 57.798

1472PoA0391 YQ6M5MUR0276MUE1XSQY44Z36S7UDS 9666 Promoting Efficient Stove Dissemination and Use in West Africa Africa West Africa Burkina Faso E+Carbon Registered EE households EE households Stoves AMS-II.G. 3 141.1 1-Dec-12 28 0.000 819.967 DNV 271.080 29-Jun-17 31-Mar-17 TÜV Nord Sweden (Government of Sweden) n.a. 24-Aug-12 PoA0225 15-Dec-11 24-Jun-13 11-Oct-13 24-Jun-13 CPA 30-Dec-99CPA 1 6 8 9 0.0 Plist

1473CPA0391.01 9666-0001 Africa West Africa Togo Togo E+Carbon Registered EE households EE households Stoves AMS-II.G. 1 45.2 7 7 7.0 1-Jan-13 0.000 361.668 DNV 216.405 216.405 29-Jun-17 31-Mar-17 Sweden (Government of Sweden) n.a. 24-Aug-12 CPA0225.0001 24-Jun-13 30-Dec-99 1 6 8 9 1 Ghana 171.6 No Investment Plist 3 8.966 51.290 51.290 51.290 51.290 51.290 50.929

1474CPA0391.02 9666-0002 Africa West Africa Togo Togo E+Carbon Registered EE households EE households Stoves AMS-II.G. 1 47.9 7 7 22-Mar-16 229.150 DNV 54.674 54.674 21-Feb-18 31-Mar-17 n.a. 24-Aug-12 22-Mar-16 30-Dec-99 1 6 8 9 1 Ghana No Plist 28.304 51.291 51.291 51.291 51.291 51.291 50.764

1475CPA0391.03 9666-0003 Africa West Africa Togo Togo E+Carbon Registered EE households EE households Stoves AMS-II.G. 1 47.9 7 7 22-Mar-16 229.150 DNV n.a. 24-Aug-12 22-Mar-16 30-Dec-99 1 6 8 9 1 Ghana No Plist 28.304 51.291 51.291 51.291 51.291 51.291 50.764

1476PoA0392 WO5VV2U1XZA9X7CGMXYSBIPPFZXZ3B Tunisian cogeneration development programme (PoA) Africa North Africa Tunisia Tunisia Validation Terminated EE supply side EE supply side Cogeneration AMS-II.H. 1 1.9 1-Nov-12 28 0.160 19.240 BV Cert 0.000 n.a. n.a. 30-Aug-12 PoA 30-Dec-99PoA 4 9 5 11 2.0

1477CPA0392.01 Cartonnerie Tunisienne cogeneration project Africa North Africa Tunisia Enfidha Validation Terminated EE supply side EE supply side Cogeneration AMS-II.H. 1 1.9 10 20 0.0 1-Dec-12 0.160 19.240 BV Cert n.a. n.a. 30-Aug-12 30-Dec-99 4 9 5 11 0 2.0 15400 0.542 10.0 No Technological 1.924 1.924 1.924 1.924 1.924 1.924 1.924 1.924 1.924 1.924

1478PoA0393 22WZJA189ELOHZ452NI1SXUPG6XT9J Latin America South America Colombia Colombia At Validation Fugitive Fugitive Oil field flaring reduction AM29 1 1.0 31-Aug-12 28 0.000 10.350 GHD 0.000 n.a. n.a. 31-Aug-12 CPA 31-Dec-99CPA 9 1 5 7 10.5

1479CPA0393.01 Electricity generation from natural gas normally flared at the Corrales oil field. Latin America South America Colombia Boyacá At Validation Fugitive Fugitive Oil field flaring reduction AM29 1 1.0 10 10 0.0 31-Dec-12 0.000 10.350 GHD n.a. n.a. 31-Aug-12 30-Dec-99 9 1 5 7 0 10.5 0.534 No Investment 3 1.035 1.035 1.035 1.035 1.035 1.035 1.035 1.035 1.035 1.035

1480PoA0394 FJJ08SSP8ZU3R6HL7T219WWX03183L ALUPAR Renewable Energy Programme Latin America South America Brazil Brazil Ambio Participações Ltda. Validation Terminated Hydro Hydro Run of river ACM2 1 21.5 30-Apr-12 28 0.000 171.675 RINA 0.000 n.a. n.a. 1-Sep-12 PoA0305 CPA 31-Dec-99PoA 4 5 9 11 23.0

1481CPA0394.01 ALUPAR Renewable Energy Programme Version 01 Latin America South America Brazil Minas Gerais Ambio Participações Ltda. Validation Terminated Hydro Hydro Run of river ACM2 1 21.5 7 30 0.0 1-Jan-13 0.000 171.675 RINA n.a. n.a. 1-Sep-12 CPA0305.001 30-Dec-99 4 5 9 11 0 23.0 107923 0.020 No 3 21.452 21.452 21.452 21.452 21.452 21.452 21.452

1482PoA0395 EHD7YA6MXW474KKDAJKEW6MHX5HIZ7 9769 Energy Efficient Stoves Program (EESP) Africa East Africa Ethiopia Ethiopia Standard Bank Plc Registered EE households EE households Stoves AMS-II.G. 3 139.6 5-Sep-12 28 10.499 1,314.659 TÜV-Nord 224.153 224.153 24-Jun-16 16-Oct-16 TÜV-NORD United K. (Standard Bank) n.a. 5-Sep-12 17-Oct-13 PoA 30-Dec-99CPA Gold Standard 4 7 8 9 6 0.0 MSC

1483CPA0395.01 9769-0001 Energy Efficient Stoves Program CPA 1 Africa East Africa Ethiopia Oromia Standard Bank Plc Registered EE households EE households Stoves AMS-II.G. 1 46.5 7 21 0.0 1-Oct-12 10.499 384.079 TÜV-Nord 103.639 103.639 24-Jun-16 16-Oct-16 TÜV-NORD United K. (Standard Bank) n.a. 5-Sep-12 17-Oct-13 30-Dec-99 4 7 8 9 6 -1 180.0 No MSC 41.996 41.996 41.996 41.996 41.996 41.996 41.996

1484CPA0395.02 9769-0002 Energy Efficient Stoves Program CPA 2 Africa East Africa Ethiopia Many Standard Bank Plc Registered EE households EE households Stoves AMS-II.G. 1 46.5 10 0.0 29-Apr-14 0.000 465.280 TÜV-Nord 72.011 72.011 24-Jun-16 16-Oct-16 TÜV-NORD United K. (Standard Bank) n.a. 5-Sep-12 28-Apr-14 30-Dec-99 4 7 8 9 6 -1 180.0 No MSC 46.530 46.530 46.530 46.530 46.530 46.530 46.530 46.530 46.530 46.530

1485CPA0395.03 9769-0003 Energy Efficient Stoves Program CPA 3 Africa East Africa Ethiopia Many Standard Bank Plc Registered EE households EE households Stoves 38,868 energy efficient cooking stoves AMS-II.G. 1 46.5 10 10 0.0 30-May-14 0.000 465.300 TÜV-Nord 48.503 48.503 14-Dec-17 16-Oct-16 TÜV-NORD United K. (Standard Bank) n.a. 5-Sep-12 30-May-14 30-Dec-99 4 7 8 9 6 -1 180.0 No MSC 46.530 46.530 46.530 46.530 46.530 46.530 46.530 46.530 46.530 46.530

1486PoA0396 6I0AD6KH0W3GC8M73EYS2AO8BZPOFS Solar Energy and Energy Efficiency in Africa Africa Southern Africa South Africa South Africa Validation Terminated Solar Solar Solar water heating 1 0.0 31-Dec-12 28 0.000 0.144 Carbon Check 0.000 n.a. n.a. 20-Sep-12 PoA 30-Dec-99PoA 5 7 1 10 9 0.0

1487CPA0396.01 Solridge Solar Water Heating System Africa Southern Africa South Africa Johannesburg Validation Terminated Solar Solar Solar water heating 1 0.0 7 20 0.0 1-Jan-13 0.000 0.144 Carbon Check n.a. n.a. 20-Sep-12 30-Dec-99 5 7 1 10 9 0 No N/A MSC 0.018 0.018 0.018 0.018 0.018 0.018 0.018

1488PoA0397 LYASMHII14XF02XM3LU9ERNQ2W2U7X For Stoves Programme of Activities Interregional Interregional Tanzania All For Stoves Ltd Validation Terminated EE households EE households Stoves AMS-II.G. 1 62.6 27-Sep-12 28 0.000 626.240 TÜV-Rhein 0.000 n.a. n.a. 28-Sep-12 CPA 30-Dec-99CPA 4 1 6 8 3 9 0.0 Yes

1489CPA0397.01 CPA 001 – Efficient Maasai stoves in Monduli district of Tanzania Interregional Interregional Tanzania Tanzania For Stoves Ltd Validation Terminated EE households EE households Stoves 18,700 efficient Maasai stoves AMS-II.G. 1 62.6 10 10 0.0 1-Jan-13 0.000 626.240 TÜV-Rhein n.a. n.a. 28-Sep-12 30-Dec-99 4 1 6 8 3 9 -4 355.3 No N/A MSC Yes 62.624 62.624 62.624 62.624 62.624 62.624 62.624 62.624 62.624 62.624 1490PoA0398 8P1RVLX86UGU26JK8ZZC0WXQ20RKU7 Mangrove Restoration Program in Senegal Africa West Africa Senegal Senegal Livelihoods Fund To restore degraded wetlands Validation Terminated Afforestation Afforestation Mangroves AR-AMS3+AR-AM14 1 13.5 21-Jun-10 60 26.298 142.766 Ernst & Young 0.000 n.a. n.a. 28-Sep-12 PoA 31-Dec-99CPA 5 8 9 7 2 3 0.01491CPA0398.01 Africa West Africa Senegal Livelihoods Fund Validation Terminated Afforestation Afforestation Mangroves AR-AMS3+AR-AM14 1 13.5 30 30 21-Jun-10 26.298 142.766 Ernst & Young n.a. n.a. 28-Sep-12 30-Dec-99 5 8 9 7 2 3 2 No 10.956 12.330 13.957 15.713 17.466 19.099 20.519 21.668 22.516 23.060 23.317 23.315 23.093 22.689 13.395 12.745 12.023 11.258 10.474 9.689 8.918 8.173 7.461 6.789

1492PoA0399 1KNU8TSEJ6IHMFSVZSQR9AAWDYCWTT EcoProfitableTM Lighting Africa by ENERCAP SAS Africa Interregional Chad ENERCAP Validation Terminated EE households EE households Lighting AMS-II.J. 1 41.9 5-Oct-12 28 0.000 419.380 BV Cert 0.000 n.a. n.a. 5-Oct-12 CPA 30-Dec-99CPA 8 9 7 11 1 0.0

1493CPA0399.01 EcoProfitableTM Lighting in Chad by ENERCAP SAS EL-CPA-001-CH Africa Central Africa Chad Chad ENERCAP Validation Terminated EE households EE households Lighting AMS-II.J. 1 41.9 10 10 0.0 1-Jun-13 0.000 419.380 BV Cert n.a. n.a. 5-Oct-12 30-Dec-99 8 9 7 11 1 1 0.760 55.2 Yes 41.916 41.916 41.916 41.916 41.916 41.916 41.916 41.916 41.916 41.916

1494PoA0400 T5WVXJVDEZIV7FEB8W36OEU3J3F36L 8964 Latin America South America Uruguay Uruguay SoWiTec trading GmbH Registered Wind Wind Wind ACM2 1 190.1 6-Oct-12 28 0.000 1,522.122 TÜV-Nord 0.000 Germany (SoWiTec) n.a. 6-Oct-12 10-Dec-12 20-Dec-12 31-Dec-12 CPA 31-Dec-99CPA 10 9 5 8 11 7 81.0

1495CPA0400.01 8964-0001 Castillos Norte Latin America South America Uruguay Rocha SoWiTec trading GmbH Registered Wind Wind Wind 27 wind turbines with capacity 3 MW ACM2 1 190.1 7 20 0.0 31-Dec-12 0.000 1,522.122 TÜV-Nord Germany (SoWiTec) n.a. 6-Oct-12 31-Dec-12 30-Dec-99 10 9 5 8 11 7 1 Vestas Denmark 81.0 319676 0.565 No 3 180.532 180.532 180.532 180.532 180.532 180.532 180.532

1496PoA0401 0W7I73LAE2LA0H5VNHGR3V8U1TFR08 9593 Demand side energy efficiency measures in building lighting systems Asia & Pacific Southeast Asia Singapore Singapore Registered EE households EE households Lighting AMS-II.C. 1 6.3 14-Aug-10 28 0.000 62.910 BV Cert 0.000 n.a. n.a. 9-Oct-12 PoA0056 22-Nov-10 11-Feb-14 11-Apr-14 5-Jun-14 CPA 30-Dec-99CPA 4 9 11 5 0.0

1497CPA0401.01 9593-0001 Asia & Pacific Southeast Asia Singapore Singapore Registered EE households EE households Lighting Installing LEDs in residential buildings AMS-II.C. 1 6.3 10 11 0.0 1-Jan-13 0.000 62.910 BV Cert n.a. n.a. 9-Oct-12 CPA0056.0001 5-Jun-14 30-Dec-99 4 9 11 5 0 0.486 12.9 No N/A MSC 6.291 6.291 6.291 6.291 6.291 6.291 6.291 6.291 6.291 6.291

1498PoA0402 WX544COCWJL2NG49TY4F92ADVPWRFG 9399 Asia & Pacific East Asia China Hebei Registered Methane avoidance Methane avoidance Manure AMS-III.R.+AMS-I.C. 1 7.9 15-Oct-12 28 0.000 78.800 TÜV-Nord 0.000 United K. (CFP Energy) n.a. 12-Oct-12 1-Dec-12 29-Dec-12 14-Jun-13 29-Dec-12 PoA 30-Dec-99PoA 9 8 1 6 2 0.0 Plist

1499CPA0402.01 9399-0001 Asia & Pacific East Asia China Registered Methane avoidance Methane avoidance Manure Biogas digester systems AMS-III.R.+AMS-I.C. 1 7.9 10 10 0.0 28-Jan-13 0.000 78.800 TÜV-Nord United K. (CFP Energy) n.a. 12-Oct-12 29-Dec-12 30-Dec-99 9 8 1 6 2 0 No Plist 7.223 7.880 7.880 7.880 7.880 7.880 7.880 7.880 7.880 7.880 0.657

1500PoA0403 RHG9YZJ3O966RE0FQG6O7C6R2EI4YZ 9731 Energy Efficiency through Micro irrigation system - India Asia & Pacific Southern Asia India India Registered Agriculture Agriculture Irrigation AMS-II.F. 1 3.5 30-Nov-12 28 0.509 34.730 BV Cert 0.000 n.a. n.a. 19-Oct-12 23-Apr-13 6-Sep-13 31-Oct-12 6-Sep-13 Neither 30-Dec-99CPA 2 8 4 9 2 3 0.0

1501CPA0403.01 9731-0001 CPA 001 - Installation of drip irrigation system in 9 taluks of Maharashtra Asia & Pacific Southern Asia India Maharashtra Registered Agriculture Agriculture Irrigation Drip irrigation systems AMS-II.F. 1 3.5 10 10 0.0 1-Dec-12 0.509 34.730 BV Cert n.a. n.a. 19-Oct-12 6-Sep-13 30-Dec-99 2 8 4 9 2 3 -1 India 0.910 14.6 No N/A MSC 6.107 6.107 6.107 6.107 6.107 6.107 6.107 6.107 6.107 6.107

1502PoA0404 YFW4NB1XOJU1HY99D8QUS6DFPVTGMD 9421 LNG Bus Promoting Programme in Guangdong Province Asia & Pacific East Asia China Guangdong CNOOC Gas & Power Group Registered Transport Transport More efficient vehicles AMS-III.AY. 1 3.3 28-Oct-12 28 0.000 33.460 BV Cert 0.000 n.a. n.a. 28-Oct-12 1-Dec-12 30-Dec-12 3-Jul-13 30-Dec-12 PoA 30-Dec-99CPA 1 8 9 5 0.0

1503CPA0404.01 9421-0001 “LNG Bus Promoting Programme in Guangdong Province”-CPA1 Asia & Pacific East Asia China Guangdong CNOOC Gas & Power Group Registered Transport Transport More efficient vehicles Introduction of LNG busses AMS-III.AY. 1 3.3 10 10 -0.2 1-Feb-13 0.000 33.460 BV Cert n.a. n.a. 28-Oct-12 30-Dec-12 30-Dec-99 1 8 9 5 -1 No 5.192 4.771 4.354 3.941 3.532 3.128 2.727 2.331 1.939 1.550 1504PoA0405 XKDQLUWSV7TUTU0ZGXBVQPWBK6807A 9672 Paradigm Sub Saharan Africa Cook Stove Programme Africa East Africa Ethiopia Rwanda Ethiopia, Rwanda The Paradigm Project (TPP) Registered EE households EE households Stoves AMS-II.G. 2 65.0 1-Jan-13 28 0.000 497.362 ERM CVS 2.512 15-Aug-17 31-Dec-16 Carbon Check Sweden (NEFCO) n.a. 30-Oct-12 6-Nov-12 1-Jul-13 24-Oct-13 1-Jul-13 CPA 30-Dec-99PoA 1 4 6 8 7 0.0

1505CPA0405.01 9672-0001 Paradigm Cook Stove Programme: Ethiopia 01 (TPP-CPA-01-ETH) Africa East Africa Ethiopia Ethiopia The Paradigm Project (TPP) Registered EE households EE households Stoves AMS-II.G. 1 30.8 7 21 -1.9 1-Jan-13 0.000 246.092 ERM CVS 2.512 2.512 15-Aug-17 31-Dec-16 Sweden (NEFCO) n.a. 30-Oct-12 1-Jul-13 30-Dec-99 1 4 6 8 7 -1 No N/A MSC 5.287 13.218 22.207 29.741 35.637 40.151 43.108

1506CPA0405.02 9672-0002 Paradigm Cook Stove Programme: Rwanda 01 (TPP-CPA-01-RWN) Africa East Africa Rwanda Rwanda The Paradigm Project (TPP) Registered EE households EE households Stoves AMS-II.G. 1 34.2 7 21 -2.5 1-Sep-13 0.000 251.270 ERM CVS n.a. 30-Oct-12 1-Jul-13 30-Dec-99 Gold Standard 1 4 6 8 7 0 MSC 16.454 44.305 39.875 35.887 32.299 29.069 26.162 15.676

1507PoA0406 0J61THGAOYD4I9SY3NSOUY0HRHI0R3 6207 Improved Cook Stoves programme for Rwanda Africa East Africa Rwanda Rwanda atmosfair gGmbH Registered EE households EE households Stoves AMS-II.G. 7 245.1 15-May-11 28 9.948 2,450.770 TÜV-Rhein 0.000 212.381 212.381 1 16-Mar-15 30-Jun-17 Carbon Check Germany (atmosfair) atmosfair 14-May-11 2-Aug-11 11-May-12 6-Nov-12 31-Aug-12 PoA 30-Dec-99PoA Gold Standard 1 4 6 8 5 0.0

1508CPA0406.01 6207-0001 CPA # 1 Improved Cook Stoves programme for Rwanda Africa East Africa Rwanda Rwanda atmosfair gGmbH Registered EE households EE households Stoves AMS-II.G. 1 39.8 10 10 3.6 1-Oct-12 9.948 397.900 TÜV-Rhein 120.521 120.521 1 16-Mar-15 30-Jun-17 Carbon Check Germany (atmosfair) atmosfair 14-May-11 31-Aug-12 30-Dec-99 1 4 6 8 5 -4 Germany No 28.519 57.197 57.197 60.771 60.771 60.771 60.771 60.771 60.771 60.771

1509CPA0406.02 6207-0002 CPA 2 Improved Cook Stoves programme for Rwanda Africa East Africa Rwanda Rwanda atmosfair gGmbH Registered EE households EE households Stoves AMS-II.G. 1 33.3 10 13 0.0 1-Feb-14 0.000 333.030 TÜV-Rhein 32.205 32.205 1 16-Mar-15 30-Jun-17 Carbon Check atmosfair 14-May-11 23-Jan-14 30-Dec-99 1 4 6 8 5 2 Germany No 12.933 35.566 35.566 35.566 35.566 35.566 35.566 35.566 35.566 35.566

1510CPA0406.03 6207-0003 CPA 3 Improved Cook Stoves programme for Rwanda - Inyenyeri Africa East Africa Rwanda Rwanda atmosfair gGmbH Registered EE households EE households Stoves Phillips Woodstoves AMS-II.G. 1 41.5 10 5 0.0 1-Feb-15 414.580 TÜV-Rhein 0.000 30-Jun-17 Carbon Check atmosfair 14-May-11 12-Jan-15 30-Dec-99 1 4 6 8 5 0 38.322 41.806 41.806 41.806 41.806 41.806 41.806 41.806 41.806 41.806 1511CPA0406.04 6207-0004 Improved Cook Stoves programme for Rwanda #CPA1 Cameroon Africa West Africa Cameroon Cameroon atmosfair gGmbH Registered EE households EE households Stoves Envirofit Stoves AMS-II.G. 1 19.4 10 5 0.0 1-Mar-15 193.840 TÜV-Rhein 0.000 30-Jun-17 Carbon Check atmosfair 14-May-11 3-Feb-15 30-Dec-99 1 4 6 8 5 0 19.384 19.384 19.384 19.384 19.384 19.384 19.384 19.384 19.384 19.384 1512CPA0406.05 6207-0005 CPA 4 Improved Cook Stoves programme for Rwanda Africa West Africa Rwanda Rwanda atmosfair gGmbH Registered EE households EE households Stoves Envirofit Stoves AMS-II.G. 1 44.1 10 10 0.0 1-Aug-15 440.950 TÜV-Rhein 58.543 58.543 30-Jun-17 Carbon Check atmosfair 14-May-11 28-Jul-15 30-Dec-99 1 4 6 8 5 0 No 44.095 44.095 44.095 44.095 44.095 44.095 44.095 44.095 44.095 44.095 1513CPA0406.06 6207-0006 CPA 5 Improved Cook Stoves programme for Rwanda Africa West Africa Rwanda Rwanda atmosfair gGmbH Registered EE households EE households Stoves Envirofit Stoves AMS-II.G. 1 44.1 10 10 0.0 1-Aug-15 440.950 TÜV-Rhein 1.112 1.112 30-Jun-17 Carbon Check atmosfair 14-May-11 28-Jul-15 30-Dec-99 1 4 6 8 5 0 No 44.095 44.095 44.095 44.095 44.095 44.095 44.095 44.095 44.095 44.095

1514CPA0406.07 6207-0007 Improved Cook Stoves programme for Rwanda #CPA2 Cameroon Africa West Africa Cameroon Cameroon atmosfair gGmbH Registered EE households EE households Stoves Envirofit Stoves AMS-II.G. 1 23.0 10 10 0.0 1-Jan-17 229.520 TÜV-Rhein atmosfair 14-May-11 29-Feb-16 30-Dec-99 1 4 6 8 5 0 No 20.952 20.952 20.952 20.952 20.952 20.952 20.952 20.952 20.952 20.952 1515PoA0407 IOFM64J8NKRLE79RLAD0MLC9ERI1LJ 9863 The MRTS PoA Asia & Pacific Southern Asia India India Delhi Metro Rail Corporation Registered Transport Transport Mode shift: Road to rail ACM16 3 1,038.2 8-Feb-12 28 0.000 10,382.200 LRQA 0.000 n.a. n.a. 6-Nov-12 12-Dec-12 9-Oct-14 27-Nov-14 9-Oct-14 PoA 30-Dec-99CPA 8 1 6 9 0.0

1516CPA0407.01 9863-0001 CPA001: Delhi Metro under MRTS PoA Asia & Pacific Southern Asia India Delhi Delhi Metro Rail Corporation Registered Transport Transport Mode shift: Road to rail 103.5 km of a metro line ACM16 1 637.4 10 30 16.9 1-Jan-16 0.000 6,374.400 LRQA n.a. n.a. 6-Nov-12 9-Oct-14 30-Dec-99 8 1 6 9 0 No Investment;Other 552.710 570.296 588.441 607.162 626.477 646.545 660.716 675.188 689.967 705.059

1517CPA0407.02 9863-0002 CPA002: Ahmedabad Metro Rail Project Phase -I under MRTS PoA Asia & Pacific Southern Asia India Gujarat Delhi Metro Rail Corporation Registered Transport Transport Mode shift: Road to rail 37.928 km of a metro line ACM16 1 138.8 10 30 1-Jan-18 0.000 1,388.120 LRQA n.a. n.a. 6-Nov-12 23-Jun-17 30-Dec-99 8 1 6 9 0 No Investment;Other 88.239 102.660 116.696 130.337 138.822 147.017 154.925 162.551 169.899 176.973

1518CPA0407.03 9863-0003 Asia & Pacific Southern Asia India Maharashtra Delhi Metro Rail Corporation Registered Transport Transport Mode shift: Road to rail 33.508 km of a metro line ACM16 1 262.0 10 30 1-Jan-21 2,619.680 LRQA n.a. n.a. 6-Nov-12 21-Dec-17 30-Dec-99 8 1 6 9 0 No 239.715 244.090 248.214 253.334 255.727 262.695 269.363 277.107 281.819 287.616

1519PoA0408 P9LYV41OA2XBW7OXCUMM5LIWZPUQTJ 9502 PoA on RE Asia & Pacific Southern Asia India India Core CarbonX Solutions Registered Hybrid renewables Hybrid renewables Solar & wind AMS-I.D. 7 115.8 13-Nov-12 28 0.000 622.250 TÜV-Rhein 0.000 n.a. n.a. 13-Nov-12 12-Dec-12 31-Dec-12 5-Jul-13 31-Dec-12 PoA 30-Dec-99CPA 10 9 5 4 73.5

1520CPA0408.01 9502-0001 5 MW Solar PV power project in Punjab by EBSPL Asia & Pacific Southern Asia India Punjab Core CarbonX Solutions Registered Solar Solar Solar PV 5 MW Solar PV power projects AMS-I.D. 1 7.6 7 20 0.0 1-Jul-13 0.000 56.729 TÜV-Rhein n.a. n.a. 13-Nov-12 31-Dec-12 30-Dec-99 10 9 5 4 1 5.0 8078 0.953 No Other MSC 7.695 7.648 7.603 7.557 7.512 7.466 7.422 1521CPA0408.02 9502-0002 10 MW Solar Power Project in Kemwadi, Maharashtra: CPA S002 Asia & Pacific Southern Asia India Maharashtra Core CarbonX Solutions Registered Solar Solar Solar PV 10MW Solar PV AMS-I.D. 1 14.9 7 25 -0.2 1-Sep-14 0.000 94.548 TÜV-Rhein n.a. 13-Nov-12 18-Jul-14 30-Dec-99 10 9 5 4 1 10.0 15302 0.975 No Other MSC 15.374 15.220 15.068 14.917 14.768 14.620 14.474 1522CPA0408.03 9502-0003 9.13 MW Solar Power Project by KRBL Limited: CPA S003 Asia & Pacific Southern Asia India Madhya Pradesh Core CarbonX Solutions Registered Solar Solar Solar PV 9.13 MW Solar PV AMS-I.D. 1 14.6 7 25 0.0 1-Oct-14 0.000 91.107 TÜV-Rhein n.a. 13-Nov-12 15-Aug-14 30-Dec-99 10 9 5 4 1 9.1 14939 0.975 No Other MSC 14.566 14.566 14.566 14.566 14.566 14.566 14.566 1523CPA0408.04 9502-0004 Asia & Pacific Southern Asia India Andhra Pradesh Core CarbonX Solutions Registered Solar Solar Solar PV 10 MW Solar PV AMS-I.D. 1 16.7 7 25 -0.2 1-Oct-14 0.000 104.199 TÜV-Rhein n.a. 13-Nov-12 15-Aug-14 30-Dec-99 10 9 5 4 1 10.0 17294 0.963 No Other MSC 17.166 16.994 16.824 16.656 16.489 16.324 16.161

1524CPA0408.05 9502-0005 13.36 MW Solar Power Project in ART: CPA S005 Asia & Pacific Southern Asia India Core CarbonX Solutions Registered Solar Solar Solar PV 13.36 MW Solar PV AMS-I.D. 1 23.5 7 25 -0.0 1-Jun-15 131.605 TÜV-Rhein Core CarbonX Sols Pvt Ltd 13-Nov-12 8-May-15 30-Dec-99 10 9 5 4 1 13.4 24030 No Other MSC 23.648 23.648 23.601 23.554 23.507 23.460 23.413 1525CPA0408.06 9502-0006 10 MW Solar PV power project at NTPC-Unchahar Asia & Pacific Southern Asia India Uttar Pradesh Core CarbonX Solutions Registered Solar Solar Solar PV 10 MW Solar PV AMS-I.D. 1 13.9 7 25 30-Aug-16 60.300 TÜV-Rhein Core CarbonX Sols Pvt Ltd 13-Nov-12 30-Aug-16 30-Dec-99 10 9 5 4 1 10.0 14213 0.978 No Other MSC 14.318 14.175 14.033 13.893 13.754 13.616 13.480 1526CPA0408.07 9502-0007 6MW Solar PV power project in Rajasthan by JKLCL Asia & Pacific Southern Asia India Rajasthan Core CarbonX Solutions Registered Solar Solar Solar PV 6 MW Solar PV AMS-I.D. 1 11.3 7 25 0.0 15-May-17 40.943 TÜV-Rhein Core CarbonX Sols Pvt Ltd 13-Nov-12 15-May-17 30-Dec-99 10 9 5 4 1 6.0 1921 0.978 No Other MSC 11.613 11.497 11.382 11.268 11.156 11.044 10.934 1527CPA0408.08 9502-0008 10 MW Solar PV power project at NTPC Talcher - Kaniha: CPA S008 Asia & Pacific Southern Asia India Orissa Core CarbonX Solutions Registered Solar Solar Solar PV 10 MW Solar PV AMS-I.D. 13.4 7 25 0.0 20-Oct-17 42.819 Core CarbonX Sols Pvt Ltd 13-Nov-12 20-Oct-17 30-Dec-99 10 9 5 4 1 10.0 14000 0.978 No Other MSC 13.789 13.651 13.514 13.379 13.245 13.113 12.982 1528PoA0409 L67UP105U9ZS9X7AF1XF83CI2CS1WV 9908 Programmatic CDM for Promotion of Solar Power Generation in India Asia & Pacific Southern Asia India India AGEPL Registered Solar Solar Solar PV AMS-I.D. 1 7.9 30-Oct-12 28 0.000 63.305 BV Cert 0.000 n.a. n.a. 14-Nov-12 20-Dec-13 10-Mar-14 10-Mar-14 PoA 30-Dec-99CPA 5 9 1 11 5.0 MSC1529CPA0409.01 9908-0001 “Solar PV power project in Odisha, India” CPA-001 Asia & Pacific Southern Asia India Odisha AGEPL Registered Solar Solar Solar PV AMS-I.D. 1 7.9 7 25 -0.0 30-Dec-12 0.000 63.305 BV Cert n.a. n.a. 14-Nov-12 10-Mar-14 30-Dec-99 5 9 1 11 0 5.0 8322 0.950 No Other MSC 7.905 7.866 7.827 7.787 7.748 7.710 7.671 1530PoA0410 AK8V09UUL2AR65XVSZURXPUJP6JKQU 9442 Renewable Energy based PoA in Pakistan Asia & Pacific Southern Asia Pakistan Pakistan Horae Energy Registered Hybrid renewables Hybrid renewables Solar & wind & hydro ACM2 1 54.6 15-Nov-12 28 0.000 546.400 TÜV-Rhein 0.000 n.a. n.a. 15-Nov-12 22-Nov-12 30-Dec-12 18-Jul-13 31-Dec-12 CPA 31-Dec-99PoA 1 3 5 9 50.0

1531CPA0410.01 9442-0001 50 MW Wind Project by HAE: CPA 001 Asia & Pacific Southern Asia Pakistan Sindh Horae Energy Registered Wind Wind Wind ACM2 1 54.6 10 20 0.0 1-Jan-15 0.000 546.400 TÜV-Rhein n.a. n.a. 15-Nov-12 31-Dec-12 30-Dec-99 1 3 5 9 0 50.0 136831 0.399 No 3 54.640 54.640 54.640 54.640 54.640 54.640 54.640 54.640 54.640 54.640

1532PoA0411 JT7K2P71M47X1DMZI510DI9KYF1V46 Biomass based power plants for electricity generation in India Asia & Pacific Southern Asia India India At Validation Biomass energy Biomass energy Agricultural residues: other kinds AMS-I.D. 1 67.7 1-Dec-12 28 0.000 676.750 ERM CVS 0.000 n.a. n.a. 20-Nov-12 PoA 30-Dec-99CPA 5 9 8 10 1 11 12.0

1533CPA0411.01 CPA#1: Biomass based power project in Rupnagar, Punjab Asia & Pacific Southern Asia India Punjab At Validation Biomass energy Biomass energy Agricultural residues: other kinds 12 MW power plant AMS-I.D. 1 67.7 10 20 0.0 1-Jun-14 0.000 676.750 ERM CVS n.a. n.a. 20-Nov-12 30-Dec-99 5 9 8 10 1 11 0 12.0 74845 0.922 No Investment 3 56.037 68.969 68.969 68.969 68.969 68.969 68.969 68.969 68.969 68.969 1534PoA0412 MR2HINDSEIKY06BPY0GMHKMQFGEJ4R Methane avoidance in rice cultivation Asia & Pacific Southern Asia India India Core CarbonX Solutions Validation Terminated Agriculture Agriculture Rice crops AMS-III.AU. 1 15.0 22-Nov-12 28 0.000 120.009 TÜV-Rhein 0.000 n.a. n.a. 22-Nov-12 PoA 30-Dec-99PoA 3 9 0.0

1535CPA0412.01 Methane avoidance in rice cultivation in SJB: 001 Asia & Pacific Southern Asia India Odisha Core CarbonX Solutions Validation Terminated Agriculture Agriculture Rice crops AMS-III.AU. 1 15.0 7 0.0 1-Jan-13 0.000 120.009 TÜV-Rhein n.a. n.a. 22-Nov-12 30-Dec-99 3 9 0 No Other 14.996 14.996 14.996 14.996 14.996 14.996 14.996

1536PoA0413 G42SF4TRMPOZ5VEKHCORIUR2XCS13P RE PoA in Pakistan Asia & Pacific Southern Asia Pakistan Pakistan Horae Energy At Validation Hybrid renewables Hybrid renewables Solar & wind & other AMS-I.D. 1 6.7 22-Nov-12 28 0.000 53.346 TÜV-Rhein 0.000 n.a. n.a. 22-Nov-12 CPA 31-Dec-99PoA 3 5 9 10.0

1537CPA0413.01 10 MW solar power project by TechAccess Asia & Pacific Southern Asia Pakistan Punjab Horae Energy At Validation Solar Solar Solar PV AMS-I.D. 1 6.7 7 20 -0.5 1-Jan-13 0.000 53.346 TÜV-Rhein n.a. n.a. 22-Nov-12 30-Dec-99 3 5 9 1 Schott Germany 10.0 15336 0.435 No Other 6.890 6.840 6.790 6.741 6.691 6.641 6.591 6.542 6.492 6.442

1538PoA0414 4U5RCMD9MOY0294455DZBMXON2OLSR Asia & Pacific Southeast Asia South Korea Republic of Korea At Validation Solar Solar Solar PV AMS-I.C.+AMS-I.F. 1 1.3 1-Sep-11 28 0.332 12.319 KSA 0.000 n.a. n.a. 22-Nov-12 CPA 31-Dec-99CPA 9 5 8 1 1.5

1539CPA0414.01 PV power plants project on collective housing of 2011– <2011-LH- 001-01457> Asia & Pacific Southeast Asia South Korea Republic of Korea At Validation Solar Solar Solar PV AMS-I.C.+AMS-I.F. 1 1.3 7 20 0.0 19-Sep-11 0.332 12.319 KSA n.a. n.a. 22-Nov-12 30-Dec-99 9 5 8 1 0 1.5 No Other 1.326 1.326 1.326 1.326 1.326 1.326 1.326

Angola, Burkina Faso, Burundi, Benin, Botswana, Democratic Republ ic of the Congo, Central African Republic, Congo, Côte d`Ivoire , Cameroon, Djibouti , Ethiopia, Gabon, Ghana, Gambia, Guinea, Equatorial Guinea, Guinea-Bissau, Kenya, L iberia, Lesotho, Madagascar, Mali, Mauri tius, Malawi , Mozambique, Namibia, Niger, Nigeria , Rwanda, Seychelles, Sudan, Sierra Leone, Senegal, Swazi land, Chad, Togo, Tanzania,

Introducing wide-scale adoption of efficient charcoal cooking to ki tchens in Sub-Saharan Africa through the design or adoption of a design, manufacture, distribution, sa le and after-sale support o f efficient charcoal stoves

Pulamusa1 stoves developed by ProBEC in Zambia

CookClean Ghana Limi ted

Investment;Prevailing practice;Technological

Promote the use of e fficient or improved charcoal stoves

CookClean Ghana Limi ted

Promote and distribute use of Improved Efficient Charcoal Stoves (ECS)

CookClean Ghana Limi ted

Integrating in terrela ted technologies that focus in reducing the impacts of the land use, forestry, agricu lture andenergy consumption sectors

AMS-III.D.+AMS-III.R.+AMS-I.E.+AMS-I.I.

Mexico City, Mexico State, Puebla,Tlaxcala and Hidalgo

Small -scale biodigesters coupled with an end-use thermal appl ication

AMS-III.D.+AMS-III.R.+AMS-I.E.+AMS-I.I.

Investment;Prevailing practice;Technological

Encouraging the use of natura l gas in place of fuel oi ls and M/SMEs development and capacity bui lding, and Encouraging susta inabil ity practices in M/SMEs operation, and Mobil ization of investments in the environmenta l sector

LFO to NG: Bakery oven, fuel o il storage tanks, fue l oil supply l ines and fuel o il burners

Palm Oil Mi ll Effluent Methane Recovery & Util isation System in Malaysia. [POA-QL-01-MSIA]

To reduce the amount of greenhouse gas (GHG)

AMS-III.H.+AMS-I.C.+AMS-I.F.+AMS-I.D.

Eng Hong P alm Oil Mill Effluent Methane Recovery and Utilisation System in Malaysia

Use of enclosed anaerobic digester tanks based on UASB type digesters with floating gas holders wi th no external water seal

AMS-III.H.+AMS-I.C.+AMS-I.F.+AMS-I.D.

Investment;Prevailing practice;Technological

Investment comparison analysis

To reduce greenhouse gas emissions through the rol l out of energy efficient water heating technologies in South Africa which displace the consumption of fossi l fuels or e lectrici ty

eThekwini Municipa lity

Solar water heatingsystems and heat pumps

Investment;Prevailing practice

Marukyu S hanghai Environment Co.

To reduce electricity consumption and GHG emissions by instal ling appropriate Variable-frequency Drives on pumps, fans and other motor equipments in p lants

CPA-0001: Fan System Transformation Util izing High Voltage Frequency Converters in Shanghai Coking & Chemical Corporation

Marukyu S hanghai Environment Co.

Dongfang Hitachi

Benchmark analysis

To heat retention cooking in kitchens throughout South Africa

Installation of the heat retention cooker (HRC) in up to 70 000 kitchens

Natura l Balance

Energy Optimization Solutions for Industries in Pakistan, UAE and Egypt – Program of Activi ties

Uni ted Arab Emirates, Egypt, Pakistan

To improve energy efficiency and reduce carbon foot prin t of manufacturingindustries in Pakistan, UAE and Egypt by implementing energy optimization solutions

Optimized steam and water usage solutions through use of iWater and iBoiler so lutions

Investment;Prevailing practice;Technological

CDM Awareness & Promotion Uni t

To encourage small sca le renewable energy power generation.

AMS-I.F.+AMS-I.D.+AMS-I.A.

CDM Awareness & Promotion Uni t

AMS-I.F.+AMS-I.D.+AMS-I.A.

Investment;Technological

To develop a p latform for overcoming insti tu tional, financial and structural hurdles for the construction of smal l hydropower pro jects

Small -scale run-of-river hydropower plant

Benchmark analysis

Replacement of tradi tional charcoal stoves wi th efficient EcoRecho stoves in Haiti

Replacement of inefficient tradi tional charcoal stoves in the Republic of Hai ti (Haiti ) w ith efficient EcoRecho stoves

Investment;Prevailing practice

PT. Austindo Aufwind New Energy

To develop CPAs involving implementation of covered lagoons or b iogesters and capture and combust methane

AMS-III.H.+AMS-III.AO.+AMS-I.D.

PT. Austindo Aufwind New Energy

Contro lled anaerobic treatment o f POME in a biogas plant for recovery ofmethane and power generator sets of 1.8 MW

AMS-III.H.+AMS-III.AO.+AMS-I.D.

Benchmark analysis

The promotion and support the implementation, rep lacement or retrofit ofpower-and-heat plants, uti lizing biomass residues as primary fuel

Two new high-pressure boilers at110 bar and two turbo-a lternators for the generation of 91 MW of e lectrici ty

Carbonergy Business Consultancy Services

To facili ta te the implementation of renewable energy projects

Carbonergy Business Consultancy Services

Financial ;P revai ling practice

Benchmark analysis

To increase the supply of renewable energy to the Moroccan national grid from renewable wind energy

131 WTGs with a capacity o f 2.3 MW each.

Siemens Wind Power

Benchmark analysis

Fideicomisos Insti tu idos en Relación con la Agricu ltura FIRA

To promote susta inable developmentof livestock management system by implementing new animal waste management systems technologies(AWMS) for the reduction of GHG emiss ions.

AMS-III.D.+AMS-III.F.+AMS-I.D.+AMS-I.F.

Fideicomisos Insti tu idos en Relación con la Agricu ltura FIRA

Closed anaerobic d igester with biogas capture and e lectrici ty generation

AMS-III.D.+AMS-III.F.+AMS-I.D.+AMS-I.F.

Benchmark analysis

ENERCAP SunLighting™ Africa – Programme to rep lace kerosene lamps wi th micro PV LED systems in the Sub-Sahara region

Burkina Faso, Benin, Democratic Republ ic of the Congo, Côte d`Ivoire , Cameroon, Eth iop ia, Gabon, Ghana, Guinea, Kenya, Mauritania, Niger, Nigeria, Senegal , Chad, Togo

Angola, Burkina Faso, Benin, Democratic Republ ic of the Congo, Côte d`Ivoire , Cameroon, Eth iop ia, Gabon, Ghana, Guinea, Kenya, Mauri tania, Niger, Nigeria , Senegal, Chad, Togo

To replace kerosene-based lighting with special ly designed PV LED systems to households without access to e lectrici ty

ENERCAP SunLighting™ Africa – Programme to rep lace kerosene lamps wi th micro PV LED systems in the Sub-Sahara region - Chad

The photovol ta ic (PV) l ight emi tting diode (LED) system

Investment;Prevailing practice

Carbon Gold Beij ing Technology Co., L td .

To distribute around 50 mi llion CFLs, rep lacing low efficient ICLs

Tongren City and Anshun City

Carbon Gold Beij ing Technology Co., L td .

Estimated co llection and destruc tion of 1,000,000 incandescent lamps (ICLs) with the replacement of the same number of CFLs.

Carbon Gold Beij ing Technology Co., L td .

To distribute around 50 mi llion CFLs, rep lacing low efficient ICLs

Carbon Gold Beij ing Technology Co., L td .

Estimated co llection and destruc tion of 1,000,000 incandescent lamps (ICLs) with the replacement of the same number of CFLs.

Carbon Gold Beij ing Technology Co., L td .

Estimated co llection and destruction of 1,000,000 incandescent lamps (ICLs) with the rep lacement of the same number of CFLs.

Xiangxi Autonomous Prefecture and Chenzhou City

Carbon Gold Beij ing Technology Co., L td .

Estimated co llection and destruc tion of 1,000,000 incandescent lamps (ICLs) with the replacement of the same number of CFLs.

Carbon Gold Beij ing Technology Co., L td .

To replace approximately 65 mi llion household incandescent lamps (ICLs) with equal number of energy efficient, se lf-ba llasted, compact fluorescent lamps (CFLs)

Carbon Gold Beij ing Technology Co., L td .

Estimated co llection and destruc tion of 1,000,000 incandescent lamps (ICLs) with the replacement of the same number of CFLs

Carbon Gold Beij ing Technology Co., L td .

To replace approximately 65 mi llion household incandescent lamps (ICLs) with equal number of energy efficient, se lf-ba llasted, compact fluorescent lamps (CFLs)

“CFLs Distribution Programme in the Guangxi Zhuang A utonomous Region” CPA 1

Carbon Gold Beij ing Technology Co., L td .

Estimated co llection and destruc tion of 1,000,000 incandescent lamps (ICLs) with the replacement of the same number of CFLs

Carbon Gold Beij ing Technology Co., L td .

To replace approximately 60 mi llion household incandescent lamps (ICLs) with equal number of energy efficient, se lf-ba llasted, compact fluorescent lamps (CFLs)

Carbon Gold Beij ing Technology Co., L td .

Estimated co llection and destruc tion of 1,000,000 incandescent lamps (ICLs) with the replacement of the same number of CFLs

Carbon Gold Beij ing Technology Co., L td .

To replace approximately 150 mill ion household incandescent lamps (ICLs) with equal number of energy efficient, se lf-ba llasted, compact fluorescent lamps (CFLs)

Carbon Gold Beij ing Technology Co., L td .

Estimated co llection and destruc tion of 1,000,000 incandescent lamps (ICLs) with the replacement of the same number of CFLs

Carbon Gold Beij ing Technology Co., L td .

To replace approximately 35 mi llion household incandescent lamps (ICLs) with equal number of energy efficient, se lf-ba llasted, compact fluorescent lamps (CFLs)

Carbon Gold Beij ing Technology Co., L td .

Estimated co llection and destruc tion of 1,000,000 incandescent lamps (ICLs) with the replacement of the same number of CFLs

Carbon Gold Beij ing Technology Co., L td .

To replace approximately 55 mi llion household incandescent lamps (ICLs) with equal number of energy efficient, se lf-ba llasted, compact fluorescent lamps (CFLs)

Carbon Gold Beij ing Technology Co., L td .

Estimated co llection and destruc tion of 1,000,000 incandescent lamps (ICLs) with the replacement of the same number of CFLs

Carbon Gold Beij ing Technology Co., L td .

To replace approximately 50 mi llion household incandescent lamps (ICLs) with equal number of energy efficient, se lf-ba llasted, compact fluorescent lamps (CFLs)

Carbon Gold Beij ing Technology Co., L td .

Estimated co llection and destruc tion of 1,000,000 incandescent lamps (ICLs) with the replacement of the same number of CFLs

The programme to in troduce renewable energy system in to Seoul – CPA (2011, Seoul)The pro ject to introduce photovol ta ic systems in 64 publ ic bui ldings of Seoul (CPA-ID: 2013-SMG-001-2042 kW)1

DACC Power Generation Company

To supply renewable energy to the Pakistani National Electric Grid

DACC Power Generation Company

Programme of activities for the recovery and use of associated petroleum gas, normally combusted in flare stacks in o il-producing fields

The Andean Center for Economics in the Environment (CAEMA)

The recovery and use of the gas being combusted in flares in oi l fields

The Andean Center for Economics in the Environment (CAEMA)

Gas collection, pre-treatment, cleaning and compression for its further distribution

Investment;Technological

Benchmark analysis

Rwanda, Tanzania, Uganda, Burkina Faso

Rwanda, Burundi, Tanzania, Uganda, Burkina Faso

DelAgua Health and Development Programs

DelAgua Rwanda Publ ic Health Program: Rubavu District, Western Province, Republic of Rwanda.

DelAgua Health and Development Programs

EcoZoom high-efficiency, family-sized cook stoves and li fe straw

Vestergaard Frandsen

DelAgua Rwanda Publ ic Health Program: CPA002, Ubedehe 1& 2 in K arongi District in the Western Province of the Republic o f Rwanda

DelAgua Health and Development Programs

EcoZoom high-efficiency, family-sized cook stoves and li fe straw

Vestergaard Frandsen

DelAgua Rwanda Publ ic Health Program: CPA003, Ubedehe 1& 2 in Ngororero District in the Western Province of the Republic o f Rwanda

DelAgua Health and Development Programs

EcoZoom high-efficiency, family-sized cook stoves and li fe straw

Vestergaard Frandsen

DelAgua Rwanda Publ ic Health Program: CPA004, Ubedehe 1& 2 in Nyabihu District in the Western Province of the Republic o f Rwanda

DelAgua Health and Development Programs

EcoZoom high-efficiency, family-sized cook stoves and li fe straw

Vestergaard Frandsen

DelAgua Rwanda Publ ic Health Program: CPA005, Ubedehe 1& 2 in Nyamasheke District in the Western Province of the Republic o f Rwanda

DelAgua Health and Development Programs

EcoZoom high-efficiency, family-sized cook stoves and li fe straw

Vestergaard Frandsen

DelAgua Rwanda Publ ic Health Program: CPA006, Ubedehe 1& 2 in Rutsiro District in the Western Province of the Republic o f Rwanda

DelAgua Health and Development Programs

EcoZoom high-efficiency, family-sized cook stoves and li fe straw

Vestergaard Frandsen

DelAgua Rwanda Publ ic Health Program: CPA007, Ubedehe 1& 2 in Rusizi District in the Western Province of the Republic o f Rwanda

DelAgua Health and Development Programs

EcoZoom high-efficiency, family-sized cook stoves and li fe straw

Vestergaard Frandsen

DelAgua Rwanda Publ ic Health Program: CPA008- BUGESERA District in the Eastern Province of the Republic o f Rwanda

DelAgua Health and Development Programs

EcoZoom high-efficiency, family-sized cook stoves and li fe straw

DelAgua Rwanda Publ ic Health Program: CPA009- BURERA District in the Northern Province of the Republic of Rwanda

DelAgua Health and Development Programs

EcoZoom high-efficiency, family-sized cook stoves and li fe straw

DelAgua Rwanda Publ ic Health Program: CPA010- GATSIBO District in the Eastern Province of the Republic o f Rwanda

DelAgua Health and Development Programs

EcoZoom high-efficiency, family-sized cook stoves and li fe straw

DelAgua Rwanda Publ ic Health Program: CPA011- RULINDO District in the Northern Province of the Republic of Rwanda

DelAgua Health and Development Programs

EcoZoom high-efficiency, family-sized cook stoves and li fe straw

DelAgua Rwanda Publ ic Health Program: CPA012- KAYONZA District in the Eastern Province of the Republic o f Rwanda

DelAgua Health and Development Programs

EcoZoom high-efficiency, family-sized cook stoves and li fe straw

DelAgua Rwanda Publ ic Health Program: CPA013- KIREHE District in the Eastern Province of the Republic o f Rwanda

DelAgua Health and Development Programs

EcoZoom high-efficiency, family-sized cook stoves and li fe straw

DelAgua Rwanda Publ ic Health Program: CPA014- NGOMA District in the Eastern Province of the Republic o f Rwanda

DelAgua Health and Development Programs

EcoZoom high-efficiency, family-sized cook stoves and li fe straw

DelAgua Rwanda Publ ic Health Program: CPA015- NY AGATARE District in the Eastern Province of the Republic o f Rwanda

DelAgua Health and Development Programs

EcoZoom high-efficiency, family-sized cook stoves and li fe straw

DelAgua Rwanda Publ ic Health Program: CPA016- RWAMAGANA District in the Eastern Province of the Republic o f Rwanda

DelAgua Health and Development Programs

EcoZoom high-efficiency, family-sized cook stoves and li fe straw

Trinidad and Tobago

Petroleum Company of Trinidad and Tobago Limi ted (PETROTRIN)

To avoid greenhouse-gas emissions resulting from venting and flaringof associated gases from producing oil fields

Victoria nd St. Patrick

Petroleum Company of Trinidad and Tobago Limi ted (PETROTRIN)

Gas compression faci lity and gas gathering infrastructureinsta lled in the company.

Benchmark analysis

Energy Changes Projektentwicklung GmbH

To use carbon finance for smal l hydropower pro jects in Armenia

Smal l Hydropower Programme of Activities in Armenia – Sedvi 1 + 2 Hydropower Project”

Energy Changes Projektentwicklung GmbH

Run of river hydropower plant o f 1 .183 MW

insta ll a SWH in residential as well as commercial buildings throughout Ind ia.

SWH systems wi th a to ta l surface area of 52,685 m2

Investment;Other;Prevail ing practice

SWH systems wi th a to ta l surface area of 63,901 m2

Investment;Other;Prevail ing practice

SWH systems wi th a to ta l surface area of 63,897 m2

Investment;Other;Prevail ing practice

SWH systems wi th a to ta l surface area of 64,000 m2 (projected)

Investment;Other;Prevail ing practice

To supply, install , and finance solar water heaters to provide hotwater services for low income households in South Africa and to reduce GHG emiss ions

Standard Bank Low Pressure Solar Water Heater Programme for South Africa – CPA-001Standard Bank Low Pressure Solar Water Heater Programme for South Africa - CPA-002Standard Bank Low Pressure Solar Water Hearter Programme for South Africa - CPA-003Standard Bank Low Pressure Solar Water Heater Programme for South Africa – CPA-004Standard Bank Low Pressure Solar Water Heater Programme for South Africa – CPA-005PoA for Water Pumping Efficiency Improvement and Rehabili ta tion for Egyptian Pumping Stations

CDM Awareness and Promotion Unit

To enhance energy efficiency in the public pumping and i rrigation sector throughout Egypt via rehabili ta tion and maintenance of old stations.

CDM Awareness and Promotion Unit

Investment comparison analysis

To abate greenhouse gas emissions through the avoided use of electricity and corresponding fossil fuel combustion

EnergeticPOA (CPA 001): Implementation of efficient l ighting LED PoA scheme in India

Investment;Prevailing practice

A widespread dissemination and use of low-carbon water purification technologies.

Ultra Filtration Systems, Si lver-treated Ceramic Fi lters, S olar Powered UV Treatment

Promote installation of CFL and removal of ICL bulbs in domestic sector, Reduce power demand and peak load on power grid and Abate greenhouse gas emissions

Expand the use of renewable energy technologies, reduce ghg emissions, Reduce the d isposal of organic waste to landfil l, Optimise the recovery of materials from organic waste for beneficial use

Treatment of municipa l sewage sludge by way of anaerobic digestion (AD)

BRAC ImpactInvestment Limited (BIVL)

To distribute over 1 mil lion low emission water purification units

Energy Efficiency Program in Rural Bangladesh CPA001 Matlab Uttar, Chandpur

BRAC ImpactInvestment Limited (BIVL)

Distribution of 21,000 L ifeStraw® Family un its

Vestergaard Frandsen Group

Simple cost analysis

Ghana, Mal i, Senegal , Togo

Burkina Faso, Mali , Senegal, Togo and Ghana

To reduce greenhouse gases emissions by disseminating fue lefficientcharcoal and wood stoves throughout West Africa

Promoting Efficient Stove Dissemination and Use in West Africa – CPA 001 Togo

“Toyola Asuto” charcoal stoves for households

Toyola Energy

Benchmark analysis

Promoting Efficient Stove Dissemination and Use in West Africa – CPA 002 Togo

“Toyola Asuto” charcoal stoves for households

Toyola Energy

Promoting Efficient Stove Dissemination and Use in West Africa – CPA 003 Togo

“Toyola Asuto” charcoal stoves for households

Toyola Energy

Tunisian National Agency for Energy Conservation

Bui lding a framework for overcoming the current barriers h indering the development of cogeneration pro jects in Tunisia

Tunisian National Agency for Energy Conservation

Natura l gas cogeneration system with an installed capacity of 1 .98MW and an overal l efficiency of 86.8 %

Program of Activi ties for Electrici ty Generation using Associated Gas Normally Flared in Petro leum P roduction Fields

Andean Center for Economics in the Environment (CAEMA)

To use of associated gas normally burned in flares in off-grid area oi lfields or reg ions

Andean Center for Economics in the Environment (CAEMA)

Gas transport system and combustion through 14 power generators of 750kW

Benchmark analysis

To use the CDM incentives to promote the investment on Smal lHydro Plants (SHPs)

A new run-of-river hydro power plant of 23 MW

Benchmark analysis

To distribute and install fue l efficient cook stoves at a subsidised price to ruralhouseholds cooking with firewood.

Australia (World Vision Austral ia), Sweden (Government of Sweden)

30,000 energy efficient cooking stovesto households

Australia (World Vision Austral ia), Sweden (Government of Sweden)

30,000 energy efficient cooking stovesto households

Australia (World Vision Austral ia), Sweden (Government of Sweden)

Australia (World Vision Austral ia), Sweden (Government of Sweden)

Environmental Intermediaries& Trading Group Limited

To provide households with a range of in itiatives that ei therdisplace existing electricity use with so lar sources and/or introduce energy efficient technology

AMS-I.J.+AMS-II.C.+AMS-I.D.

Environmental Intermediaries& Trading Group Limited

Four Calpak model 150/300 solar water hearing units

AMS-I.J.+AMS-II.C.+AMS-I.D.

Burundi, Bolivia, Botswana, Belize, Colombia, Costa Rica, Algeria , Ecuador, Egypt, Eth iop ia, Micronesia (Federated States of), Ghana, Guatemala, Honduras, Indonesia, Ind ia, Jamaica, Kenya, Sri Lanka, Lesotho, Morocco, Madagascar+Malawi, Mexico, Namibia

To utilize the financial mechanism such as carbon finance so that the efficient cook stoves are accessib le to the communities

Oceanium Mangrove Restoration campaign 2010; ID: Mangrove Restoration Program in Senegal-CPA/001

Sine Saloum and Casamance deltas

Establ ishment o f 4,267 ha of mangrove p lantations in 2010 on currently degraded wetlands in the Sine Saloum and Casamance deltas

Investment;Other;Prevail ing practice;Technological

Angola, Burkina Faso, Benin, Côte d`Ivoire , Cameroon, Cape Verde, Algeria, Egypt, Gabon, Guinea, Guinea-Bissau, Liberia , Libya, Morocco, Madagascar, Mal i, Mauri tania, Malawi , Mozambique, Namibia, Niger, NigeriaSierra Leone, Senegal , Tunisia

Chad, Angola, Burkina Faso, Benin, Côte d`Ivoire , Cameroon, Cape Verde, Algeria , Egypt, Gabon, Guinea, Guinea-Bissau, Liberia, Libya, Morocco, Madagascar, Mali, Mauri tania, Malawi, Mozambique, Namibia, Niger, Nigeria

To replace ICLs wi th se lf ballasted CFLs for usage among households

1,000,000 se lf-bal lasted Compact Fluorescent Lamps (CFL)

Investment;Other;Prevail ing practice

SoWiTec Wind PoA in the Caribbean, Central and South America (“SoWiTec-PoA”)

To facili ta te the uti lization of renewable energy by supporting the implementation of wind energy projects in the Caribbean, Central and South America

Benchmark analysis

UGL Services Premas Operations

To sign ificantly contribute towards energy efficiency measures by reducing theconsumption of e lectrici ty in building lighting systems

Replacement of existing luminaires wi th LED lighting luminaires in several bu ild ings across 6 TownCounci ls in Singapore

UGL Services Premas Operations

Rural Household Biogas Development Programme in Guangxi Zhuang Autonomous Region and Hebei Provinces

Beij ing Rura l Well-o ff Economy & Technology Development Center

To enable l ivestock peasants in Guangxi Zhuang Autonomous Region and Hebei Province to instal l animal manure treatment systems with recovery and util ization of b iogas

CPA-0001 Rural Household Biogas Digester Development Programme –Zhongshan County 2012

Zhuang Autonomous Region and Hebei provinces

Beij ing Rura l Well-o ff Economy & Technology Development Center

Mahindra & Mahindra Ltd, Farm Equipment Sector

To reduce the GHG emissions due to the excess use of e lectrici ty in i rrigationsystems by introducing Micro irrigation system (MIS) such as Drip and Sprinkler irrigation system

Mahindra & Mahindra Ltd, Farm Equipment Sector

EPC Industrie Ltd

To introduce LNG buses to existing and planned new bus routes in Guangdong Province and to reduce CO2 emissions by rep lacing liquid fuels

To abate GHG emissions; reduce non-renewable woody b iomass consumption and indoor ai r pollution

Improved Cook Stoves: Ezy Stove modelImproved Cook Stoves: Ezy Stove model

To distribute ICS to reduce carbon emiss ions, reduce health problems re la ted to smoke, reduce deforestation and erosion due to extensive firewood sourcing and to increase spending power of rural households

Improved Cook Stoves - SAVE80 cookstove

Investment;Prevailing practice;Technological

Improved Cook Stoves - SAVE80 cookstove

To reduce GHG emissions from transport sector by promoting implementationof MRTS.

CPA 3: Inclusion of Mumbai Metro Rail Corporation Limited Colaba-Bandra-Seepz corridor under MRTS POA

To facili ta te the installation of renewable technologies

10 MW Solar Power Project by Ushodaya Enterprises Private Limited in Mahabubnagar, Andhra Pradesh

Andhra Pradesh, Telangana, Rajasthan and Tamil Nadu

To develop a p latform for overcoming insti tu tional, financial and structural hurdles for the construction of smal l-scale grid connected solar power pro jects in

5 MW grid connected so lar photovol ta ic (PV) power p lantTo facili ta te the installation of Wind

Turbine Generators, Solar power and hydro power to generate electricity from renewable wind energy source

50 MW wind farm: 34 WTGs each of capacity 1.5 MW

Benchmark analysis

IL&FS Environmental In frastructure andServices

To disp lace fossi l fuel util ization for electricity generation by the Promotion ofBiomass based power plants for Electricity Generation in India

IL&FS Environmental In frastructure and

Benchmark analysisTo reduce CH4 emissions through

adjusted water management system in rice cul tivation

Adjusted water management system in rice cul tivation

To facili ta te the installation of so lar, offshore wind, hydro, b iomass and wind energy power pro jects

10 MW solar PV plant with po lycrysta lline si licon (C-Si) PV glass-fo il modules

Programme of Activities to in troduce renewable energy system into col lective housing, Republ ic of Korea

Korea Land & Housing Corporation

To reduce electricity based on coal or other carbon-intensive fossil fue ls andthus to reduce the associated CO2 emiss ions in Republ ic of Korea

Korea Land & Housing Corporation

15 so lar PV systems on roofs of collective housing (total 1.457 kw)

1540PoA0415 F45IN41ZU21ABLAPDL3N3TTI24L6XT 8147 Animal Manure Treatment Programme in Hubei Province Asia & Pacific East Asia China Hubei Registered Methane avoidance Methane avoidance Manure AMS-III.D. 1 3.7 2-Sep-11 28 0.000 29.384 TÜV-Nord 0.000 United K. (A&T Carbon Asset Co.), Sweden (Vattenfall) n.a. 23-Nov-12 1-Apr-12 25-Dec-12 25-Dec-12 CPA 31-Dec-99PoA 5 9 1 6 0.0 MSC

1541CPA0415.01 8147-0001 Animal Manure Treatment Programme in Hubei Province—CPA-0001 Asia & Pacific East Asia China Hubei Registered Methane avoidance Methane avoidance Manure AMS-III.D. 1 3.7 7 15 0.0 25-Dec-12 0.000 29.384 TÜV-Nord United K. (A&T Carbon Asset Co.), Sweden (Vattenfall) n.a. 23-Nov-12 25-Dec-12 30-Dec-99 5 9 1 6 -1 0.734 No Investment MSC 3 3.663 3.663 3.663 3.663 3.663 3.663 3.663 1542PoA0416 QHN65HCPUZK6D2P6VHJMSNDE7FGQXY Animal Manure Treatment Programme in Gansu Province Asia & Pacific East Asia China Gansu At Validation Methane avoidance Methane avoidance Manure AMS-I.F.+AMS-III.D. 1 3.0 1-Feb-13 28 0.000 23.936 TÜV-Nord 0.000 n.a. n.a. 23-Nov-12 CPA 31-Dec-99PoA 1 6 3 8 5 10 0.1

1543CPA0416.01 Animal Manure Treatment Programme in Gansu Province--CPA-0001 Asia & Pacific East Asia China Gansu At Validation Methane avoidance Methane avoidance Manure AMS-I.F.+AMS-III.D. 1 3.0 7 15 0.0 1-Feb-13 0.000 23.936 TÜV-Nord n.a. n.a. 23-Nov-12 30-Dec-99 1 6 3 8 5 10 -1 0.1 613 0.766 No Investment 3 2.771 3.023 3.023 3.023 3.023 3.023 3.023 0.252

1544PoA0417 05BQ1QTQAWFAXGB047CE9TIQVA3707 9940 Asia & Pacific Southern Asia Bangladesh Bangladesh Registered EE industry EE industry Textiles AMS-II.D. 1 0.9 1-Dec-12 28 0.000 9.080 JQA 0.000 Japan (PEAR Carbon Offset Initiative) n.a. 1-Dec-12 16-Mar-14 1-May-14 17-Jun-14 1-May-14 PoA 30-Dec-99PoA 3 4 2 0.0 SUZ

1545CPA0417.01 9940-0001 Asia & Pacific Southern Asia Bangladesh Savar, Dhaka Registered EE industry EE industry Textiles AMS-II.D. 1 0.9 10 15 0.0 1-Jun-14 0.000 9.080 JQA Japan (PEAR Carbon Offset Initiative) n.a. 1-Dec-12 1-May-14 30-Dec-99 3 4 2 0 15.0 No Other SUZ 0.641 0.741 0.839 0.988 0.988 0.988 0.988 0.988 0.988 0.988

1546PoA0418 9XGHHQBYF4A2CY9KC20P24P2HNN69B Demand-side energy efficiency measures for cooling systems Asia & Pacific Southeast Asia Singapore Singapore At Validation EE service EE service HVAC & lighting AMS-II.C. 1 1.9 22-Jun-10 28 0.000 18.920 BV Cert 0.000 n.a. n.a. 10-Jan-13 PoA0048 PoA 30-Dec-99CPA 4 9 12 5 8 0.0

1547CPA0418.01 Asia & Pacific Southeast Asia Singapore Singapore At Validation EE service EE service HVAC & lighting AMS-II.C. 1 1.9 10 30 0.0 1-Jan-13 0.000 18.920 BV Cert n.a. n.a. 10-Jan-13 CPA0048.01 30-Dec-99 4 9 12 5 8 0 0.486 3.8 No 1.892 1.892 1.892 1.892 1.892 1.892 1.892 1.892 1.892 1.892

1548PoA0419 DGGHMM4HPL89OS4NTYLLKX232CM9HF Africa North Africa Tunisia Tunisia Validation Terminated Solar Solar Solar water heating AMS-I.C. 1 0.0 1-Dec-12 28 0.000 0.070 BV Cert 0.000 n.a. n.a. 17-Jan-13 PoA 30-Dec-99PoA 9 1 5 0.0

1549CPA0419.01 Africa North Africa Tunisia Tunis Validation Terminated Solar Solar Solar water heating Installation of solar water heaters AMS-I.C. 1 0.0 10 20 0.0 1-May-13 0.000 0.070 BV Cert n.a. n.a. 17-Jan-13 30-Dec-99 9 1 5 0 Yes 0.005 0.007 0.007 0.007 0.007 0.007 0.007 0.007 0.007 0.007 0.002

1550PoA0420 TQCK20FWS1Y6SDTQSIPL9VIGKZZ52X 9706 Efficient Cook Stove Programme: Malawi Africa East Africa Malawi Malawi Alchemy Carbon Registered EE households EE households Stoves AMS-II.G. 1 52.9 1-Feb-13 28 0.000 401.286 DNV 0.000 n.a. n.a. 1-Feb-13 28-Jun-13 1-Aug-13 24-Oct-13 1-Aug-13 PoA 31-Dec-99PoA 4 3 8 6 5 7 -3 0.0 Yes

1551CPA0420.01 9706-0001 CPA 1: Balaka Improved Cook Stove Project Africa East Africa Malawi Balaka Alchemy Carbon Registered EE households EE households Stoves Improved Cook Stoves AMS-II.G. 1 52.9 7 7 0.0 1-Jun-13 0.000 401.286 DNV n.a. n.a. 1-Feb-13 1-Aug-13 30-Dec-99 4 3 8 6 5 7 -3 No MSC Yes 52.877 52.877 52.877 52.877 52.877 52.877 52.877 1552PoA0421 HQAEXWWPQLI7PZL8Z27RVQ9EYN0H44 9617 Small-scale Hydropower Programme of Activities in Guizhou Province Asia & Pacific East Asia China Guizhou Registered Hydro Hydro New dam AMS-I.D. 1 4.0 3-Feb-13 28 0.000 39.770 TÜV-Rhein 0.000 n.a. n.a. 5-Feb-13 1-Oct-12 26-Apr-13 2-Oct-13 26-Apr-13 CPA 31-Dec-99CPA 9 4 5 -3 1.5

1553CPA0421.01 9617-0001 CPA-001-Moshigou Hydropower Project in Zheng’an County, Guizhou Province Asia & Pacific East Asia China Guizhou Registered Hydro Hydro New dam 1.5 MW small scale hydro dam project AMS-I.D. 1 4.0 10 20 0.0 1-Jan-15 0.000 39.770 TÜV-Rhein n.a. n.a. 5-Feb-13 26-Apr-13 30-Dec-99 9 4 5 -3 1.5 6057 0.657 No Other 3.977 3.977 3.977 3.977 3.977 3.977 3.977 3.977 3.977 3.977

1554PoA0422 5OU7T6OTS119BWM69C11ZUYYZXWIQJ 9705 Programme of Activities for Small Scale Hydropower CDM in Sri Lanka Asia & Pacific Southern Asia Sri Lanka Sri Lanka Sri Lanka Carbon Fun Registered Hydro Hydro Run of river AMS-I.D. 8 46.6 13-Sep-12 28 0.000 206.009 Deloitte-TECO 6.760 n.a. n.a. 5-Feb-13 5-Aug-13 6-Aug-13 25-Oct-13 6-Aug-13 CPA 31-Dec-99CPA 5 1 8 -3 15.7

1555CPA0422.01 9705-0001 Ganthuna Small Hydropower Project <2013-PPB-001-1.3MW> Asia & Pacific Southern Asia Sri Lanka Aranayaka Sri Lanka Carbon Fun Registered Hydro Hydro Run of river AMS-I.D. 1 3.2 7 20 0.0 28-Feb-13 0.000 24.936 Deloitte-TECO n.a. n.a. 5-Feb-13 6-Aug-13 30-Dec-99 5 1 8 -3 1.3 4555 No Financial 3 3.433 3.433 3.433 3.433 3.433 3.433 3.433

1556CPA0422.02 9705-0002 3.8MW Bulathwaththa Small Hydropower Project<2014-MPM-004-3.8MW> Asia & Pacific Southern Asia Sri Lanka Sri Lanka Carbon Fun Registered Hydro Hydro Run of river AMS-I.D. 1 9.1 7 20 0.0 1-Sep-15 0.000 48.342 Deloitte-TECO 6.760 6.760 n.a. 5-Feb-13 12-Aug-15 30-Dec-99 5 1 8 -3 1.3 4555 No Financial 9.058 9.058 9.058 9.058 9.058 9.058 9.058

1557CPA0422.03 9705-0003 2.0MW Maskeliya Oya Small Hydropower Project<2014-PPD-003-2.0MW> Asia & Pacific Southern Asia Sri Lanka Sri Lanka Carbon Fun Registered Hydro Hydro Run of river AMS-I.D. 1 5.2 7 20 0.0 1-Feb-16 0.000 25.568 Deloitte-TECO n.a. 5-Feb-13 13-Oct-15 30-Dec-99 5 1 8 -3 2.0 7154 No Financial 5.199 5.199 5.199 5.199 5.199 5.199 5.199

1558CPA0422.04 9705-0004 3.0MW Koswathu Ganga Small Hydropower Project<2014-FIN-005-3.0MW> Asia & Pacific Southern Asia Sri Lanka Sri Lanka Carbon Fun Registered Hydro Hydro Run of river AMS-I.D. 1 8.9 7 20 0.0 1-Sep-16 0.000 38.748 Deloitte-TECO n.a. 5-Feb-13 13-Oct-15 30-Dec-99 5 1 8 -3 3.0 12300 No Financial 8.940 8.940 8.940 8.940 8.940 8.940 8.940

1559CPA0422.05 9705-0005 3.25MW Dambulu Oya Small Hydropower Project<2014-HPD-002-3.25MW> Asia & Pacific Southern Asia Sri Lanka Sri Lanka Carbon Fun Registered Hydro Hydro Run of river AMS-I.D. 1 11.0 7 20 0.0 1-Jan-17 0.000 44.152 Deloitte-TECO n.a. 5-Feb-13 13-Oct-15 30-Dec-99 5 1 8 -3 3.3 15187 No Financial 11.038 11.038 11.038 11.038 11.038 11.038 11.038

1560CPA0422.06 9705-0006 1.4MW Gomale Oya Small Hydropower Project <2016-GMO-007-1.4MW> Asia & Pacific Southern Asia Sri Lanka Sabaragamuwa Sri Lanka Carbon Fun Registered Hydro Hydro Run of river AMS-I.D. 1 2.5 7 20 0.0 1-Nov-17 7.965 Deloitte-TECO n.a. 5-Feb-13 20-Oct-17 30-Dec-99 5 1 8 -3 1.4 3461 0.726 No Financial 2.515 2.515 2.515 2.515 2.515 2.515 2.515

1561CPA0422.07 9705-0007 1.5MW Moragaha Oya Small Hydropower Project <2016-MOR-008-1.5MW> Asia & Pacific Southern Asia Sri Lanka Kandy Sri Lanka Carbon Fun Registered Hydro Hydro Run of river AMS-I.D. 1 3.2 7 20 0.0 1-Nov-17 10.271 Deloitte-TECO n.a. 5-Feb-13 20-Oct-17 30-Dec-99 5 1 8 -3 1.5 4450 0.727 No Financial 3.234 3.234 3.234 3.234 3.234 3.234 3.234

1562CPA0422.08 9705-0008 Asia & Pacific Southern Asia Sri Lanka Kandy Sri Lanka Carbon Fun Registered Hydro Hydro Run of river AMS-I.D. 1 3.4 7 20 0.0 1-Apr-19 6.027 Deloitte-TECO n.a. 5-Feb-13 20-Oct-17 30-Dec-99 5 1 8 -3 1.9 4730 0.727 No Financial 3.437 3.437 3.437 3.437 3.437 3.437 3.437

1563PoA0423 NXW8NYFJ1P4SIED5ISBCE7SIJDD42Q Asia & Pacific Southern Asia Nepal Nepal Shubhalakshya Developer Validation Terminated EE households EE households Stoves AMS-II.G. 1 1.9 4-Feb-13 28 0.000 18.860 JQA 0.000 n.a. n.a. 5-Feb-13 CPA 30-Dec-99CPA 4 6 -1 0.0

1564CPA0423.01 CPA-1_HCS programme in Nepal Asia & Pacific Southern Asia Nepal Kavrepalanchouk Shubhalakshya Developer Validation Terminated EE households EE households Stoves AMS-II.G. 1 1.9 10 10 0.0 1-Jan-14 0.000 18.860 JQA n.a. n.a. 5-Feb-13 30-Dec-99 4 6 -1 No 1.139 2.401 2.280 2.165 2.056 1.953 1.855 1.761 1.671 1.587

1565PoA0424 9JHYIBRKQ7EH0SWZD3CIAQ2FRH5ON2 Coal Water Slurry CDM Programme of Activity for A&A Energy Asia & Pacific East Asia China Guizhou Beijing YuanDa carbon Assets At Validation EE industry EE industry Higher efficiency coal power AMS-II.D. 1 5.8 8-Mar-13 28 0.000 57.580 TÜV-Rhein 0.000 n.a. n.a. 8-Feb-13 CPA 31-Dec-99CPA 1 6 5 -5 0.0

1566CPA0424.01 Asia & Pacific East Asia China Qingzhen Beijing YuanDa carbon Assets At Validation EE industry EE industry Higher efficiency coal power Coal Water Slurry boilers AMS-II.D. 1 5.8 10 10 0.0 1-Jun-13 0.000 57.580 TÜV-Rhein n.a. n.a. 8-Feb-13 30-Dec-99 1 6 5 -5 No 3.031 6.061 6.061 6.061 6.061 6.061 6.061 6.061 6.061 6.061

1567PoA0425 4J3CE2NLGO9BMO9R6N6ACLPC7698TV CDM Africa Sustainable Energy Programme Africa East Africa Malawi Zambia Malawi and Zambi Replaced At Validation EE households EE households Stoves AMS-I.E. 23-Jan-13 28 TÜV-SÜD n.a. n.a. 9-Feb-13 8-May-13 PoA 30-Dec-99PoA 4 6 8 1

1568CPA0425.01 CDM Africa Sustainable Energy Programme in Lilongwe, Malawi CPA-001 Africa East Africa Malawi Malawi Replaced At Validation EE households EE households Stoves AMS-I.E. 1 84.3 10 10 0.0 1-Mar-13 0.000 842.650 TÜV-SÜD n.a. n.a. 9-Feb-13 8-May-13 30-Dec-99 4 6 8 1 No 21.818 49.378 76.938 99.216 99.216 99.216 99.216 99.216 99.216 99.216

1569PoA0426 JXL2Y84V8EMDBFFJCVFR34PEJ5VROU DVC Solar Programme PoA Asia & Pacific Southern Asia India Damodar Valley Corporation Validation Terminated Solar Solar Solar PV AMS-I.D. 1 21.8 5-Oct-12 25 0.000 218.150 URS 0.000 n.a. n.a. 14-Feb-13 PoA 30-Dec-99PoA 5 0 0.0

1570CPA0426.01 CPA 1- Right Bank Main Canal- 1 Asia & Pacific Southern Asia India West Bengal Damodar Valley Corporation Validation Terminated Solar Solar Solar PV AMS-I.D. 1 21.8 10 25 0.0 31-May-13 0.000 218.150 URS n.a. n.a. 14-Feb-13 30-Dec-99 5 0 No 21.815 21.815 21.815 21.815 21.815 21.815 21.815 21.815 21.815 21.815

1571PoA0427 ACS2B35M0XY389CTPD0C4B7XK2JDV1 9815 Man and Man Enterprise Improved Cooking Stoves Programme in Togo Africa West Africa Togo Togo Man & Man Enterprise Registered EE households EE households Stoves AMS-II.G. 1 48.0 1-Apr-13 28 0.000 372.304 TÜV-Rhein 0.000 United K. (Eneco Energy) Ecosur Afrique 13-Mar-13 3-Sep-13 18-Jun-14 15-Aug-14 18-Jun-14 PoA 30-Dec-99PoA 6 9 11 12 5 3 0.0 Yes

1572CPA0427.01 9815-0001 Man and Man Enterprise Improved Cooking Stoves Programme in Togo Africa West Africa Togo Maritime Region Man & Man Enterprise Registered EE households EE households Stoves Improved Kenyan Jiko-type stoves AMS-II.G. 1 48.0 7 3 0.0 1-Apr-13 0.000 372.304 TÜV-Rhein United K. (Eneco Energy) Ecosur Afrique 13-Mar-13 18-Jun-14 30-Dec-99 6 9 11 12 5 3 Ghana Ghana No Plist Yes 34.717 46.289 46.289 46.289 46.289 46.289 46.289 11.572

1573PoA0428 225PPVQSD435LNLP5S15HR0V4LN1EQ 10134 Improved Cookstoves for Haiti Latin America Caribbean Haiti Haiti C-Quest Capital Registered EE households EE households Stoves AMS-II.G. 1 27.0 13-Mar-13 28 0.000 153.544 DNV 0.000 n.a. n.a. 19-Mar-13 17-Nov-14 24-Apr-15 24-Apr-15 PoA 30-Dec-99PoA 4 6 12 9 0 0.0

1574CPA0428.01 10134-01 Distribution of Improved Cookstoves for Haiti – CPA 001 Latin America Caribbean Haiti Haiti C-Quest Capital Registered EE households EE households Stoves AMS-II.G. 1 27.0 7 15 0.0 30-Apr-15 0.000 153.544 DNV n.a. n.a. 19-Mar-13 24-Apr-15 30-Dec-99 4 6 12 9 0 No MSC 13.395 26.789 26.789 26.789 26.789 26.789 26.789 13.395

1575PoA0429 800PC9TDFWPK3KSNWNQRIR57GYA921 9934 CDM Africa Sustainable Energy Programme Africa East Africa Malawi Malawi and Zambia Registered EE households EE households Stoves AMS-I.E. 1 49.6 26-Apr-13 28 0.000 496.010 TÜV-SÜD 0.000 Sweden (C-Quest Capital) n.a. 8-May-13 9-Feb-13 PoA0425 7-Feb-14 5-Mar-14 16-Apr-14 CPA 30-Dec-99CPA 1 6 4 3 0.0

1576CPA0429.01 9934-0001 CDM Africa Sustainable Energy Programme in Lilongwe, Malawi CPA-001 Africa East Africa Malawi Lilongwe Registered EE households EE households Stoves Philips Smokeless stove AMS-I.E. 1 49.6 10 10 0.0 1-Jul-13 0.000 496.010 TÜV-SÜD Sweden (C-Quest Capital) n.a. 8-May-13 9-Feb-13 CPA0425.0001 16-Apr-14 30-Dec-99 1 6 4 3 No MSC 21.818 49.378 76.938 99.216 99.216 99.216 99.216 99.216 99.216 99.216 1577PoA0430 OXY7E7RTBRBNAXVW06E45VH49M3Y0Q 9811 Improved Cook Stove Programme with Carbon Finance (ICF), Nepal Asia & Pacific Southern Asia Nepal Registered EE households EE households Stoves AMS-II.G. 3 125.2 17-Mar-13 28 0.000 1,252.070 TÜV-Rhein 129.132 129.132 21-Jan-16 1-Apr-17 TÜV-Rhein United K. (Eneco Energy) Impact Carbon 22-May-13 25-Sep-13 19-Dec-13 5-Mar-14 19-Nov-13 PoA 30-Dec-99PoA 1 6 4 -1 0.0 Yes1578CPA0430.01 9811-0001 CPA # 01 Asia & Pacific Southern Asia Nepal Registered EE households EE households Stoves Locally made stoves AMS-II.G. 1 41.6 10 10 0.0 17-May-13 0.000 415.870 TÜV-Rhein 0.000 74.968 74.968 21-Jan-16 1-Apr-17 TÜV-Rhein United K. (Eneco Energy) Impact carbon 22-May-13 19-Nov-13 30-Dec-99 1 6 4 -1 No MSC Yes 26.633 42.637 42.637 42.637 42.637 42.637 42.637 42.637 42.637 15.887 1579CPA0430.02 9811-0002 CPA # 02 Asia & Pacific Southern Asia Nepal Registered EE households EE households Stoves AMS-II.G. 1 41.8 10 10 0.0 19-Dec-14 418.100 TÜV-Rhein 0.000 40.439 40.439 21-Jan-16 1-Apr-17 TÜV-Rhein United K. (Eneco Energy) Impact carbon 22-May-13 19-Dec-14 30-Dec-99 1 6 4 -1 No MSC 41.810 41.810 41.810 41.810 41.810 41.810 41.810 41.810 41.810 41.810 1580CPA0430.03 9811-0003 CPA # 03 Asia & Pacific Southern Asia Nepal Registered EE households EE households Stoves AMS-II.G. 1 41.8 10 10 0.0 19-Dec-14 418.100 TÜV-Rhein 0.000 13.725 13.725 22-Dec-17 1-Apr-17 TÜV-Rhein United K. (Eneco Energy) Impact carbon 22-May-13 19-Dec-14 30-Dec-99 1 6 4 -1 No MSC 41.810 41.810 41.810 41.810 41.810 41.810 41.810 41.810 41.810 41.810 1581PoA0431 K1MM085EOD4T0V6TA3XRWOCQDU7Z68 City of Cape Town Treatment of Organic Waste Streams CDM Projects Africa Southern Africa South Africa South Africa City of Cape Town Validation Terminated Methane avoidance Methane avoidance Waste water AM25 1 49.1 1-Jul-13 28 0.000 343.982 Carbon Check 0.000 n.a. n.a. 28-May-13 PoA0389 CPA 30-Dec-99CPA 1 5 9 2 0.01582CPA0431.01 Cape Flats Anaerobic Digestion Facility (CPA01) Africa Southern Africa South Africa City of Cape Town Validation Terminated Methane avoidance Methane avoidance Waste water AM25 1 49.1 7 21 0.0 1-Jan-14 0.000 343.982 Carbon Check n.a. n.a. 28-May-13 CPA0389.0001 30-Dec-99 1 5 9 2 No Prevailing practice 34.818 34.818 45.943 57.067 57.067 57.067 57.067 1583PoA0432 J6BH1IA303D4ZP6S684Q6ZMRXIUUEO 10018 Production of biogas from animal manure for rural household Africa North Africa Sudan Sudan Registered Methane avoidance Methane avoidance Domestic manure AMS-I.E. 1 55.9 16-Jun-13 28 0.000 391.383 URS 0.000 n.a. n.a. 16-Jun-13 1-Jan-14 12-Aug-14 3-Oct-14 12-Aug-14 PoA 30-Dec-99CPA SD Tool 4 12 5 6 1 0.0 Yes1584CPA0432.01 10018-0001 Production of Biogas in North Kordofan, Sudan Africa North Africa Sudan Registered Methane avoidance Methane avoidance Domestic manure AMS-I.E. 1 55.9 7 21 0.0 1-Jan-14 0.000 391.383 URS n.a. n.a. 16-Jun-13 12-Aug-14 30-Dec-99 SD Tool 4 12 5 6 1 No Plist Yes 36.509 36.509 36.509 36.509 36.509 36.509 36.509 1585PoA0433 CEM44UHRR31D8ALMI0USR3U7BJ2IPS 10124 CDM Sustainable Energy Programme Africa West Africa Senegal Zambia Senagal, Zambia SEM Fund Registered EE households EE households Stoves AMS-I.E. 2 72.3 19-Jul-13 28 0.000 370.174 KBS 0.000 n.a. 19-Jul-13 1-Apr-15 19-Feb-15 23-Apr-15 19-Feb-15 PoA 30-Dec-99PoA 4 6 8 9 1 0.0 MSC Yes1586CPA0433.01 10124-0001 CDM Sustainable Energy Project Dakar 1, Version 01. Africa West Africa Senegal Senegal SEM Fund Registered EE households EE households Stoves AMS-I.E. 1 31.3 7 21 5.5 20-Mar-15 0.000 181.411 KBS n.a. 19-Jul-13 19-Feb-15 30-Dec-99 4 6 8 9 1 MSC Yes 3.662 54.334 64.150 64.150 64.150 64.150 64.150 1587CPA0433.02 10124-0002 CDM Sustainable Energy Project Dakar 2, Version 01. Africa West Africa Senegal Senegal SEM Fund Registered EE households EE households Stoves AMS-I.E. 1 41.0 7 21 5.5 26-May-16 0.000 188.763 KBS n.a. 19-Jul-13 26-May-17 30-Dec-99 4 6 8 9 1 MSC Yes 16.881 41.231 45.794 45.794 45.794 45.794 45.794 1588PoA0434 B1M92WPJZUPMP9E64OL663TEDP26Z0 9941 Programme of Activities for Local Improved Cookstoves in West Afria Africa West Africa Mali Benin Mali, Benin GERES Association Registered EE households EE households Stoves AMS-II.G. 1 32.9 18-Feb-13 28 0.000 233.140 DNV 2.747 n.a. 6-Aug-13 8-Nov-13 21-May-14 18-Jul-14 21-May-14 CPA 30-Dec-99CPA Gold Standard 4 9 6 -1 0.0 Plist1589CPA0434.01 9941-0001 Project Activity for Local Improved Cookstoves in Bamako Africa West Africa Mali Bamako GERES Association Registered EE households EE households Stoves AMS-II.G. 1 32.9 7 7 0.0 30-Nov-13 0.000 233.140 DNV 2.747 2.747 22-Dec-16 31-Dec-15 n.a. 6-Aug-13 21-May-14 30-Dec-99 4 9 6 -1 Yes Plist 24.264 29.058 29.058 29.058 29.058 29.058 29.058 1590PoA0435 Z57MTLC6J08HCLDJVZEO9ITMTD3XWZ 9948 Impact Carbon Global Safe Water Programme of Activities (PoA) Africa East Africa Rwanda Uganda Rwanda, Uganda Impact Carbon Registered EE service EE service Water purification AMS-III.AV. 22 719.1 17-Aug-13 28 0.000 2,386.433 ERM CVS 0.000 Germany (Stiftung Zukunft des Kohlenstoffmarktes) n.a. 17-Aug-13 10-Sep-12 30-Apr-14 1-May-14 CPA 30-Dec-99CPA 4 1 6 9 10 5 0 0.0 Plist Yes1591CPA0435.01 9948-0001 Impact Carbon Global Safe Water Programme of Activities (PoA): CPA 1 Africa East Africa Rwanda Rwanda Impact Carbon Registered EE service EE service Water purification AMS-III.AV. 1 13.6 7 21 3.1 30-May-14 0.000 89.567 ERM CVS Germany (Stiftung Zukunft des Kohlenstoffmarktes) n.a. 17-Aug-13 1-May-14 30-Dec-99 4 1 6 9 10 5 0 No Plist Yes 0.876 4.381 10.715 19.715 19.715 19.715 19.715 1592CPA0435.02 9948-0002 Impact Carbon Global Safe Water Programme of Activities (PoA): CPA 2 Africa East Africa Uganda Uganda Central, Western Impact Carbon Registered EE service EE service Water purification AMS-III.AV. 1 12.9 7 21 2.0 30-May-14 0.000 84.779 ERM CVS Germany (Stiftung Zukunft des Kohlenstoffmarktes) n.a. 17-Aug-13 1-May-14 30-Dec-99 4 1 6 9 10 5 0 No Plist Yes 3.658 9.512 15.365 15.365 15.365 15.365 15.365 1593CPA0435.03 9948-0003 Impact Carbon Global Safe Water Programme of Activities (PoA): CPA 3 Africa East Africa Nigeria Nigeria Nigeria Impact Carbon Registered EE service EE service Water purification AMS-III.AV. 1 34.0 7 21 7.0 30-Mar-17 0.000 127.893 ERM CVS Germany (Stiftung Zukunft des Kohlenstoffmarktes) n.a. 17-Aug-13 8-May-17 30-Dec-99 4 1 6 9 10 5 0 No Plist Yes 8.506 17.012 25.518 34.025 42.531 51.037 59.544 1594CPA0435.04 9948-0004 Impact Carbon Global Safe Water Programme of Activities (PoA): CPA 4 Africa East Africa Kenya Kenya Kenya Impact Carbon Registered EE service EE service Water purification AMS-III.AV. 1 34.4 7 21 2.0 15-Jun-17 0.000 121.886 ERM CVS Germany (Stiftung Zukunft des Kohlenstoffmarktes) n.a. 17-Aug-13 2-Jul-17 30-Dec-99 4 1 6 9 10 5 0 No Plist Yes 8.610 17.221 25.831 34.442 43.052 51.663 59.658 1595CPA0435.05 9948-0005 Impact Carbon Global Safe Water Programme of Activities (PoA): CPA 5 Africa East Africa Nigeria Nigeria Nigeria Impact Carbon Registered EE service EE service Water purification AMS-III.AV. 1 34.0 7 21 4-Oct-17 110.368 ERM CVS Germany (Stiftung Zukunft des Kohlenstoffmarktes) n.a. 17-Aug-13 4-Oct-17 30-Dec-99 4 1 6 9 10 5 0 No Plist Yes 8.506 17.012 25.518 34.025 42.531 51.037 59.544 1596CPA0435.06 9948-0006 Impact Carbon Global Safe Water Programme of Activities (PoA): CPA 6 Africa East Africa Nigeria Nigeria Nigeria Impact Carbon Registered EE service EE service Water purification AMS-III.AV. 1 34.0 7 21 4-Oct-17 110.368 ERM CVS Germany (Stiftung Zukunft des Kohlenstoffmarktes) n.a. 17-Aug-13 4-Oct-17 30-Dec-99 4 1 6 9 10 5 0 No Plist Yes 8.506 17.012 25.518 34.025 42.531 51.037 59.544 1597CPA0435.07 9948-0007 Impact Carbon Global Safe Water Programme of Activities (PoA): CPA 7 Africa East Africa Nigeria Nigeria Nigeria Impact Carbon Registered EE service EE service Water purification AMS-III.AV. 1 34.0 7 21 4-Oct-17 110.368 ERM CVS Germany (Stiftung Zukunft des Kohlenstoffmarktes) n.a. 17-Aug-13 4-Oct-17 30-Dec-99 4 1 6 9 10 5 0 No Plist Yes 8.506 17.012 25.518 34.025 42.531 51.037 59.544 1598CPA0435.08 9948-0008 Impact Carbon Global Safe Water Programme of Activities (PoA): CPA 8 Africa East Africa Nigeria Nigeria Nigeria Impact Carbon Registered EE service EE service Water purification AMS-III.AV. 1 34.0 7 21 4-Oct-17 110.368 ERM CVS Germany (Stiftung Zukunft des Kohlenstoffmarktes) n.a. 17-Aug-13 4-Oct-17 30-Dec-99 4 1 6 9 10 5 0 No Plist Yes 8.506 17.012 25.518 34.025 42.531 51.037 59.544 1599CPA0435.09 9948-0009 Impact Carbon Global Safe Water Programme of Activities (PoA): CPA 9 Africa East Africa Nigeria Nigeria Nigeria Impact Carbon Registered EE service EE service Water purification AMS-III.AV. 1 34.0 7 21 4-Oct-17 110.368 ERM CVS Germany (Stiftung Zukunft des Kohlenstoffmarktes) n.a. 17-Aug-13 4-Oct-17 30-Dec-99 4 1 6 9 10 5 0 No Plist Yes 8.506 17.012 25.518 34.025 42.531 51.037 59.544 1600CPA0435.10 9948-0010 Impact Carbon Global Safe Water Programme of Activities (PoA): CPA 10 Africa East Africa Nigeria Nigeria Nigeria Impact Carbon Registered EE service EE service Water purification AMS-III.AV. 1 34.0 7 21 4-Oct-17 110.368 ERM CVS Germany (Stiftung Zukunft des Kohlenstoffmarktes) n.a. 17-Aug-13 4-Oct-17 30-Dec-99 4 1 6 9 10 5 0 No Plist Yes 8.506 17.012 25.518 34.025 42.531 51.037 59.544 1601CPA0435.11 9948-0011 Impact Carbon Global Safe Water Programme of Activities (PoA): CPA 11 Africa East Africa Nigeria Nigeria Nigeria Impact Carbon Registered EE service EE service Water purification AMS-III.AV. 1 34.0 7 21 4-Oct-17 110.368 ERM CVS Germany (Stiftung Zukunft des Kohlenstoffmarktes) n.a. 17-Aug-13 4-Oct-17 30-Dec-99 4 1 6 9 10 5 0 No Plist Yes 8.506 17.012 25.518 34.025 42.531 51.037 59.544 1602CPA0435.12 9948-0012 Impact Carbon Global Safe Water Programme of Activities (PoA): CPA 12 Africa East Africa Nigeria Nigeria Nigeria Impact Carbon Registered EE service EE service Water purification AMS-III.AV. 1 34.0 7 21 4-Oct-17 110.368 ERM CVS Germany (Stiftung Zukunft des Kohlenstoffmarktes) n.a. 17-Aug-13 4-Oct-17 30-Dec-99 4 1 6 9 10 5 0 No Plist Yes 8.506 17.012 25.518 34.025 42.531 51.037 59.544 1603CPA0435.13 9948-0013 Impact Carbon Global Safe Water Programme of Activities (PoA): CPA 13 Africa East Africa Nigeria Nigeria Nigeria Impact Carbon Registered EE service EE service Water purification AMS-III.AV. 1 34.0 7 21 4-Oct-17 110.368 ERM CVS Germany (Stiftung Zukunft des Kohlenstoffmarktes) n.a. 17-Aug-13 4-Oct-17 30-Dec-99 4 1 6 9 10 5 0 No Plist Yes 8.506 17.012 25.518 34.025 42.531 51.037 59.544 1604CPA0435.14 9948-0014 Impact Carbon Global Safe Water Programme of Activities (PoA): CPA 14 Africa East Africa Uganda Uganda Uganda Impact Carbon Registered EE service EE service Water purification AMS-III.AV. 1 35.3 7 21 15-Dec-17 107.666 ERM CVS n.a. 17-Aug-13 21-Nov-17 30-Dec-99 4 1 6 9 10 5 0 No Plist Yes 10.734 20.395 29.089 36.915 43.957 50.296 56.000 1605CPA0435.15 9948-0015 Impact Carbon Global Safe Water Programme of Activities (PoA): CPA 15 Africa East Africa Uganda Uganda Uganda Impact Carbon Registered EE service EE service Water purification AMS-III.AV. 1 35.3 7 21 15-Dec-17 107.666 ERM CVS n.a. 17-Aug-13 21-Nov-17 30-Dec-99 4 1 6 9 10 5 0 No Plist Yes 10.734 20.395 29.089 36.915 43.957 50.296 56.000 1606CPA0435.16 9948-0016 Impact Carbon Global Safe Water Programme of Activities (PoA): CPA 16 Africa East Africa Uganda Uganda Uganda Impact Carbon Registered EE service EE service Water purification AMS-III.AV. 1 35.3 7 21 15-Dec-17 107.666 ERM CVS n.a. 17-Aug-13 21-Nov-17 30-Dec-99 4 1 6 9 10 5 0 No Plist Yes 10.734 20.395 29.089 36.915 43.957 50.296 56.000 1607CPA0435.17 9948-0017 Impact Carbon Global Safe Water Programme of Activities (PoA): CPA 17 Africa East Africa Uganda Uganda Uganda Impact Carbon Registered EE service EE service Water purification AMS-III.AV. 1 35.3 7 21 15-Dec-17 107.666 ERM CVS n.a. 17-Aug-13 21-Nov-17 30-Dec-99 4 1 6 9 10 5 0 No Plist Yes 10.734 20.395 29.089 36.915 43.957 50.296 56.000 1608CPA0435.18 9948-0018 Impact Carbon Global Safe Water Programme of Activities (PoA): CPA 18 Africa East Africa Uganda Uganda Uganda Impact Carbon Registered EE service EE service Water purification AMS-III.AV. 1 35.3 7 21 15-Dec-17 107.666 ERM CVS n.a. 17-Aug-13 21-Nov-17 30-Dec-99 4 1 6 9 10 5 0 No Plist Yes 10.734 20.395 29.089 36.915 43.957 50.296 56.000 1609CPA0435.19 9948-0019 Impact Carbon Global Safe Water Programme of Activities (PoA): CPA 19 Africa East Africa Uganda Uganda Uganda Impact Carbon Registered EE service EE service Water purification AMS-III.AV. 1 35.3 7 21 15-Dec-17 107.666 ERM CVS n.a. 17-Aug-13 21-Nov-17 30-Dec-99 4 1 6 9 10 5 0 No Plist Yes 10.734 20.395 29.089 36.915 43.957 50.296 56.000 1610CPA0435.20 9948-0020 Impact Carbon Global Safe Water Programme of Activities (PoA): CPA 20 Africa East Africa Uganda Uganda Uganda Impact Carbon Registered EE service EE service Water purification AMS-III.AV. 1 35.3 7 21 15-Dec-17 107.666 ERM CVS n.a. 17-Aug-13 21-Nov-17 30-Dec-99 4 1 6 9 10 5 0 No Plist Yes 10.734 20.395 29.089 36.915 43.957 50.296 56.000 1611CPA0435.21 9948-0021 Impact Carbon Global Safe Water Programme of Activities (PoA): CPA 21 Africa East Africa Uganda Uganda Uganda Impact Carbon Registered EE service EE service Water purification AMS-III.AV. 1 35.3 7 21 15-Dec-17 107.666 ERM CVS n.a. 17-Aug-13 21-Nov-17 30-Dec-99 4 1 6 9 10 5 0 No Plist Yes 10.734 20.395 29.089 36.915 43.957 50.296 56.000 1612CPA0435.22 9948-0022 Impact Carbon Global Safe Water Programme of Activities (PoA): CPA 22 Africa East Africa Uganda Uganda Uganda Impact Carbon Registered EE service EE service Water purification AMS-III.AV. 1 35.3 7 21 15-Dec-17 107.666 ERM CVS n.a. 17-Aug-13 21-Nov-17 30-Dec-99 4 1 6 9 10 5 0 No Plist Yes 10.734 20.395 29.089 36.915 43.957 50.296 56.000 1613PoA0436 YJTOH0TT7HP5ZDP000NYOHHKBKMI5I Asia & Pacific Southern Asia India India Replaced At Validation EE industry EE service Iron & steel heat AMS-II.D. 28-Mar-13 28 CTI n.a. n.a. 27-Aug-13 12-Dec-13 CPA 30-Dec-99PoA 10 1 5 8 6 -11614CPA0436.01 Asia & Pacific Southern Asia India India Gujarat Replaced At Validation EE industry EE service Iron & steel heat AMS-II.D. 1 0.1 10 30 0.0 9-Apr-13 0.000 1.100 CTI n.a. n.a. 27-Aug-13 12-Dec-13 30-Dec-99 10 1 5 8 6 -1 No 0.110 0.110 0.110 0.110 0.110 0.110 0.110 0.110 0.110 0.110 1615PoA0437 OWTZ3YKG6G3SMHMKZ6CMG3XKQZMXFC Decentralised Community Water Purification Program (DCWPP) Interregional Interregional India Water Health India Pvt Validation Terminated EE households EE households Water purification AMS-III.AV. 1 19.0 24-Sep-12 28 0.000 189.680 BV Cert 0.000 n.a. n.a. 5-Sep-13 CPA 30-Dec-99CPA 3 6 4 5 11 3 0.01616CPA0437.01 Africa West Africa Ghana Water Health India Pvt Validation Terminated EE households EE households Water purification AMS-III.AV. 1 19.0 10 20 0.0 31-Dec-13 0.000 189.680 BV Cert n.a. n.a. 5-Sep-13 30-Dec-99 3 6 4 5 11 3 No 18.968 18.968 18.968 18.968 18.968 18.968 18.968 18.968 18.968 18.968 1617PoA0438 IX1LNUH7LDP6QTIKMK0GOX58TP9YQX 9847 Renewable Energy CDM Programme of Rwanda (RECPR) Africa East Africa Rwanda Rwanda Ngali Energy Registered Hybrid renewables Hybrid renewables 6 68.9 6-May-13 28 0.000 256.389 TÜV-Rhein 0.000 n.a. n.a. 5-Sep-13 12-Dec-13 30-Mar-15 30-Mar-15 CPA 31-Dec-99CPA 10 5 9 0 17.0

1618CPA0438.01 9847-0001 Base II Hydropower Project Africa East Africa Rwanda Gakenke District Ngali Energy Registered Hybrid renewables Hydro New dam 1 13.3 7 30 0.0 1-Jan-16 0.000 66.566 TÜV-Rhein n.a. n.a. 5-Sep-13 30-Mar-15 30-Dec-99 10 5 9 0 2.9 18890 No MSC 13.306 13.306 13.306 13.306 13.306 13.306 13.306

1619CPA0438.02 9847-0002 Base I Hydropower Project Africa East Africa Rwanda Kigali DG Works Ltd Registered Hybrid renewables Hydro New dam 1 12.6 7 30 0.0 1-Jan-18 0.000 37.740 TÜV-Rhein n.a. 5-Sep-13 15-Sep-15 30-Dec-99 10 5 9 0 2.9 17860 No MSC 12.580 12.580 12.580 12.580 12.580 12.580 1620CPA0438.03 9847-0003 Giciye II Hydropower Project Africa East Africa Rwanda Nyabihu District DG Works Ltd Registered Hybrid renewables Hydro New dam 1 13.1 7 30 0.0 1-Apr-16 0.000 62.275 TÜV-Rhein n.a. 5-Sep-13 15-Sep-15 30-Dec-99 10 5 9 0 4.2 18000 0.704 No MSC 9.907 13.101 13.101 13.101 3.194

1621CPA0438.04 9847-0004 Ngororero Hydropower Project Africa East Africa Rwanda Ngororero District DG Works Ltd Registered Hybrid renewables Hydro New dam 1 12.2 7 30 0.0 1-Jan-18 0.000 36.558 TÜV-Rhein n.a. 5-Sep-13 15-Sep-15 30-Dec-99 10 5 9 0 2.4 17300 0.704 No MSC 12.186 12.186 12.186 12.186 12.186 12.186 12.186 1622CPA0438.05 9847-0005 Ntaruka A Hydropower Project Africa East Africa Rwanda Kigali DG Works Ltd Registered Hybrid renewables Hydro New dam 1 9.7 7 30 0.0 1-Jan-18 0.000 29.160 TÜV-Rhein n.a. 5-Sep-13 15-Sep-15 30-Dec-99 10 5 9 0 2.0 13800 0.704 No MSC 9.720 9.720 9.720 9.720 9.720 9.720 9.720 1623CPA0438.06 9847-0006 Rwondo Hydropower Project Africa East Africa Rwanda Kigali DG Works Ltd Registered Hybrid renewables Hydro New dam 1 8.0 7 30 0.0 1-Jan-18 0.000 24.090 TÜV-Rhein n.a. 5-Sep-13 15-Sep-15 30-Dec-99 10 5 9 0 2.6 11400 0.704 No MSC 8.030 8.030 8.030 8.030 8.030 8.030 8.030 1624PoA0439 5J795DDLOATXXWHW34QTFG41TFM7K1 10045 Fuel Efficient Stoves for Ethiopia Programme of Activity Africa East Africa Ethiopia Ethiopia World Food Programme Registered EE households EE households Stoves AMS-II.G. 1 43.1 28 0.000 309.000 TÜV-Rhein 0.000 n.a. n.a. 18-Sep-13 6-Nov-12 13-Oct-14 28-Nov-14 13-Oct-14 PoA 30-Dec-99PoA 4 1 6 0 0.01625CPA0439.01 10045-0001 Ethiopia Improved Cookstoves Initiative CPA 1 Africa East Africa Ethiopia Amhara region World Food Programme Registered EE households EE households Stoves AMS-II.G. 1 43.1 7 7 0.0 1-Nov-13 0.000 309.000 TÜV-Rhein n.a. n.a. 18-Sep-13 13-Oct-14 30-Dec-99 4 1 6 0 No 48.169 48.169 48.169 48.169 48.169 48.169 48.169 1626PoA0440 ZK7KC0DQEOMI5BF35X5I4SFUXF26Z3 10008 Installation of Energy Efficient Cookstoves in Yangon in Myanmar: CPA 001 Asia & Pacific East Asia Myanmar Myanmar Myanmar Core CarbonX Sols Pvt Ltd Registered EE households EE households Stoves AMS-II.G. 1 34.1 1-Oct-13 28 0.000 341.490 CTI 0.000 n.a. n.a. 1-Oct-13 29-Sep-15 1-Feb-17 3-May-17 15-Mar-17 PoA 30-Dec-99PoA 4 5 8 9 1 0 0.0 Yes1627CPA0440.01 10008-0001 Installation of Energy Efficient Cookstoves in Myanmar Asia & Pacific East Asia Myanmar Yangon Core CarbonX Sols Pvt Ltd Registered EE households EE households Stoves AMS-II.G. 1 34.1 10 10 0.0 15-Mar-17 0.000 341.490 CTI n.a. n.a. 1-Oct-13 15-Mar-17 30-Dec-99 4 5 8 9 1 0 No Plist Yes 34.149 34.149 34.149 34.149 34.149 34.149 34.149 34.149 34.149 34.149 1628PoA0441 13SFZPWFPLHUD007M8OTVGSU0OVOY7 10093 Cable Propelled Mass Transit Projects in Nigeria Africa West Africa Nigeria Nigeria Registered Transport Transport Mode shift: Road to rail AMS-III.U. 1 24.1 29-Oct-13 28 0.000 115.285 SGS 0.000 n.a. n.a. 29-Oct-13 28-Jun-14 29-Aug-16 21-Oct-16 31-Oct-15 CPA 31-Dec-99CPA 1 9 5 6 1 0.0 Financial;Technological Foik Yes1629CPA0441.01 10093-0001 Lagos Cable Propelled Transit Project Africa West Africa Nigeria Lagos Registered Transport Transport Mode shift: Road to rail AMS-III.U. 1 24.1 7 25 -0.4 18-Mar-16 0.000 115.285 SGS n.a. n.a. 29-Oct-13 31-Oct-15 30-Dec-99 1 9 5 6 1 No Yes 25.077 24.732 24.390 24.052 23.718 23.386 23.058

1630PoA0442 8BKLMUAT1G84R85S48ACQO2WEHPXIV 9974 Disseminating Efficient Cookstoves in Vanuatu Asia & Pacific Southern Asia Vanuatu Vanuatu Green Power Registered EE households EE households Stoves AMS-II.G. 1 11.2 2-Nov-13 0.000 80.257 JQA 0.000 n.a. n.a. 16-Nov-13 14-Jan-14 5-Sep-14 24-Oct-14 5-Sep-14 PoA 30-Dec-99PoA 9 5 2 6 0 0.0

1631CPA0442.01 9974-0001 Disseminating Efficient Cookstoves in Vanuatu CPA-No. 1 Asia & Pacific Southern Asia Vanuatu Entire country Green Power Registered EE households EE households Stoves AMS-II.G. 1 11.2 7 0.0 2-Nov-13 0.000 80.257 JQA n.a. n.a. 16-Nov-13 5-Sep-14 30-Dec-99 9 5 2 6 0 No MSC 9.524 9.524 9.524 9.524 9.524 9.524 9.524 9.524

1632PoA0443 037UDHJ1E7DKOPWLRTBZUT6I8P1Z50 West African Biodigester Programme of Activities Africa West Africa Burkina Faso Cameroon, Benin Replaced At Validation EE households EE households Biogas from MSW AMS-I.E. 29-Aug-13 28 Carbon Check n.a. n.a. 15-Nov-13 18-Dec-13 PoA 30-Dec-99CPA 2 1 5 8 6 0 Plist1633CPA0443.01 National Biodigester Programme Burkina Faso – CPA01 (PNB-BF-CPA01) Africa West Africa Burkina Faso Cameroon, Benin Burkina Faso Entire country Replaced At Validation EE households EE households Biogas from MSW AMS-I.E. 1 22.6 7 4.1 29-Aug-13 0.000 165.723 Carbon Check n.a. n.a. 15-Nov-13 18-Dec-13 30-Dec-99 2 1 5 8 6 0 Yes Plist 4.070 13.025 23.608 29.307 29.307 29.307 29.307 1634PoA0444 9MKULPB3302M4J20WN7T3P2G9TU494 10010 Asia & Pacific Southern Asia India India Registered EE industry EE industry Iron & steel AMS-II.D. 1 0.6 28-Mar-13 28 0.000 5.600 CTI 0.000 n.a. n.a. 3-Dec-13 PoA0436 25-Apr-14 22-Dec-14 20-Feb-15 22-Dec-14 CPA 30-Dec-99PoA 1 5 7 8 11 0 0.0 Plist1635CPA0444.01 10010-001 Efficiency Improvements at Sachdeva Steel Products: CPA 001 Asia & Pacific Southern Asia India Gujarat Registered EE industry EE industry Iron & steel AMS-II.D. 1 0.6 10 30 0.0 1-Apr-14 0.000 5.600 CTI n.a. n.a. 3-Dec-13 CPA0436.0001 22-Dec-14 30-Dec-99 1 5 7 8 11 0 No Plist 0.590 0.590 0.590 0.590 0.590 0.590 0.590 0.590 0.590 0.590

1636PoA0445 CKG0XTVO5BVBIDTH2KED37JDTD1WOR 10337 Queiroz Galvão Energias Renováveis Wind Power Programme Latin America South America Brazil Brazil Ambio Participacoes Ltda. Registered Wind Wind Wind ACM2 1 46.4 21-Oct-11 28 0.000 181.759 LRQA 0.000 n.a. n.a. 31-Jan-17 28-Sep-16 21-Dec-16 31-Jan-17 CPA 30-Dec-99PoA 10 5 9 0 29.71637CPA0445.01 10337-0001 Ilha Grande Wind Farm project Latin America South America Brazil Ceará Ambio Participacoes Ltda. Registered Wind Wind Wind ACM2 1 46.4 7 20 0.0 31-Jan-17 0.000 181.759 LRQA n.a. n.a. 31-Jan-17 31-Jan-17 30-Dec-99 10 5 9 0 29.7 105800 No N/A 46.393 46.393 46.393 46.393 46.393 46.393 46.393

1638PoA0446 P1YMBTMTSM58FRTC2YZ85QJMAP0E9D 9977 West African Biodigester Programme of Activities Africa West Africa Burkina Faso Benin, Cameroon Registered EE households EE households Biogas from MSW AMS-I.E. 1 22.6 29-Aug-13 28 0.000 165.715 Carbon Check 24.472 24.472 1 n.a. n.a. 18-Dec-13 PoA0443 15-Jan-14 24-Jun-14 8-Aug-14 24-Jun-14 PoA 30-Dec-99CPA 2 1 5 8 6 0 0.0 Plist

1639CPA0446.01 9977-0001 National Biodigester Programme Burkina Faso – CPA01 (PNB-BF-CPA01) Africa West Africa Burkina Faso Benin, Cameroon Burkina Faso Entire country Registered EE households EE households Biogas from MSW AMS-I.E. 1 22.6 7 4.1 29-Aug-13 0.000 165.715 Carbon Check 24.472 24.472 1 27-Feb-18 31-Dec-16 n.a. n.a. 18-Dec-13 CPA0443.0001 24-Jun-14 30-Dec-99 2 1 5 8 6 0 No Plist 4.070 13.025 23.608 29.307 29.307 29.307 29.307 1640PoA0447 A8MGEL2OLVFTPZ0Z5ZIEMAFOTFZJ8I 10082 Secure Safe Water in Developing Countries Africa East Africa Uganda Uganda Whave Solutions Limited Registered EE service EE households Water purification AMS-III.AV. 1 36.3 18-Jun-13 28 0.000 254.480 BV Cert 0.000 n.a. n.a. 7-Jan-14 20-Oct-14 25-Mar-15 14-May-15 19-Dec-14 CPA 30-Dec-99CPA 4 6 1 9 5 3 0.01641CPA0447.01 10082-0001 Ground Water Extraction Filtration Systems in Uganda - CPA 001 Africa East Africa Uganda Entire country Whave Solutions Limited Registered EE service EE households Water purification AMS-III.AV. 1 36.3 7 30 8.8 1-Jan-14 0.000 254.480 BV Cert n.a. n.a. 7-Jan-14 19-Dec-14 30-Dec-99 4 6 1 9 5 3 Yes 10.451 20.901 31.352 41.803 52.253 59.569 59.569

1642PoA0448 3XOCBOQEJILPUB21NN0WSUZBABYN9W Asia & Pacific Southern Asia Nepal Nepal Validation Terminated EE households EE households Stoves AMS-II.G. 1 43.2 20-Dec-13 28 0.000 284.647 JQA 0.000 n.a. n.a. 16-Jan-14 PoA 30-Dec-99PoA 4 8 1 5 12 0 0.01643CPA0448.01 CPA 001 Asia & Pacific Southern Asia Nepal Rolpa District Validation Terminated EE households EE households Stoves AMS-II.G. 1 43.2 7 21 0.0 1-Jun-14 0.000 284.647 JQA n.a. n.a. 16-Jan-14 30-Dec-99 4 8 1 5 12 0 No 21.600 43.200 43.200 43.200 43.200 43.200 43.200 21.600 1644PoA0449 E6IB5VSYQIRALMN4NV1Z288S68XFZ4 9981 Domestic Cooking Stoves substitution programme in Mozambique Africa East Africa Mozambique Mozambique Fondazione AVSI Registered EE households EE households Stoves AMS-II.G. 3 93.4 20-Jan-14 28 0.000 464.367 DNV 0.000 Italy (CarbonSinkGroup+Cloros), Sweden (NEFCO) n.a. 22-Jan-14 14-Feb-14 17-Oct-14 17-Oct-14 PoA 30-Dec-99CPA 1 9 4 5 6 8 0 0.0 Plist Yes1645CPA0449.01 9981-0001 Domestic Cooking Stoves in Maputo (Mozambique) Africa East Africa Mozambique Maputo Fondazione AVSI Registered EE households EE households Stoves AMS-II.G. 1 28.4 7 21 1.3 1-Nov-14 0.000 175.249 DNV Italy (CarbonSinkGroup+Cloros), Sweden (NEFCO) n.a. 22-Jan-14 17-Oct-14 30-Dec-99 1 9 4 5 6 8 0 No Plist Yes 0.189 15.160 31.790 32.228 32.228 32.228 32.228 26.857

1646CPA0449.02 9981-0002 Domestic cookstoves in Maputo (Mozambique), phase II Africa East Africa Mozambique Maputo Fondazione AVSI Registered EE households EE households Stoves AMS-II.G. 1 38.5 7 21 12-Jul-16 0.000 172.302 DNV Italy (CarbonSinkGroup+Cloros), Sweden (NEFCO) n.a. 22-Jan-14 12-Jul-16 30-Dec-99 1 9 4 5 6 8 0 No 10.729 39.171 39.942 39.942 39.942 39.942 39.942 19.971

1647CPA0449.03 9981-0003 Improved Cookstoves in Pemba Africa East Africa Mozambique Cabo Delgado Fondazione AVSI Registered EE households EE households Stoves AMS-II.G. 1 26.4 7 21 1-Aug-16 0.000 116.817 DNV Italy (CarbonSinkGroup+Cloros), Sweden (NEFCO) n.a. 22-Jan-14 1-Aug-16 30-Dec-99 1 9 4 5 6 8 0 No 3.416 25.494 28.387 28.387 28.387 28.387 28.387 14.194

1648PoA0450 3PUVISPZUYI57FVE40JRADONEU7R5G 10203 Africa East Africa Mozambique Mozambique Fundo de Energia (FUNAE) Registered Mixed renewables Mixed renewables Solar & Hydro AMS-I.L. 1 16.4 8-Feb-14 28 0.000 76.517 SGS 0.000 n.a. n.a. 8-Feb-14 4-Feb-14n.a. 16-Jul-16 5-May-16 PoA 30-Dec-99PoA 8 6 11 3 0.0 MSC

1649CPA0450.01 10203-0001 Africa East Africa Mozambique Entire country Fundo de Energia (FUNAE) Registered Mixed renewables Mixed renewables Solar & Hydro AMS-I.L. 1 16.4 7 20 3.3 5-May-16 0.000 76.517 SGS n.a. n.a. 8-Feb-14 5-May-16 30-Dec-99 8 6 11 3 Yes MSC 4.609 9.219 13.828 18.437 23.047 23.047 23.047

1650PoA0451 PC01M3KDKFZNXLPE1VO319OXCFT980 10053 Empowering DRC communities through the use of Improved Cook Stoves Africa Central Africa Congo DR Registered EE households EE households Stoves AMS-II.G. 2 86.7 7-Feb-14 28 0.000 475.780 Carbon Check 0.000 n.a. n.a. 12-Feb-14 18-Sep-14 17-Oct-14 15-Nov-14 17-Oct-14 PoA 30-Dec-99PoA Gold Standard 4 1 8 10 6 0 0.01651CPA0451.01 10053-0001 Africa Central Africa Congo DR South Kivu Registered EE households EE households Stoves AMS-II.G. 1 42.6 7 21 7.3 1-Jul-14 0.000 277.185 Carbon Check n.a. n.a. 12-Feb-14 17-Oct-14 30-Dec-99 4 1 8 10 6 0 No 2.125 9.428 16.731 24.034 31.337 38.640 45.940

1652CPA0451.02 10053-0002 Africa Central Africa Congo DR Kinshasa Registered EE households EE households Stoves AMS-II.G. 1 44.1 7 21 1-Jul-16 0.000 198.595 Carbon Check n.a. 12-Feb-14 13-Jun-16 30-Dec-99 4 1 8 10 6 0 No 7.842 39.059 47.589 47.589 47.589 47.589 47.589 23.795

1653PoA0452 97VY4TYOVDSC3TDCQP09BW9LOLRL7V 10182 Biomass Energy Conservation Programme Africa East Africa Malawi Rwanda Malawi Hestian Ltd. Registered EE households EE households Stoves AMS-II.G. 25 975.4 15-Feb-14 28 0.000 3,623.596 TÜV-Nord 55.031 TÜV-NORD Norway (Norwegian Ministry of Finance) n.a. 15-Feb-14 1-Apr-15 13-Aug-15 14-Nov-15 13-Aug-15 PoA 30-Dec-99CPA 4 1 6 9 0 0.0 Plist Yes

1654CPA0452.01 10182-0001 Malawi Biomass Energy Conservation Programme CPA 1 Africa East Africa Malawi Entire country Hestian Ltd. Registered EE households EE households Stoves AMS-II.G. 1 39.8 7 21 0.0 15-Feb-14 0.000 273.603 TÜV-Nord 42.523 42.523 27-Dec-17 31-Jan-17 TÜV-NORD Norway (Norwegian Ministry of Finance) n.a. 15-Feb-14 13-Aug-15 30-Dec-99 4 1 6 9 0 No Plist Yes 21.415 42.830 42.830 42.830 42.830 42.830 42.830

1655CPA0452.02 10182-0002 Malawi Biomass Energy Conservation Programme CPA 2 Africa East Africa Malawi Entire country Hestian Ltd. Registered EE households EE households Stoves AMS-II.G. 1 39.8 7 21 0.0 21-Sep-16 0.000 170.198 TÜV-Nord 8.775 8.775 27-Dec-17 31-Jan-17 TÜV-NORD n.a. 15-Feb-14 15-Oct-16 30-Dec-99 4 1 6 9 0 No Plist Yes 21.415 42.830 42.830 42.830 42.830 42.830 42.830

1656CPA0452.03 10182-0003 Malawi Biomass Energy Conservation Programme CPA 3 Africa East Africa Malawi Entire country Hestian Ltd. Registered EE households EE households Stoves AMS-II.G. 1 39.8 7 21 0.0 21-Sep-16 0.000 170.198 TÜV-Nord 1.069 1.069 27-Dec-17 31-Jan-17 TÜV-NORD n.a. 15-Feb-14 15-Oct-16 30-Dec-99 4 1 6 9 0 No Plist Yes 21.415 42.830 42.830 42.830 42.830 42.830 42.830

1657CPA0452.04 10182-0004 Malawi Biomass Energy Conservation Programme CPA 4 Africa East Africa Malawi Entire country Hestian Ltd. Registered EE households EE households Stoves AMS-II.G. 1 39.8 7 21 0.0 21-Sep-16 0.000 170.198 TÜV-Nord 2.664 2.664 27-Dec-17 31-Jan-17 TÜV-NORD n.a. 15-Feb-14 15-Oct-16 30-Dec-99 4 1 6 9 0 No Plist Yes 21.415 42.830 42.830 42.830 42.830 42.830 42.830

1658CPA0452.05 10182-0005 Malawi Biomass Energy Conservation Programme CPA 5 Africa East Africa Malawi Entire country Hestian Ltd. Registered EE households EE households Stoves AMS-II.G. 1 39.8 7 21 0.0 21-Sep-16 0.000 170.198 TÜV-Nord n.a. 15-Feb-14 15-Oct-16 30-Dec-99 4 1 6 9 0 No Plist Yes 21.415 42.830 42.830 42.830 42.830 42.830 42.830

1659CPA0452.06 10182-0006 Malawi Biomass Energy Conservation Programme CPA 6 Africa East Africa Malawi Entire country Hestian Ltd. Registered EE households EE households Stoves AMS-II.G. 1 39.8 7 21 0.0 21-Sep-16 0.000 170.198 TÜV-Nord n.a. 15-Feb-14 15-Oct-16 30-Dec-99 4 1 6 9 0 No Plist Yes 21.415 42.830 42.830 42.830 42.830 42.830 42.830

1660CPA0452.07 10182-0007 Malawi Biomass Energy Conservation Programme CPA 13 Africa East Africa Malawi Entire country Hestian Ltd. Registered EE households EE households Stoves AMS-II.G. 1 38.8 7 21 0.0 11-Aug-17 0.000 131.526 TÜV-Nord n.a. 15-Feb-14 11-Aug-17 30-Dec-99 4 1 6 9 0 No Plist Yes 20.880 41.761 41.761 41.761 41.761 41.761 41.761

1661CPA0452.08 10182-0008 Malawi Biomass Energy Conservation Programme CPA 15 Africa East Africa Malawi Entire country Hestian Ltd. Registered EE households EE households Stoves AMS-II.G. 1 38.8 7 21 0.0 11-Aug-17 0.000 131.526 TÜV-Nord n.a. 15-Feb-14 11-Aug-17 30-Dec-99 4 1 6 9 0 No Plist Yes 20.880 41.761 41.761 41.761 41.761 41.761 41.761

1662CPA0452.09 10182-0009 Malawi Biomass Energy Conservation Programme CPA 14 Africa East Africa Malawi Entire country Hestian Ltd. Registered EE households EE households Stoves AMS-II.G. 1 38.8 7 21 0.0 11-Aug-17 0.000 131.526 TÜV-Nord n.a. 15-Feb-14 11-Aug-17 30-Dec-99 4 1 6 9 0 No Plist Yes 20.880 41.761 41.761 41.761 41.761 41.761 41.761

1663CPA0452.10 10182-0010 Malawi Biomass Energy Conservation Programme CPA 16 Africa East Africa Malawi Entire country Hestian Ltd. Registered EE households EE households Stoves AMS-II.G. 1 38.8 7 21 0.0 11-Aug-17 0.000 131.526 TÜV-Nord n.a. 15-Feb-14 11-Aug-17 30-Dec-99 4 1 6 9 0 No Plist Yes 20.880 41.761 41.761 41.761 41.761 41.761 41.761

1664CPA0452.11 10182-0011 Malawi Biomass Energy Conservation Programme CPA 17 Africa East Africa Malawi Entire country Hestian Ltd. Registered EE households EE households Stoves AMS-II.G. 1 38.8 7 21 0.0 11-Aug-17 0.000 131.526 TÜV-Nord n.a. 15-Feb-14 11-Aug-17 30-Dec-99 4 1 6 9 0 No Plist Yes 20.880 41.761 41.761 41.761 41.761 41.761 41.761

1665CPA0452.12 10182-0012 Malawi Biomass Energy Conservation Programme CPA 18 Africa East Africa Malawi Entire country Hestian Ltd. Registered EE households EE households Stoves AMS-II.G. 1 38.8 7 21 0.0 11-Aug-17 0.000 131.526 TÜV-Nord n.a. 15-Feb-14 11-Aug-17 30-Dec-99 4 1 6 9 0 No Plist Yes 20.880 41.761 41.761 41.761 41.761 41.761 41.761

1666CPA0452.13 10182-0013 Malawi Biomass Energy Conservation Programme CPA 19 Africa East Africa Malawi Entire country Hestian Ltd. Registered EE households EE households Stoves AMS-II.G. 1 38.8 7 21 0.0 11-Aug-17 0.000 131.526 TÜV-Nord n.a. 15-Feb-14 11-Aug-17 30-Dec-99 4 1 6 9 0 No Plist Yes 20.880 41.761 41.761 41.761 41.761 41.761 41.761

1667CPA0452.14 10182-0014 Malawi Biomass Energy Conservation Programme CPA 20 Africa East Africa Malawi Entire country Hestian Ltd. Registered EE households EE households Stoves AMS-II.G. 1 38.8 7 21 0.0 11-Aug-17 0.000 131.526 TÜV-Nord n.a. 15-Feb-14 11-Aug-17 30-Dec-99 4 1 6 9 0 No Plist Yes 20.880 41.761 41.761 41.761 41.761 41.761 41.761

1668CPA0452.15 10182-0015 Malawi Biomass Energy Conservation Programme CPA 21 Africa East Africa Malawi Entire country Hestian Ltd. Registered EE households EE households Stoves AMS-II.G. 1 38.8 7 21 0.0 11-Aug-17 0.000 131.526 TÜV-Nord n.a. 15-Feb-14 11-Aug-17 30-Dec-99 4 1 6 9 0 No Plist Yes 20.880 41.761 41.761 41.761 41.761 41.761 41.761

1669CPA0452.16 10182-0016 Malawi Biomass Energy Conservation Programme CPA 22 Africa East Africa Malawi Entire country Hestian Ltd. Registered EE households EE households Stoves AMS-II.G. 1 38.8 7 21 0.0 11-Aug-17 0.000 131.526 TÜV-Nord n.a. 15-Feb-14 11-Aug-17 30-Dec-99 4 1 6 9 0 No Plist Yes 20.880 41.761 41.761 41.761 41.761 41.761 41.761

1670CPA0452.17 10182-0017 Malawi Biomass Energy Conservation Programme CPA 23 Africa East Africa Malawi Entire country Hestian Ltd. Registered EE households EE households Stoves AMS-II.G. 1 38.8 7 21 0.0 11-Aug-17 0.000 131.526 TÜV-Nord n.a. 15-Feb-14 11-Aug-17 30-Dec-99 4 1 6 9 0 No Plist Yes 20.880 41.761 41.761 41.761 41.761 41.761 41.761

1671CPA0452.18 10182-0018 Malawi Biomass Energy Conservation Programme CPA 24 Africa East Africa Malawi Entire country Hestian Ltd. Registered EE households EE households Stoves AMS-II.G. 1 38.8 7 21 0.0 11-Aug-17 0.000 131.526 TÜV-Nord n.a. 15-Feb-14 11-Aug-17 30-Dec-99 4 1 6 9 0 No Plist Yes 20.880 41.761 41.761 41.761 41.761 41.761 41.761

1672CPA0452.19 10182-0019 Malawi Biomass Energy Conservation Programme CPA 25 Africa East Africa Malawi Entire country Hestian Ltd. Registered EE households EE households Stoves AMS-II.G. 1 38.8 7 21 0.0 11-Aug-17 0.000 131.526 TÜV-Nord n.a. 15-Feb-14 11-Aug-17 30-Dec-99 4 1 6 9 0 No Plist Yes 20.880 41.761 41.761 41.761 41.761 41.761 41.761

1673CPA0452.20 10182-0020 Malawi Biomass Energy Conservation Programme CPA 8 Africa East Africa Malawi Entire country Hestian Ltd. Registered EE households EE households Stoves AMS-II.G. 1 38.8 7 21 0.0 11-Aug-17 0.000 131.526 TÜV-Nord n.a. 15-Feb-14 11-Aug-17 30-Dec-99 4 1 6 9 0 No Plist Yes 20.880 41.761 41.761 41.761 41.761 41.761 41.761

1674CPA0452.21 10182-0021 Malawi Biomass Energy Conservation Programme CPA 9 Africa East Africa Malawi Entire country Hestian Ltd. Registered EE households EE households Stoves AMS-II.G. 1 38.8 7 21 0.0 11-Aug-17 0.000 131.526 TÜV-Nord n.a. 15-Feb-14 11-Aug-17 30-Dec-99 4 1 6 9 0 No Plist Yes 20.880 41.761 41.761 41.761 41.761 41.761 41.761

1675CPA0452.22 10182-0022 Malawi Biomass Energy Conservation Programme CPA 10 Africa East Africa Malawi Entire country Hestian Ltd. Registered EE households EE households Stoves AMS-II.G. 1 38.8 7 21 0.0 11-Aug-17 0.000 131.526 TÜV-Nord n.a. 15-Feb-14 11-Aug-17 30-Dec-99 4 1 6 9 0 No Plist Yes 20.880 41.761 41.761 41.761 41.761 41.761 41.761

1676CPA0452.23 10182-0023 Malawi Biomass Energy Conservation Programme CPA 11 Africa East Africa Malawi Entire country Hestian Ltd. Registered EE households EE households Stoves AMS-II.G. 1 38.8 7 21 0.0 11-Aug-17 0.000 131.526 TÜV-Nord n.a. 15-Feb-14 11-Aug-17 30-Dec-99 4 1 6 9 0 No Plist Yes 20.880 41.761 41.761 41.761 41.761 41.761 41.761

1677CPA0452.24 10182-0024 Malawi Biomass Energy Conservation Programme CPA 12 Africa East Africa Malawi Entire country Hestian Ltd. Registered EE households EE households Stoves AMS-II.G. 1 38.8 7 21 0.0 11-Aug-17 0.000 131.526 TÜV-Nord n.a. 15-Feb-14 11-Aug-17 30-Dec-99 4 1 6 9 0 No Plist Yes 20.880 41.761 41.761 41.761 41.761 41.761 41.761

1678CPA0452.25 10182-0025 Malawi Biomass Energy Conservation Programme CPA 7 Africa East Africa Malawi Entire country Hestian Ltd. Registered EE households EE households Stoves AMS-II.G. 1 38.8 7 21 0.0 11-Aug-17 0.000 131.526 TÜV-Nord n.a. 15-Feb-14 11-Aug-17 30-Dec-99 4 1 6 9 0 No Plist Yes 20.880 41.761 41.761 41.761 41.761 41.761 41.761

1679PoA0453 JE5F87CN33FCNOX1QFFG0EZ4Y0C2G7 Programme of Activities for Small Scale Biomass Power CDM in Sri Lanka Asia & Pacific Southern Asia Sri Lanka Sri Lanka Sri Lanka Carbon Fund (SLCF) At Validation Biomass energy Biomass energy Forest residues: other AMS-I.D. 1 25.8 20-Feb-14 28 0.000 128.841 TÜV-Nord 0.000 n.a. n.a. 21-Feb-14 CPA 30-Dec-99CPA 10 5 8 9 0 5.0 MSC

1680CPA0453.01 Asia & Pacific Southern Asia Sri Lanka Monaragala District Sri Lanka Carbon Fund (SLCF) At Validation Biomass energy Biomass energy Forest residues: other AMS-I.D. 1 25.8 7 20 0.0 1-Jan-16 0.000 128.841 TÜV-Nord n.a. n.a. 21-Feb-14 30-Dec-99 10 5 8 9 0 5.0 35040 0.735 No MSC 25.754 25.754 25.754 25.754 25.754 25.754 25.754

1681PoA0454 A9KIAK5VGTYVSBGGQXGRWK4196MTFG 10096 Asia & Pacific Southern Asia Bangladesh Bangladesh Registered Methane avoidance Methane avoidance Composting AMS-III.F. 1 7.0 20-Mar-14 28 0.000 69.780 DNV 0.000 n.a. n.a. 20-Mar-14 16-Mar-14 5-Jan-15 17-Mar-15 5-Jan-15 CPA 30-Dec-99CPA 2 1 9 5 0 0.0 MSC1682CPA0454.01 10096-0001 Asia & Pacific Southern Asia Bangladesh Registered Methane avoidance Methane avoidance Composting AMS-III.F. 1 7.0 10 20 -0.7 1-Oct-14 0.000 69.780 DNV n.a. n.a. 20-Mar-14 5-Jan-15 30-Dec-99 2 1 9 5 0 Yes MSC 0.697 2.910 4.392 5.426 6.146 6.652 7.014 7.278 7.473 7.622

1683PoA0455 4OLCB25Q80TOU822DX5QIAHWXRKGNW Asia & Pacific Southern Asia Sri Lanka Sri Lanka SLCF At Validation Biomass energy Biomass energy Agricultural residues: other kinds AMS-I.C. 1 8.7 31-Mar-14 28 0.000 52.452 TÜV-Nord 0.000 n.a. n.a. 2-Apr-14 CPA 30-Dec-99CPA 10 5 9 2 0 0.0

1684CPA0455.01 Asia & Pacific Southern Asia Sri Lanka Nuwara Eliya District SLCF At Validation Biomass energy Biomass energy Agricultural residues: other kinds AMS-I.C. 1 8.7 7 20 0.0 1-Jan-15 0.000 52.452 TÜV-Nord n.a. n.a. 2-Apr-14 30-Dec-99 10 5 9 2 0 No 8.738 8.738 8.738 8.738 8.738 8.738 8.738

1685PoA0456 RNPFCDC0WUVSWC2ZYKXTAXMWOTZHQV China low-energy commercial buildings programme Asia & Pacific East Asia China China At Validation EE service EE service EE commercial buildings AMS-I.D.+AMS-II.Q. 1 1.7 29-Jan-14 28 0.000 17.180 BV Cert 0.000 n.a. n.a. 8-May-14 CPA 30-Dec-99CPA 5 6 11 3 0.0

1686CPA0456.01 China low-energy commercial buildings programme- CPA #1 Asia & Pacific East Asia China Beijing At Validation EE service EE service EE commercial buildings AMS-I.D.+AMS-II.Q. 1 1.7 10 30 0.0 30-Oct-14 0.000 17.180 BV Cert n.a. n.a. 8-May-14 30-Dec-99 5 6 11 3 1.9 No 1.718 1.718 1.718 1.718 1.718 1.718 1.718 1.718 1.718 1.718

1687PoA0457 1W4KRHVFFA1RIPLD9LFWB3G31S5OCB 10030 Household energy appliance programme Asia & Pacific East Asia Myanmar Timor-Leste Differ Cookstoves AS Registered EE households EE households Appliances 1 137.9 16-May-14 28 0.000 663.934 JQA 0.000 Norway (Brighterlite+Differ) n.a. 16-May-14 12-Nov-15 8-Mar-16 20-May-16 10-Mar-16 PoA 30-Dec-99CPA 1 6 7 5 4 3 0.0

1688CPA0457.01 10030-0001 Household appliance distribution in Timor-Leste Differ-CPA-001 Asia & Pacific East Asia Timor-Leste Timor-Leste Differ Cookstoves AS Registered EE households EE households Appliances 1 137.9 7 21 0.0 10-Mar-16 0.000 663.934 JQA Norway (Brighterlite+Differ) n.a. 16-May-14 10-Mar-16 30-Dec-99 1 6 7 5 4 3 No 137.9 137.9 137.9 137.9 137.9 137.9 137.9

1689PoA0459 OUX5F5L72AS1JQUYYZOYVYUQILG4AX 10175 MPG Geothermal Energy PoA Africa East Africa Kenya Kenya Registered Geothermal Geothermal Geothermal electricity ACM2 1 142.5 23-May-13 28 0.000 591.468 SGS 0.000 n.a. n.a. 5-Jul-14 11-Nov-14 7-Nov-16 31-Dec-16 7-Nov-16 CPA 30-Dec-99PoA 10 9 8 -2 35.0 Yes1690CPA0459.01 10175-0001 Akiira I 35 MW Geothermal Project (CPA 001) Africa East Africa Kenya Rift Valley Province Registered Geothermal Geothermal Geothermal electricity ACM2 1 142.5 7 30 0.0 7-Nov-16 591.468 SGS n.a. n.a. 5-Jul-14 7-Nov-16 30-Dec-99 10 9 8 -2 35.0 298618 0.607 No Yes 142.499 142.499 142.499 142.499 142.499 142.499 142.499 1691PoA0460 SC016Y5SBGMTU1XS6QYRQ8XF7H0QRO 10186 Africa East Africa Uganda Uganda Registered Energy distribution Energy distribution Connection of Isolated grid 2 448.2 12-Aug-14 28 0.000 4,482.450 BV Cert 0.000 Sweden (IBRD) Rural Electrification Agency Uganda 12-Aug-14 25-Aug-14 28-Aug-15 27-Oct-15 28-Aug-15 PoA 30-Dec-99PoA 5 9 8 10 7 6 0 0.0 MSC1692CPA0460.01 10186-0001 Africa East Africa Uganda Registered Energy distribution Energy distribution Connection of Isolated grid 1 64.0 10 20 2.4 28-Aug-15 640.000 BV Cert Sweden (IBRD) Rural Electrification Agency Uganda 12-Aug-14 25-Aug-14 28-Aug-15 27-Oct-15 28-Aug-15 30-Dec-99 5 9 8 10 7 6 0 No MSC 1.375 2.314 4.062 7.389 13.821 15.826 19.463 19.463 19.463 19.463 1693CPA0460.02 10186-0002 Africa East Africa Uganda Entire country Registered Energy distribution Energy distribution Connection of Isolated grid 1 384.2 10 20 2.4 4-May-17 3,842.450 BV Cert Sweden (IBRD) Rural Electrification Agency Uganda 12-Aug-14 25-Aug-14 28-Aug-15 27-Oct-15 4-May-17 30-Dec-99 5 9 8 10 7 6 0 No MSC 37.469 93.877 154.102 221.255 295.335 381.149 485.269 601.269 723.269 848.530 1694PoA0461 IDSORWQ9OTGJTQANF8Z3241EYIOUQG Latin America South America Brazil Brazil Ecometano Empreendimentos At Validation Biomass energy Biomass energy Gasification of biomass AMS-I.E. 1 12.7 21-Oct-13 28 0.000 74.170 RINA 0.000 n.a. EQAO 13-Aug-14 CPA 30-Dec-99PoA 0 0.0 Foik

1695CPA0461.01 UTER RS1 Latin America South America Brazil Rio Grande do Sul Ecometano Empreendimentos At Validation Biomass energy Biomass energy Gasification of biomass AMS-I.E. 1 12.7 7 21 0.0 1-Mar-15 74.170 RINA n.a. EQAO 13-Aug-14 30-Dec-99 No Foik 10.582 12.698 12.698 12.698 12.698 12.698 12.698 2.116 1696PoA0462 71KQB065BOYM4SHSRDQ4QSP5E3Y3NA 10292 Dissemination of improved cook stoves and generation of charcoal Asia & Pacific Southern Asia India India Atmosfair GmbH Registered EE households EE households Stoves 2 192.5 23-May-14 28 0.000 748.963 TÜV-Rhein 0.000 Germany (Atmosfair) n.a. 2-Sep-14 16-Nov-15 20-Jul-16 24-Sep-16 20-Jul-16 PoA 30-Dec-99PoA 4 9 6 1 0 0.01697CPA0462.01 10292-0001 Asia & Pacific Southern Asia India West Bengal Atmosfair GmbH Registered EE households EE households Stoves 1 95.9 7 10 0.0 20-Jul-16 426.885 TÜV-Rhein Germany (Atmosfair) n.a. 2-Sep-14 20-Jul-16 30-Dec-99 4 9 6 1 0 No 100.010 100.010 100.010 100.010 100.010 100.010 100.010

1698CPA0462.02 10292-0002 Dissemination of improved cook stoves and generation of charcoal, CPA2 Asia & Pacific Southern Asia India Assam Atmosfair GmbH Registered EE households EE households Stoves 1 96.6 7 10 0.0 1-Sep-17 0.000 322.078 TÜV-Rhein Germany (Atmosfair) n.a. 2-Sep-14 19-Jul-17 30-Dec-99 4 9 6 1 0 32.262 96.521 96.521 96.521 96.521 96.521 96.521 64.524

1699PoA0463 MH4HJDK7DKCXHETW2QVSXKKXDIBU4T 10289 UAE Small Scale Solar Programme of Activities Middle East Arabian Peninsula United Arab Emirates Registered Solar Solar Solar PV AMS-I.D. 1 1.4 10-Mar-14 28 0.000 6.592 TÜV-Nord 0.000 n.a. n.a. 3-Sep-14 2-Feb-15 11-May-16 8-Jun-16 15-Apr-16 CPA 30-Dec-99CPA 9 5 1 6 0 3.91700CPA0463.01 10289-0001 Solar PV at Dubai International Humanitarian City Middle East Arabian Peninsula United Arab Emirates Dubai Emirate Registered Solar Solar Solar PV AMS-I.D. 1 1.4 7 25 0.0 15-Apr-16 6.592 TÜV-Nord n.a. n.a. 3-Sep-14 15-Apr-16 30-Dec-99 9 5 1 6 0 3.9 5996 0.427 No 1.398 1.398 1.398 1.398 1.398 1.398 1.398 1701PoA0464 ACG70V0UUUPNDPCRJL8KRYLHHSB0CJ 9992 Programme for Promotion of Access to Domestic Biogas in Rural Bangladesh Asia & Pacific Southern Asia Bangladesh Bangladesh Registered Methane avoidance Methane avoidance Domestic manure AMS-I.E. 1 0.7 13-Dec-11 28 4.029 4.195 JQA 0.000 Japan (PEAR Carbon Offset Initiative) PEAR Carbon Offset Initiative 13-Dec-11 PoA0183 31-Jan-13 27-Sep-14 15-Mar-14 18-Jul-14 PoA 30-Dec-99PoA 1 6 4 8 0.0 MSC

1702CPA0464.01 9992-0001 Domestic Biogas CPA-1.12.2011 in Rural Bangladesh (13/12/2011–31/01/2012) Asia & Pacific Southern Asia Bangladesh Dhaka Registered Methane avoidance Methane avoidance Domestic manure AMS-I.E. 1 0.7 7 20 0.0 1-Sep-14 4.029 4.195 JQA Japan (PEAR Carbon Offset Initiative) PEAR Carbon Offset Initiative 13-Dec-11 CPA0183-0001 18-Jul-14 30-Dec-99 1 6 4 8 0 Yes Other MSC 0.221 0.662 0.662 0.662 0.662 0.662 0.662 0.441

1703PoA0465 SXU1LR1U04OTKGP8WPNG9WMYZIYU04 Latin America South America Brazil Brazil At Validation Methane avoidance Methane avoidance Gasification of biomass ACM24 1 1.3 1-Nov-14 28 0.000 5.573 RINA 0.000 n.a. EQAO 15-Oct-14 CPA 30-Dec-99CPA 0 0.0 Other Foik 0.630

1704CPA0465.01 RNG production at Ester sugarcane mill Latin America South America Brazil Southeast Region At Validation Methane avoidance Methane avoidance Gasification of biomass ACM24 1 1.3 7 21 0.0 1-Aug-16 5.573 RINA n.a. EQAO 15-Oct-14 30-Dec-99 0 No Foik 0.630 1.261 1.261 1.261 1.261 1.261 1.261 1705PoA0466 49CTOPGOOGIMRZOF5X0VILKX1OTYC3 10202 Gigawatt Global Programme of Activities Africa East Africa Rwanda Rwanda Gigawatt Global Registered Solar Solar Solar PV ACM2+AMS-I.D. 1 10.1 15-Jan-14 28 0.000 60.514 ERM CVS 12.369 12.369 3-Jan-18 28-Feb-17 AENOR n.a. n.a. 22-Oct-14 23-Jun-15 22-Oct-15 22-Dec-15 23-Oct-15 CPA 30-Dec-99CPA 10 5 9 11 12 0 8.5 Yes1706CPA0466.01 10202-0001 ASYV 8.5MW Solar PV Project (CPA-001) Africa East Africa Rwanda Rwamagana District Gigawatt Global Registered Solar Solar Solar PV ACM2+AMS-I.D. 1 10.1 7 25 -0.1 1-Jan-15 60.514 ERM CVS 12.369 12.369 3-Jan-18 28-Feb-17 AENOR n.a. n.a. 22-Oct-14 23-Oct-15 30-Dec-99 10 5 9 11 12 0 8.5 15275 0.620 No Yes 9.642 9.584 9.526 9.469 9.412 9.356 9.300

1707PoA0467 OX3K0512SQU5LKOQJKYA6R27JVJBK0 Africa West Africa Mali Scatec Solar AS Replaced At Validation Solar Solar Solar PV ACM2 4-Dec-14 28 TÜV-Nord n.a. Scatec Solar 11-Dec-14 4-Dec-15 CPA 30-Dec-99CPA 10 1 5 9 8 0 Yes

1708CPA0476.01 Africa West Africa Mali Segou Scatec Solar ASA Replaced At Validation Solar Solar Solar PV ACM2 1 45.6 10 30 1-Jul-15 455.690 TÜV-Nord n.a. Scatec Solar 22-Oct-15 4-Dec-15 31-Dec-99 10 12 5 9 0 33.0 57000 0.790 Yes 22.785 45.569 45.569 45.569 45.569 45.569 45.569 45.569 45.569 45.569 22.785

1709PoA0468 3M66FY6L03ERDWPD0JZON05UXVD13A Lurio Forest Landscape PoA Africa East Africa Mozambique Mozambique Lurio Green Resources At Validation Afforestation Afforestation Afforestation AR-ACM3 1 231.5 16-Dec-14 60 0.000 2,539.141 TÜV-SÜD 0.000 n.a. Lurio Green Resources 16-Dec-14 PoA 30-Dec-99PoA 2 3 4 5 8 0 0.0 Yes1710CPA0468.01 Lurio Forest CPA 1 Africa East Africa Mozambique Nampula Province Lurio Green Resources At Validation Afforestation Afforestation Afforestation AR-ACM3 1 231.5 20 50 28.2 15-Jan-10 2,539.141 TÜV-SÜD n.a. Lurio Green Resources 16-Dec-14 30-Dec-99 2 3 4 5 8 0 Yes Yes -20.659 5.446 9.933 22.091 66.761 154.138 278.193 369.131 493.626 718.071 625.018 -132.476 -583.465 -540.829 -709.894 544.098 709.675 934.438 999.993 660.165

1711PoA0469 5YTH7MV4S4P4W0Y2RPEGIUWJT1V7EG 10268 Ethiopia – Clean Cooking Energy Program Africa East Africa Ethiopia Ethiopia Registered Biomass energy Biomass energy Gasification of biomass 2 93.8 23-Dec-14 28 0.000 370.799 AENOR 0.000 Sweden (IBRD) WB-CF 24-Dec-14 16-Nov-15 18-Mar-16 20-May-16 18-Mar-16 PoA 30-Dec-99PoA 1 4 6 8 0 0.01712CPA0469.01 10268-0001 NBP Ethiopia Domestic Biogas Plants CPA 1 Africa East Africa Ethiopia Entire country Registered Biomass energy Biomass energy Gasification of biomass 1 23.6 7 21 0.0 18-Mar-16 112.990 AENOR Sweden (IBRD) WB-CF 24-Dec-14 18-Mar-16 30-Dec-99 1 4 6 8 0 Yes 23.580 23.580 23.580 23.580 23.580 23.580 23.580 1713CPA0469.02 10268-0002 NBP Ethiopia Domestic Biogas Plants CPA 2 Africa East Africa Ethiopia Entire country Registered Biomass energy Biomass energy Gasification of biomass 1 70.2 7 21 0.0 1-May-17 257.809 AENOR Sweden (IBRD) WB-CF 24-Dec-14 25-Apr-17 30-Dec-99 1 4 6 8 0 Yes 16.283 75.045 75.045 75.045 75.045 75.045 75.045 25.015 1714PoA0470 8EO72C1R37OE3DBKH86Z80WEMU854S 10285 Ethiopia Off-Grid Renewable Energy Program Africa East Africa Ethiopia Ethiopia Registered Solar EE households Solar lamps 3 63.3 23-Dec-14 28 0.000 4,060.653 AENOR 0.000 Sweden (IBRD) WB-CF 24-Dec-14 16-Nov-15 11-Apr-16 1-Sep-16 1-Jul-16 PoA 30-Dec-99PoA 8 9 1 7 0 0.01715CPA0470.01 10285-0001 DBE Off-grid renewable energy solar lamps 01/01/2015 – 31/12/2015 Africa East Africa Ethiopia Entire country Registered Solar EE households Solar lamps 1 17.7 7 21 -3.5 1-Jul-16 79.916 AENOR Sweden (IBRD) WB-CF 24-Dec-14 1-Jul-16 30-Dec-99 8 9 1 7 0 Yes 36.800 36.800 31.280 25.760 25.760 25.760 12.880 1716CPA0470.02 10285-0002 DBE Off-grid renewable energy solar home system CPA 1 Africa East Africa Ethiopia Entire country Registered Solar EE households Solar lamps 1 13.0 7 21 30-Nov-17 40.149 AENOR Sweden (IBRD) WB-CF 24-Dec-14 30-Nov-17 30-Dec-99 8 9 1 7 0 Yes 4.335 13.003 13.003 13.003 13.003 13.003 13.003 8.669

1717CPA0470.03 10285-0003 DBE Off-grid renewable energy solar lamps CPA 2 Africa East Africa Ethiopia Entire country Registered Solar EE households Solar lamps 1 32.5 7 21 3,940.588 AENOR Sweden (IBRD) WB-CF 24-Dec-14 1-Feb-18 30-Dec-99 8 9 1 7 0 Yes 20.900 41.800 41.800 35.530 29.260 29.260 29.260

1718PoA0471 L5GGNTK8TQ95UOCJFMQJQ2JAWS0BYI 10266 Asia & Pacific Southeast Asia Cambodia Cambodia Nexus Carbon for Development Registered Biomass energy Biomass energy Agricultural residues: rice husk 1 0.5 30-Sep-13 28 0.000 5.490 TÜV-Rhein 0.000 n.a. Nexus Carbon 6-Jan-15 29-Feb-16 14-Mar-16 20-May-16 14-Mar-16 CPA 30-Dec-99CPA 1 2 10 9 5 0 0.4

1719CPA0471.01 10266-0001 Asia & Pacific Southeast Asia Cambodia Takeo Province Nexus Carbon for Development Registered Biomass energy Biomass energy Agricultural residues: rice husk 1 0.5 10 10 0.0 14-Mar-16 5.490 TÜV-Rhein n.a. Nexus Carbon 6-Jan-15 30-Dec-99 1 2 10 9 5 0 0.4 Yes 0.3 0.5 0.5 0.5 0.5 0.5 0.5 0.3

1720PoA0472 74QG5YTWARI47CCQQ19G624BXVJIVN Renewable Energy Rural Electrification (RERE) Programme Africa West Africa Cameroon Cameroon Replaced At Validation Mixed renewables Mixed renewables Mixed renewables AMS-I.L. 1-Jan-16 28 Carbon Check n.a. S2 Services 26-May-15 24-Oct-15 CPA 30-Dec-99PoA 5 6 7 9 8 10 31721CPA0472.01 Renewable Energy Rural Electrification (RERE) Programme CPA-001 Africa West Africa Cameroon Southwest Replaced At Validation Hydro Hydro Existing dam 1 MW run of river plant AMS-I.L. 1 71.3 10 10 0.0 30-Jun-16 712.800 Carbon Check n.a. S2 Services 26-May-15 24-Oct-15 30-Dec-99 5 6 7 9 8 10 3 7.128 7.128 7.128 7.128 7.128 7.128 7.128 7.128 1722PoA0473 6NDI8LJFFX11LQG5UVUXYPR33L2VEF Africa West Africa Côte d'Ivoire Côte d’Ivoire ENERCAP SAS At Validation Solar EE households Solar lamps AMS-III.AR. 1 59.8 2-Jul-15 28 0.000 598.000 Carbon Check 0.000 n.a. ENERCAP 3-Jul-15 Both 30-Dec-99CPA 1 6 8 11 0 0.0

1723CPA0473.01 Africa West Africa Côte d'Ivoire West ENERCAP SAS At Validation Solar EE households Solar lamps AMS-III.AR. 1 59.8 10 2 0.0 1-Jan-16 598.000 Carbon Check n.a. ENERCAP 3-Jul-15 30-Dec-99 1 6 8 11 0 No 59.800 59.800 59.800

1724PoA0474 XU6GL6ZBELKPIQ2E0LEDJ2KPBIE725 Africa East Africa Uganda Uganda RuMeth International At Validation Methane avoidance Methane avoidance Manure AMS-III.BK. 4 23.6 1-Jan-16 28 0.000 118.240 BV Cert 0.000 n.a. Carbonomics 19-Aug-15 PoA 30-Dec-99PoA 1 8 3 0.0

1725CPA0474.01 Dairy Feed Improvement Uganda, Gulu Project Africa East Africa Uganda RuMeth International At Validation Methane avoidance Methane avoidance Manure AMS-III.BK. 4 23.6 7 7.1 1-Jan-16 118.240 BV Cert n.a. Carbonomics 19-Aug-15 30-Dec-99 1 8 3 No 2.254 6.740 13.451 22.414 33.634 44.865 44.865 1726PoA0475 SBAFBKMIDXYP0C36RZKR58EIIIOI35 10307 Small Hydro Power Programme of Activities in Iran Middle East Southern Asia Iran Iran Registered Hydro Hydro Run of river AMS-I.D. 4 83.5 16-Feb-15 28 0.000 313.509 Carbon Check 0.000 n.a. Mehr renewable energies 7-Oct-15 26-Sep-15 26-Dec-16 20-Sep-16 CPA 30-Dec-99CPA 10 5 9 0 24.5

1727CPA0475.01 10307-0001 Absardeh Small Scale Hydro Power Middle East Southern Asia Iran Tehran Registered Hydro Hydro Run of river AMS-I.D. 1 6.9 7 1-Apr-17 25.906 Carbon Check n.a. Mehr renewable energies 7-Oct-15 9-Mar-17 30-Dec-99 10 5 9 0 2.3 0.6909 No 6.902 6.902 6.902 6.902 6.902 6.902 6.902 1728CPA0475.02 10307-0002 Azizabad Small Scale Hydro Power Middle East Southern Asia Iran Registered Hydro Hydro Run of river AMS-I.D. 1 22.6 7 1-Apr-17 84.951 Carbon Check n.a. Mehr renewable energies 7-Oct-15 9-Mar-17 30-Dec-99 10 5 9 0 5.6 32760 0.6909 No 22.633 22.633 22.633 22.633 22.633 22.633 22.633 1729CPA0475.03 10307-0003 Doplan Small Scale Hydro Power Middle East Southern Asia Iran Registered Hydro Hydro Run of river AMS-I.D. 1 41.9 7 1-Apr-17 157.272 Carbon Check n.a. Mehr renewable energies 7-Oct-15 9-Mar-17 30-Dec-99 10 5 9 0 12.0 60650 0.6909 No 41.901 41.901 41.901 41.901 41.901 41.901 41.901 1730CPA0475.04 10307-0004 Solehdokal Small Scale Hydro Power Middle East Southern Asia Iran West Azarbaiian Registered Hydro Hydro Run of river AMS-I.D. 1 12.1 7 1-Apr-17 45.379 Carbon Check n.a. Mehr renewable energies 7-Oct-15 9-Mar-17 30-Dec-99 10 5 9 0 4.6 17500 0.6909 No 12.1 12.1 12.1 12.1 12.1 12.1 12.1 1731PoA0476 SHND6Q0XLHEF251RLTC74MUG02T1VB Scaling-Up Solar Photovoltaic Power Generation Africa West Africa Mali Scatec Solar ASA Replaced At Validation Solar Solar Solar PV ACM2 4-Dec-14 28 TÜV-Nord n.a. Scatec Solar 22-Oct-15 4-Dec-15 CPA 30-Dec-99CPA 10 12 5 9 01732CPA0476.01 Scaling-Up Solar Photovoltaic Power Generation Africa West Africa Mali Segou Scatec Solar ASA Replaced At Validation Solar Solar Solar PV ACM2 1 45.6 10 30 1-Jul-15 455.690 TÜV-Nord n.a. Scatec Solar 22-Oct-15 4-Dec-15 31-Dec-99 10 12 5 9 0 33.0 57000 0.790 Yes 22.785 45.569 45.569 45.569 45.569 45.569 45.569 45.569 45.569 45.569 22.785

1733PoA0477 4WNFT5SJZ60Y1Q2TXHUN633E1RZUMW 10322 Renewable Energy Rural Electrification (RERE) Programme Africa Central Africa Cameroon Cameroon Registered Hybrid renewables Hybrid renewables Solar PV AMS-I.L. 1 1.3 1-Jan-16 28 0.000 13.470 Carbon Check 0.000 n.a. S2 Services 24-Oct-15 PoA0472 4-Dec-15 14-Sep-16 4-Nov-16 14-Sep-16 CPA 30-Dec-99PoA 10 9 0 1.0 Yes1734CPA0477.01 10322-0001 Renewable Energy Rural Electrification (RERE) Programme CPA-001 Africa Central Africa Cameroon Southwest Registered Solar Solar Solar PV AMS-I.L. 1 1.3 10 20 14-Sep-16 13.470 Carbon Check n.a. S2 Services 24-Oct-15 CPA0472.01 14-Sep-16 30-Dec-99 10 9 0 1.0 2100 0.800 No Yes 1.347 1.347 1.347 1.347 1.347 1.347 1.347 1.347 1.347 1.347 1735PoA0478 0KWS1YQMFXLUMHLZPC52PRKJ1P1RAM Biomass Briquette usage for energy use in Zambia Africa Southern Africa Zambia Zambia EOTF Energy At Validation Biomass energy Biomass energy Biomass briquettes AMS-I.C.+AMS.I.E. 1 12.2 25-Nov-15 28 0.000 60.233 EPIC 0.000 n.a. EOTF Energy 21-Nov-15 PoA 30-Dec-99PoA 5 2 4 8 11 0 0.0 Yes1736CPA0478.01 Biomass Briquette usage for energy use in Zambia Africa Southern Africa Zambia Copperbelt Province EOTF Energy At Validation Biomass energy Biomass energy Biomass briquettes AMS-I.C.+AMS.I.E. 1 12.2 7 1-Feb-16 60.233 EPIC n.a. EOTF Energy 21-Nov-15 30-Dec-99 5 2 4 8 11 0 No Yes 12.248 12.248 12.248 12.248 12.248 12.248 12.248

1737PoA0479 N285VUBOBO8I1VUDV813EBUWI1SQHI 10286 Brazilian PoA for NAMA incentivized NCRE Projects Latin America South America Brazil Brazil Energia S.A. Registered Solar & wind Wind & Solar Wind & Solar ACM2 5 1317.4 5-May-14 28 0.0 3,344.307 TÜV-Rhein 0.000 n.a. Tractebel Engineering 27-Nov-15 13-Oct-16 25-Aug-16 04-Nov-16 18-Sep-16 CPA 30-Dec-99PoA 10 9 8 11 0 671.91738CPA0479.01 10286-0001 Santa Mónica Wind Complex Latin America South America Brazil Ceará State Energia S.A. Registered Wind Wind Wind ACM2 1 211.9 7 18-Sep-16 908.450 TÜV-Rhein n.a. Tractebel Engineering 27-Nov-15 18-Sep-16 31-Dec-99 10 9 8 11 0 97.2 414 0.512 No 211.875 211.875 211.875 211.875 211.875 211.875 211.875

1739CPA0479.02 10286-0002 Assú V Solar Power Plant Latin America South America Brazil Rio Grande do NorteEnergia S.A. Registered Solar Solar Solar PV ACM2 1 45.9 7 18-Sep-16 196.774 TÜV-Rhein n.a. Tractebel Engineering 27-Nov-15 30-Aug-17 31-Dec-99 10 9 8 11 0 30.0 85 0.512 No 45.893 45.893 45.893 45.893 45.893 45.893 45.893

1740CPA0479.03 10286-0003 Floresta Solar Power Complex Latin America South America Brazil Rio Grande do NorteEnergia S.A. Registered Solar Solar Solar PV ACM2 1 119.8 7 1-Jan-18 359.415 TÜV-Rhein n.a. Tractebel Engineering 27-Nov-15 27-Oct-17 31-Dec-99 10 9 8 11 0 86.0 221388 0.512 No 119.805 119.805 119.805 119.805 119.805 119.805 119.805

1741CPA0479.04 10286-0004 Paracatu Solar Power Complex Latin America South America Brazil Minas Gerais Energia S.A. Registered Solar Solar Solar PV ACM2 1 161.3 7 1-Jan-19 322.682 TÜV-Rhein n.a. Tractebel Engineering 27-Nov-15 27-Oct-17 31-Dec-99 10 9 8 11 0 132.0 298138 0.512 No 161.341 161.341 161.341 161.341 161.341 161.341 161.341

1742CPA0479.05 10286-0005 Brazilian PoA for NAMA incentivized NCRE Projects Latin America South America Brazil Brazil Energia S.A. Registered Wind Wind Wind ACM2 1 778.5 7 20 1-Jan-19 1,556.986 TÜV-Rhein n.a. Tractebel Engineering 27-Nov-15 2-Feb-18 31-Dec-99 10 9 8 11 0 326.7 1438556 0.541 No 775.341 779.018 779.018 779.018 779.018 779.018 779.018

1743PoA0480 RB9X7ZPS0N9YJUCV2ROYWNH4QBE9EC 10340 Project Gaia Cook Stove Programme of Activities (PoA) Africa East Africa Ethiopia Djibouti, Ethiopia Project Gaia Inc. Registered EE households EE households Stoves AMS-I.I.+AMS.I.E. 3 214.1 12-Feb-15 28 0.0 862.9ERM CVS 0.000 n.a. Carbon Africa 15-Dec-15 06-May-16 21-Dec-16 03-Feb-17 21-Dec-16 CPA 30-Dec-99CPA 2 6 8 1 0.0 Yes1744CPA0480.01 10340-0001 Project Gaia Cook Stove Programme of Activities - CPA0001 Ethiopia Africa East Africa Ethiopia Addis Ababa Project Gaia Inc. Registered EE households EE households Stoves AMS-I.I.+AMS.I.E. 1 67.7 7 10 21-Dec-16 273.0ERM CVS n.a. Carbon Africa 15-Dec-15 21-Dec-16 30-Dec-99 2 6 8 1 0.0 No Yes 67.7 67.7 67.7 67.7 67.7 67.7 67.7

1745CPA0480.02 10340-0002 Project Gaia Cook Stove Programme of Activities - CPA0002 Djibouti Africa East Africa Djibouti Djibouti Project Gaia Inc. Registered EE households EE households Stoves AMS-I.I.+AMS.I.E. 1 73.2 7 10 21-Dec-16 294.9ERM CVS n.a. Carbon Africa 15-Dec-15 21-Dec-16 30-Dec-99 2 6 8 1 0.0 No Yes 73.2 73.2 73.2 73.2 73.2 73.2 73.2

1746CPA0480.03 10340-0003 Project Gaia Cook Stove Programme of Activities - CPA0003 Ethiopia Africa East Africa Ethiopia Addis Ababa Project Gaia Inc. Registered EE households EE households Stoves AMS-I.I.+AMS.I.E. 1 73.2 7 10 21-Dec-16 294.9ERM CVS n.a. Carbon Africa 15-Dec-15 21-Dec-16 30-Dec-99 2 6 8 1 0.0 No 89.4 86.6 84.8 82.0 80.2 59.5 29.7

1747PoA0481 X4IM4AVD2NMJ06KUN45441RGMNPKW2 10320 Scaling-Up Solar Photovoltaic Power Generation Africa West Africa Mali Scatec Solar ASA Registered Solar Solar Solar PV ACM2 3 104.9 4-Dec-14 28 0.000 1,049.400 TÜV-Nord 0.000 Norway (Norwegian Ministry of Finance) Scatec Solar 4-Dec-15 PoA0476 20-Nov-15 1-Dec-16 12-Jan-17 14-Nov-16 CPA 30-Dec-99CPA 10 12 5 9 0 70.0 Yes1748CPA0481.01 10320-0001 Scaling-Up Solar Photovoltaic Power Generation Africa West Africa Mali Segou Scatec Solar ASA Registered Solar Solar Solar PV ACM2 1 45.6 10 30 1-Jul-16 455.690 TÜV-Nord Norway (Norwegian Ministry of Finance) Scatec Solar 4-Dec-15 CPA0476.01 14-Nov-16 31-Dec-99 10 12 5 9 0 33.0 57000 0.790 Yes 22.785 45.569 45.569 45.569 45.569 45.569 45.569 45.569 45.569 45.569 22.785

1749CPA0481.02 10320-0002 20MW Ningo PV Power Generation Project in Ghana Africa West Africa Ghana Accra Scatec Solar ASA Registered Solar Solar Solar PV ACM2 1 31.7 10 30 1-Jul-16 316.500 TÜV-Nord Norway (Norwegian Ministry of Finance) Scatec Solar 4-Dec-15 14-Nov-16 31-Dec-99 10 12 5 9 0 20.0 0.690 Yes Yes 12.938 25.875 25.875 36.750 37.125 31.500 28.125 36.750 37.125 37.125 12.937

1750CPA0481.03 10320-0003 17MWp Zagtouli PV Power Generation Project in Burkina Faso Africa West Africa Burkina Faso Ouagadougou Scatec Solar ASA Registered Solar Solar Solar PV ACM2 1 27.7 10 30 1-Jul-15 277.210 TÜV-Nord Norway (Norwegian Ministry of Finance) Scatec Solar 4-Dec-15 14-Nov-16 31-Dec-99 10 12 5 9 0 17.0 0.840 Yes Yes 27.721 27.721 27.721 27.721 27.721 27.721 27.721 27.721 27.721 27.721 27.721

1751PoA0482 JIU805HXWOOQUQRU3D16YUPPM8GJSK Caribbean Hotels’ Energy Efficiency and Renewable Energy Programme Latin America Caribbean Barbados Caribbean Replaced At Validation EE service EE service EE commercial buildings AMS-I.F.+AMS.II.E. 1-May-16 28 AENOR n.a. 4-Mar-16 23-Jun-16 PoA 30-Dec-99PoA 10 8 0 No

1752CPA0482.01 Latin America Caribbean Barbados Barbados Replaced At Validation EE service EE service EE commercial buildings AMS-I.F.+AMS.II.E. 1 14.0 7 25 1-Jan-17 0.000 56.000 AENOR n.a. 4-Mar-16 23-Jun-16 30-Dec-99 10 8 0 No 0.014 0.014 0.014 0.014 0.014 0.014 0.014

1753PoA0483 CEXFODYZSYUI90WAQ5KOTZLELNF0OB Asia & Pacific Southern Asia Bangladesh Bangladesh At Validation EE industry EE industry Building materials AMS-III.Z. 1 48.66 02-May-13 28 0.00 206.90Carbon Check 0.000 n.a. Greentech Carbon 08-Apr-16 31-Dec-99 6 9 1 5 0 0.0 Yes

1754CPA0483.01 Asia & Pacific Southern Asia Bangladesh Bangladesh At Validation EE industry EE industry Building materials AMS-III.Z. 1 48.66 7 21 01-Oct-16 0.000 206.90Carbon Check n.a. Greentech Carbon 08-Apr-16 31-Dec-99 6 9 1 5 0 Yes 48.658 48.658 48.658 48.658 48.658 48.658 48.658

1755PoA0484 1Y5MX0T813M4QH3SYZPE9QUI9ECPKS Caribbean Hotels’ Energy Efficiency and Renewable Energy Programme Latin America Caribbean Barbados Caribbean At Validation EE service EE service EE commercial buildings 1 14.0 1-Jul-16 28 0.000 56.000 AENOR 0.000 n.a. 23-Jun-16 PoA0482 PoA 30-Dec-99PoA 10 8 0 0.0 No

1756CPA0484.01 Latin America Caribbean Barbados Barbados At Validation EE service EE service EE commercial buildings 1 14.0 7 25 1-Jan-17 0.000 56.000 AENOR n.a. 23-Jun-16 CPA0482.01 30-Dec-99 10 8 0 No 0.014 0.014 0.014 0.014 0.014 0.014 0.014

1757PoA0485 41OLNMSVZC6LMXUQMOIRZCZ0W2BGZ0 10355 Asia & Pacific Southern Asia Bangladesh Bangladesh Future Carbon Energy Services Registered EE industry EE industry Building materials AMS-III.Z. 1 19.4 19-Jul-16 28.0 0.0 73.5EPIC 0.000 Switzerland (South Pole Carbon Asset Management) South Pole Carbon Asset Management 19-Jul-16 03-Aug-15 25-Mar-17 13-Apr-17 15-Mar-17 PoA 31-Dec-99PoA 6 9 1 5 8 0 0.0 No

1758CPA0485.01 10355-1 Asia & Pacific Southern Asia Bangladesh Bangladesh Future Carbon Energy Services Registered EE industry EE industry Building materials AMS-III.Z. 1 19.4 7 21 15-Mar-17 0.0 73.5EPIC Switzerland (South Pole Carbon Asset Management) South Pole Carbon Asset Management 19-Jul-16 15-Mar-17 30-Dec-99 6 9 1 5 8 0 No 19.353 19.353 19.353 19.353 19.353 19.353 19.353

1759PoA0486 6UL2V8JUL2MI73JS59F7Z3W8H09OEB Mali Rural Electrification Program Africa West Africa Mali Mali AMADER At Validation Solar Solar Solar PV AMS-III.AR.+AMS-III.BL. 1 6.6 15-Jul-16 28.0 0.0 65.5TÜV-Nord 0.000 n.a. WB-CF 11-Aug-16 PoA 31-Dec-99PoA 10 8 5 1 0 0.0 Yes Financial;Technological

1760CPA0486.01 Africa West Africa Mali Mali AMADER At Validation Solar Solar Solar PV AMS-III.AR.+AMS-III.BL. 1 6.6 10 10 1-Nov-16 0.0 65.5TÜV-Nord n.a. WB-CF 11-Aug-16 30-Dec-99 10 8 5 1 0 No Financial;Technological 4.201 6.812 6.812 6.812 6.812 6.812 6.812 6.812 6.812 6.812

1761PoA0487 Z5AES3I5E7H6ZZMA7I8UOEMAG8W2Z1 10341MicroEnergy Credits – Microfinance for Clean Energy Product Lines - Africa Africa East Africa Kenya Kenya Registered EE households EE households Stoves 1 62.6 23-Nov-15 28.0 0.0 241.8TÜV-Nord 0.000 n.a. MicroEnergy Credits 21-Feb-17 PoA491 02-Dec-16 19-Jan-17 30-Mar-17 21-Feb-17 PoA 31-Dec-99PoA 11 10 8 4 1 3 0.0 No Financial;Technological

1762CPA0487.01 10341-1 Africa East Africa Kenya Kenya Registered EE households EE households Stoves 1 62.6 7 10 21-Feb-17 0.0 241.8TÜV-Nord n.a. MicroEnergy Credits 21-Feb-17 CPA491.01 21-Feb-17 30-Dec-99 11 10 8 4 1 3 No Financial;Technological 52.563 61.763 52.563 43.363 43.363 43.363 43.363

1763PoA0488 72K3OJO4VPTRS842EZ54UQ9XGJVMYV 10375EnKing International Renewable Energy POA Asia & Pacific Southern Asia India India Registered Mixed renewables Mixed renewables Solar & wind & hydro 1 1.8 0.0 6.5Carbon Check 0.000 n.a. EnKing International 22-Sep-16 08-Feb-17 01-Feb-18 09-Mar-18 6-Apr-18 PoA 31-Dec-99PoA 11 9 8 5 4 3 1.0 No

1764CPA0488.01 10375-1Grid Connected Solar PV project (EKIESL-CPA01.June-16-01) Asia & Pacific Southern Asia India Madhya Pradesh Registered Solar Solar Solar PV 1 1.8 7 25 1-Jul-17 0.0 6.5Carbon Check n.a. EnKing International 22-Sep-16 6-Apr-18 30-Dec-99 11 9 8 5 4 3 1.0 No 1.845 1.845 1.845 1.845 1.845 1.845 1.845

1765PoA0489 Q56OREDLIC435MP944WHDIZW6L2B1B EnvironmentFirst Renewable Energy Programme Asia & Pacific Southern Asia India India At Validation Mixed renewables Mixed renewables Solar & wind AMS-I.D. 1 7.7 0.0 30.9LGAI 0.000 n.a. EnvironmentFirst Energy Services 29-Sep-16 No 30-Dec-99CPA 10 9 5 5.0 No

1766CPA0489.01 Solar PV Power Project (Environmentfirst 222) Asia & Pacific Southern Asia India At Validation Solar Solar Solar PV AMS-I.D. 1 7.7 7 25 31-Dec-16 0.0 30.9LGAI n.a. EnvironmentFirst Energy Services 29-Sep-16 30-Dec-99 10 9 5 5.0 No 7.708 7.708 7.708 7.708 7.708 7.708 7.708

1767PoA0490 UV8ZQRS0B5UBQSWCTHRZ721RP8RF8K 10411Senegal Rural Electrification Program Africa West Africa Senegal Senegal reg. request Solar Solar Solar PV AMS-III.AR.+AMS-III.BL. 3 67.6 7-Jun-11 0.0 284.9AENOR 0.000 n.a. WB-CF 1-Oct-16 PoA 31-Dec-99PoA 10 8 7 5 3.2 No

1768CPA0490.01 10411-1CPA001 Senegal Rural Electrification - Mini-Grids Africa West Africa Senegal Entire country reg. request Solar Solar Solar PV AMS-III.BL. 1 27.1 7 20 30-Jun-17 95.0AENOR n.a. WB-CF 1-Oct-16 30-Dec-99 10 8 7 5 10 No 1.096 13.149 35.064 35.064 35.064 35.064 35.064

1769CPA0490.02 10411-2CPA002 Senegal Rural Electrification – Grid Extension Africa West Africa Senegal Entire country reg. request Grid extension Energy distribution Connection of Isolated grid AMS-III.BL. 1 13.4 20 30-Jun-17 95.0AENOR n.a. WB-CF 1-Oct-16 30-Dec-99 10 8 7 5 No 7.211 14.423 14.423 14.423 14.423 14.423 14.423

1770CPA0490.03 10411-3CPA003 Senegal Rural Electrification – Solar Home Systems Africa West Africa Senegal Entire country reg. request Solar Solar Solar PV AMS-III.BL. 1 27.1 20 30-Jun-17 95.0AENOR n.a. WB-CF 1-Oct-16 30-Dec-99 10 8 7 5 3.2 No 1.096 13.149 35.064 35.064 35.064 35.064 35.064

1771PoA0491 ASSVOL77GLGAI5U80NDJWGV583VA9H Asia & Pacific Southern Asia Bangladesh Bangladesh Future Carbon Energy Services Replaced At Validation EE industry EE industry Building materials AMS-III.Z. EPIC n.a. South Pole Carbon Asset Management 5-Oct-16 21-Feb-17 PoA 30-Dec-99PoA and CPA 9 8 7 6 5 1 3 No

1772CPA0491.01 Asia & Pacific Southern Asia Bangladesh Sylhet division Future Carbon Energy Services Replaced At Validation EE industry EE industry Building materials AMS-III.Z. 1 19.7 7 21 5-Oct-16 83.4EPIC n.a. South Pole Carbon Asset Management 5-Oct-16 21-Feb-17 30-Dec-99 9 8 7 6 5 1 3 No 19.67 19.67 19.67 19.67 19.67 19.67 19.67

1773PoA0492 WE879RFG2DQN0UOJEG8APJPKQPDQX9 10352 Tandavanala TsinjoHarena Improved cookstoves in Madagascar Africa East Africa Madagascar Madagascar Tandavanala Registered EE households EE households Stoves AMS-II.G. 3 140.1 17-Nov-16 0.0 524.9KBS 0.000 Norway (Norwegian Ministry of Finance) Tandavanala 17-Nov-16 30-Jan-17 04-Mar-17 20-Apr-17 4-Apr-17 PoA 30-Dec-99PoA 8 6 5 4 1 0 0.0 No

1774CPA0492.01 10352-0001 Tandavanala TsinjoHarena Improved cookstoves in Madagascar-CPA001 Africa East Africa Madagascar Haute Matsiatra Tandavanala Registered EE households EE households Stoves AMS-II.G. 1 46.4 7 10 4-Apr-17 173.8KBS Norway (Norwegian Ministry of Finance) Tandavanala 17-Nov-16 4-Apr-17 30-Dec-99 8 6 5 4 1 0 No 46.42 46.42 46.42 46.42 46.42 46.42 46.42

Wuhan Tianying Envi ronmental Engineering

To establ ish a sustainable livestock waste management model that would significantly improve rural environment and reduce greenhouse gas emissions

Wuhan Tianying Envi ronmental Engineering

Biogas digesters wi th i ti lization of biogas for energy

Benchmark analysisLanzhou Hualong Poul try

BreedingTo support the installation of animal manure treatment systems with recovery of biogas and the util ization of the generated biogas as fue l

Lanzhou Hualong Poul try Breeding

Biogas digesters wi th i ti lization of biogas for energy

Benchmark analysis

Energy and Water Saving Promotion Programme for Textile Dyeing Process of Bangladesh Textile and Garment Industries

Green Pro ject Water Saving Technology

The purpose is to promote energy and water saving through optimizing the process from yarn to fabric on textile dyeing process that is the most water and energy consuming process in a textile andgarment factory

Energy and Water Saving Promotion Programme for Textile Dyeing Process of Bangladesh Textile andGarment Industries

Green Pro ject Water Saving Technology

Dyeing process optimization from yarn to fabric by targeting dyeing machines and other machines

UGL Services Premas Operations

To sign ificantly contribute towards energy efficiency measures by reducing theconsumption of e lectrici ty in building cooling systems

Energy Efficiency measures in cool ing system at Republic Plaza, 9 Raffles Place, Singapore

UGL Services Premas Operations

Replacement of existing cool ing systems (ch illers)

Prevai ling practice;Technological

Programme of Activities for the development of solar water heating systems in the tertiary sector in Tunisia - PROSOL tertiary

Tunisian National Agency for Energy Conservation

To instal l around 10,000 square meters of SWH sy stems per year, thereby d isplacing fossil fue ls and eventually carbon intensive electricity from the grid and, currently used to provide hot water in the tertiary sector

Programme of Activities for the development of solar water heating systems in the tertiary sector in Tunisia - PROSOL tertiary-CPA-001

Tunisian National Agency for Energy Conservation

Other;P revai ling practice;Technological

MSCMSCMSCMSCTo construct and d istribute efficient cook

stoves free of charge with a h igh ly subsidised insta lla tion charge to rura l households cooking with firewood in Malawi

Beij ing YuanDa Carbon Assets Investment Management

to develop a p latform for a series of smal l scale hydropower plants in Guizhou Province to overcome financial hurd les, and to so lve the electricity shortage problem in these areas, strengthen the rura l infrastructure construction.

Beij ing YuanDa Carbon Assets Investment Management

MSCMSCMSCMSCTo promote small hydropower generation

in Sri LankaTwo Horizonta l shaft Francis turbines with power generated at 690 V, and stepped up to 33 000 V using a step-up transformer

Benchmark analysis

Install a run-of-river hydropower p lant with a capaci ty of 3.8MW using water flow

Install a run-of-river hydropower p lant with a capaci ty of 2MW using water flow

Install a run-of-river hydropower p lant with a capaci ty of 3MW using water flow

Install a run-of-river hydropower p lant with a capaci ty of 3.25MW using water flow

Install a run-of-river hydropower p lant with a capaci ty of 10MW using water flow

Install a run-of-river hydropower p lant with a capaci ty of 1.5MW using water flow

1.9MW Upper Hulu Ganga Small Hydropower Pro ject <2016-UHG-009-1.9MW>

Install a run-of-river hydropower p lant with a capaci ty of 1.9MW using water flow

Programme to Reduce Non-Renewable Biomass Consumptions through Introduction of High-Efficiency Cook Stoves

To reduce the nonrenewable b iomass consumption by introducing the highly efficient cooking appliance

High-efficiency cook stove made of insu lating bricks

Aim at popularizing coal water slurry and related equipment in Guizhou province, increasing the efficiency of boi lers in the province.

CPA-0001 Medica l Park concentrate Steam supply station project in Qinzhen Ci ty Guizhou

C-Quest Capital Malaysia Global Stoves

To reduce greenhouse gas emissions from cook-stoves using wood-fuel (charcoal and firewood) derived from non-renewable sources, in domestic ki tchens,

C-Quest Capital Malaysia Global Stoves

African Clean Energy Company, Phi lips Smokeless stove (ACE)

West Bengal and Jharkhand

to instal l 1000 MW capacity of S olar Photo Vol ta ic (PV) in the next 15 years across the DVC canals and the barren land by the side of the canals in the district of West Bengal and Jharkhand.

Crystall ine modules in the range 200 wp – 320 wp

To reducing wood fue l consumption of Togolese by improved stoves

Man and Man Enterprise

Promotion, distribution and sa le of thermally-efficient Improved Cookingstoves in Haiti

Eco-Zoom Jet Lightweight ceramic portable stoves

C-Quest Capital Malaysia Global Stoves

To distribute more efficient improved cooking systems (ICS) using renewable biomass affordable and avai lab le to users in the host countries

C-Quest Capital Malaysia Global StovesFar Western

Development Region

SNV Netherlands Development Organisation

To disseminate 150,000 improved cookstoves (ICS) to households in the Far Western

Doti, Dadeldhura, Baitad i, Achham, Darchula, Bajhang & Bajura

SNV Netherlands Development OrganisationDoti, Dadeldhura,

Baitad i, Achham, Darchula, Bajhang, Bajura

SNV Netherlands Development Organisation

Dissemination of improved cooking stovesDoti, Dadeldhura,

Baitad i, Achham, Darchula, Bajhang, Bajura

SNV Netherlands Development Organisation

Dissemination of improved cooking stovesTo reduce the amount of greenhouse gas

(GHG) generated by the management of City of Cape Town and the Cape Flats

Repai r the anaerobic d igesters and the Thermal Drying PlantAgricu ltura l Technological

Transfer SocietyTo replace the current usage of fue l wood in rural North

KordofanAgricu ltura l Technological Transfer Society

Bio d igesters to be installed at household levelThe proposed PoA wil l del iver a long-term,

secure and simple contribution to sustainable development that, without carbon finance, would not exist.

Norway (Differ), Sweden (Government o f Sweden), Germany (Stiftung Zukunft des Kohlenstoffmarktes)15,330 highly e fficient and durable

cooking systemsNorway (Differ), Sweden (Government o f Sweden), Germany (Stiftung Zukunft des Kohlenstoffmarktes)15,440 highly e fficient and durable

cooking systemsNorway (Differ), Sweden (Government o f Sweden), Germany (Stiftung Zukunft des Kohlenstoffmarktes)The overall goal o f the PoA is to increase

market penetration of loca l Improved Cookstoves (ICS) in West Africa

Norway (Differ), Sweden (Government o f Sweden), Germany (Stiftung Zukunft des Kohlenstoffmarktes)This CPA wi ll distribute up to 30.000

locally produced improved charcoal cookstoves.

Norway (Differ), Sweden (Government o f Sweden), Germany (Stiftung Zukunft des Kohlenstoffmarktes)

Financial ;Investment;Prevai ling practiceThe proposed PoA wil l, through carbon

financing, engage local partners in production, d istribution, sale and support of various water purification technologies

Gatsibo, Kayonza, Kirehe

This CPA wi ll distribute low carbon water purifiers.This CPA wi ll distribute low carbon water purifiers.This CPA wi ll distribute low carbon water purifiers.This CPA wi ll distribute low carbon water purifiers.This CPA wi ll distribute low carbon water purifiers.This CPA wi ll distribute low carbon water purifiers.This CPA wi ll distribute low carbon water purifiers.This CPA wi ll distribute low carbon water purifiers.This CPA wi ll distribute low carbon water purifiers.This CPA wi ll distribute low carbon water purifiers.This CPA wi ll distribute low carbon water purifiers.This CPA wi ll distribute low carbon water purifiers.This CPA wi ll distribute low carbon water purifiers.This CPA wi ll distribute low carbon water purifiers.

Norway (Differ), Germany (Sti ftung Zukunft des Kohlenstoffmarktes)This CPA wi ll distribute low carbon

water purifiers.Norway (Differ), Germany (Sti ftung Zukunft des Kohlenstoffmarktes)This CPA wi ll distribute low carbon

water purifiers.Norway (Differ), Germany (Sti ftung Zukunft des Kohlenstoffmarktes)This CPA wi ll distribute low carbon

water purifiers.Norway (Differ), Germany (Sti ftung Zukunft des Kohlenstoffmarktes)This CPA wi ll distribute low carbon

water purifiers.Norway (Differ), Germany (Sti ftung Zukunft des Kohlenstoffmarktes)This CPA wi ll distribute low carbon

water purifiers.Norway (Differ), Germany (Sti ftung Zukunft des Kohlenstoffmarktes)This CPA wi ll distribute low carbon

water purifiers.Norway (Differ), Germany (Sti ftung Zukunft des Kohlenstoffmarktes)This CPA wi ll distribute low carbon

water purifiers.Norway (Differ), Germany (Sti ftung Zukunft des Kohlenstoffmarktes)This CPA wi ll distribute low carbon

water purifiers.Norway (Differ), Germany (Sti ftung Zukunft des Kohlenstoffmarktes)Efficiency Improvements in Furnaces used in Steel Re-ro lling industry in

Bhavnagar District, Gujarat IndiaSihor S teel Re-roll ing Mi lls Association

The goal of the proposed PoA is to implement energy efficiency measures in existing furnaces used in SME steel re-rol ling mill cluster in Bhavnagar district of

Efficiency Improvements in Furnaces used in Steel Re-ro lling industry in Bhavnagar District, Gujarat, India

Sihor S teel Re-roll ing Mi lls Association

This CPA will implement energy efficiency measures in smal l and medium enterprises (SME) in the stee l re-rol ling industry.

India, Bangladesh, Ghana, L iberia, Nigeria

The goal of the proposed PoA is to install low/zero GHG emitting water purifiers a t community leve l. The water puri fication system will reduce GHG emission by

Decentral ised Community Water Purification System installations in Ghana, Africa

Volta, G. Accra, Eastern, Northeren, Ashanti , Brongahafo

Under this CPA 35 WaterHeal th units wil l be installed in the region of type WHC 65 which has the rated capacity of puri fying 2700 li ters of water per

The purpose of this PoA is to support the development and implementation of renewable energy projects in Rwanda. (hydropower, solar photovoltaic power,

AMS-I.F.+ACM2+AMS-I.D.

The purpose of this CPA is to construct a micro scale hydropower plant with a capacity of 2 .9 MW

AMS-I.F.+ACM2+AMS-I.D.

The purpose of this CPA is to construct a micro scale hydropower plant with a capacity of 2 .9 MW

AMS-I.F.+ACM2+AMS-I.D.The purpose of this CPA is to

construct a micro scale hydropower plant with a capacity of 4 .2 MW

AMS-I.F.+ACM2+AMS-I.D.

The purpose of this CPA is to construct a micro scale hydropower plant with a capacity of 2 .4 MW

AMS-I.F.+ACM2+AMS-I.D.The purpose of this CPA is to

construct a micro scale hydropower plant with a capacity of 2 MW

AMS-I.F.+ACM2+AMS-I.D.The purpose of this CPA is to

construct a micro scale hydropower plant with a capacity of 2 .6 MW

AMS-I.F.+ACM2+AMS-I.D.The objective of the PoA is to distribute

over 200,000 fuel efficient cooking stoves to rural households in Ethiopia

This CPA wi ll distribute two di fferent types of fuel efficienct cook-stoves. Mirt stoves for injera baking and Tikikil rocket stoves for other cooking tasks.

The objective of the PoA is to distribute ICS to reduce GHG emissions and improve indoor a ir quality

This CPA wi ll distribute 11,000 ICS throughout the Yangon reg ion of Myanmar

Ropeway Transport Limited, Nigeria

The objective of the PoA is to promote efficient and less carbon intensive transportation in highly populated areas of Nigeria, using cable cars.

Ropeway Transport Limited, Nigeria

This CPA wi ll enta il the construction of a Cable Propel led Transit (CPT), based on a cable technology moving cabins on aeria l towers from one location to another.

The objective of this PoA is to distribute ICS across Vanuatu, to provide clean and energy efficient technology for cooking in various communities in the country

The purpose of this CPA is to distribute 3000 ICS in households in various communities.

SNV Netherlands Development Organisation

The objective of this PoA is to stimulate dissemination of biodigester systems in West Africa to rep lace trad itional thermal energy generation methods at household

SNV Netherlands Development Organisation

The purpose of this CPA is to disseminate biogas digester systems in Burkina Faso

Efficiency Improvements in Furnaces used in Steel Re-ro lling industry in Bhavnagar District, Gujarat, India

Sihor S teel Re-roll ing Mi lls Association

The objective of this PoA is to implement energy efficiency measures in furnaces of the smal l and medium enterprise steel re-rol ling mill cluster in Bhavnagar district of

Sihor S teel Re-roll ing Mi lls Association

The purpose of this CPA is to increase the usefu ll length of the reheating furnace, modify the zone of the reheating furnace and change the roof to a flat suspended one from an arc type, all in order to increase energy efficiency in the mil l

The objective of this PoA is to create incentives and promote wind energy in Brazi l.

Install w ind turb ines in the state of Ceará with a total capaci ty of 29.7MW

SNV Netherlands Development Organisation

The objective of this PoA is to stimulate dissemination of biodigester systems in West Africa to rep lace trad itional thermal energy generation methods at household

SNV Netherlands Development Organisation

The purpose of this CPA is to disseminate biogas digester systems in Burkina Faso

The objective of the PoA is to increase access to secure drinking water through promoting zero greenhouse gas (GHG) emi tting water purification

The purpose of this CPA is to insta ll ground water pumps throughout rura l Uganda.

Improved cook stove Program of Activities in Pyuthan, Rolpa, Rukum, Salyan, Dai lekhand Jajarkot d istricts o f Nepal

Business & Environment Sustainable Nepal Pvt. L tc.

The proposed PoA aims to abate greenhouse gas emissions and reduce consumption of non-renewable fuel wood used for cooking applications by replacing

Business & Environment Sustainable Nepal Pvt. L tc.

The proposed CPA involves the insta lla tion of 13,000 l-pot hole LRS in households located in Rolpa District o f Nepal .

The aim of this PoA is to improve energy efficiency by substituting inefficient tradtional cooking stoves with more effective ones imporving the conditions of

The pro ject invo lves the distribution of around 10,000 energy efficient stoves to households during the years 2014, 2015 and 2016

The pro ject invo lves the distribution of around 11,530 energy efficient stoves to households during the years 2015−2017

The pro ject invo lves the distribution of around 6,541 energy efficient stoves to households during the years 2015−2017

Off-grid renewable energy for rura l electri fication in Mozambique managed by FUNAE

The objective of this PoA is to provide renewable energy for rura l villages in Mozambique through insta lla tion of off-grid electricity technologies such as micro

CPA-0001: 2014-2016 Action Plan for “Off-grid renewable energy for rural electrification in Mozambique managed by FUNAE”

In th is CPA a range of so lar pv insta lla tions wi ll be made as well as one micro hydropower plant with a capacity of 631KWDemocratic

Republ ic of CongoClimate Corporation Emissions Trading

The purpose of this PoA is to disseminate improved b iomass cookstoves tu urban, peri-urban and rural users, while replacing old stoves thus increasing efficiency and

Empowering DRC communities through the use of Improved Cook Stoves – CPA 001

Climate Corporation Emissions Trading

This CPA wi ll facil ita te the dissemination of Improved Cook Stoves (ICS) in the Democratic Republic of Congo

Empowering DRC communities through the use of Improved Cook Stoves – CPA 002

Climate Corporation Emissions Trading

This CPA wi ll facil ita te the dissemination of Improved Charcoal Cook Stoves (ICS) to urban, peri -urban, and rural households in the Province of Kinshasa

The purpose of this PoA is to promote reduction of greenhouse gas emissions from non-renewable biomass fue l, through dissemination of improved hous ehold

The CPA aims to disseminate between 12500 and 14000 improved cookstoves throughout Malawi .The CPA aims to in itial ly disseminate approximately 21,645 improved cookstoves

The CPA aims to in itial ly disseminate approximately 21,645 improved cookstoves

The CPA aims to in itial ly disseminate approximately 21,645 improved cookstoves

The CPA aims to in itial ly disseminate approximately 21,645 improved cookstoves

The CPA aims to in itial ly disseminate approximately 21,645 improved cookstoves

The CPA aims to in itial ly disseminate approximately 21,116 improved cookstoves

The CPA aims to in itial ly disseminate approximately 21,106 improved cookstoves

The CPA aims to in itial ly disseminate approximately 21,645 improved cookstoves

The CPA aims to in itial ly disseminate approximately 21,645 improved cookstoves

The CPA aims to in itial ly disseminate approximately 21,645 improved cookstovesThe CPA aims to in itial ly disseminate approximately 21,645 improved cookstovesThe CPA aims to in itial ly disseminate approximately 21,645 improved cookstovesThe CPA aims to in itial ly disseminate approximately 21,645 improved cookstovesThe CPA aims to in itial ly disseminate approximately 21,645 improved cookstovesThe CPA aims to in itial ly disseminate approximately 21,645 improved cookstovesThe CPA aims to in itial ly disseminate approximately 21,645 improved cookstovesThe CPA aims to in itial ly disseminate approximately 21,645 improved cookstovesThe CPA aims to in itial ly disseminate approximately 21,645 improved cookstovesThe CPA aims to in itial ly disseminate approximately 21,645 improved cookstoves

The CPA aims to in itial ly disseminate approximately 21,645 improved cookstoves

The CPA aims to in itial ly disseminate approximately 21,645 improved cookstoves

The CPA aims to in itial ly disseminate approximately 21,645 improved cookstoves

The CPA aims to in itial ly disseminate approximately 21,645 improved cookstoves

The CPA aims to in itial ly disseminate approximately 21,645 improved cookstoves

This PoA involves installation of small biomass power generation pro jects throughout Sri Lanka in an effort to reduce GHG emissions and provide electricity to

Programme of Activities for Smal l Scale Biomass Power CDM in Sri Lanka - CPA-0001 - Buttala Smal l Biomass Power Project

This CPA enta il the insta lla tion of a 5MW biomass based power plant, generating approximately 35.05GWh/year which wil l be fed to the Sri Lanka national grid .

Programmatic CDM project using Municipal Organic Waste of 64 Districts of Bangladesh

Department of Environment of the Government of Bangladesh

This PoA involves co llection and composting of municipal sol id wasteComposting of Municipa l Solid Waste of Mymensingh Pourashava Area,

CPA No. 01District of Mymensingh

Department of Environment of the Government of Bangladesh

This CPA enta il the insta lla tion of a plant for composting Municipa l Solid Waste to avoid methane emissions.

Programme of Activities for Smal l Scale Biomass Based Thermal Energy Generation CDM in Sri Lanka

This PoA involves implementation of small scale biomass based thermal energy generation pro jects Milco Small Scale Biomass Based Thermal Energy Generation Project

<2014-SLCF-001-4MWth>This CPA enta ils insta lla tion of a 6 THP b iomass boi ler running on sustainably grown Gl iricidia .

Beij ing Sus Energy Sci . & Tech. Co.

Design and implementation of green commercial buildings

Beij ing Sus Energy Sci . & Tech. Co.

New low-energy conference center: Bei jing Yanqi Convention and Exhib ition Center

Timor-Leste, Myanmar

Solar lighting, water fil ters and improved cook stoves to households

AMS-I.A.+AMS-II.G.+AMS-III.AV.

18,500 stoves, 100,000 solar lighting appliances and 100,000 solar home systems

AMS-I.A.+AMS-II.G.+AMS-III.AV.

Marine Power Generation Company (MPG)

Support the development and implementation of geothermal energy pro jects in the Ri ft Vally Region of Kenya.

Marine Power Generation Company (MPG)

Installation of 35MW geothermal power plant to supply e lectrici ty to the grid .

Accelerating Electrification through Grid Extension and Off-Grid Electri fication in Rura l Areas of

Rura l Electrification Agency Uganda (REA)

The PoA wi ll expand energy access to electricity in Uganda through extensions of existing grids, o ff-grid electri fication and solar powered l ighting systems.

AMS-III.AR.+AMS-I.L .+AMS-III.BB.Accelerating Electrification through Grid Extension and off-grid electri fication

in Rural Areas of Uganda CPA 1Western Service Territory

Rura l Electrification Agency Uganda (REA)

Increases access to energy through grid extension and distribution of so lar powered LED lighting systems

AMS-III.AR.+AMS-I.L .+AMS-III.BB.Accelerating Electrification through Grid Extension and off-grid electri fication

in Rural Areas of Uganda CPA 2Rura l Electrification Agency Uganda (REA)

Increases access to energy through grid extension and distribution of so lar powered LED lighting systems

AMS-III.AR.+AMS-I.L .+AMS-III.BB.Programme of Activities for Fossil Natural Gas Substi tu tion by Renewable

Natural GasProduced from Anaerobic Digestion of Organic Waste in BrazilTh is PoA wi ll facil itate a fossil-fue l switch through the production of biogas from anaerobic digesters decomposing residues from the agricultura l industry. Installation of a biogas reactor

decomposing b iomass material with a capacity of producing 12,600,000Nm^3/year

This PoA wi ll disseminate improved cookstoves

AMS-III.BG.+AMS -II.G.+AMS-I.E.Dissemination of TLUD gasi fier stoves and generation of charcoal in West

Bengal , first CPADissemination of TLUD cook stoves in West Bengal at subsid ized prices

AMS-III.BG.+AMS -II.G.+AMS-I.E.

Dissemination of TLUD cook stoves at subsidized prices

AMS-III.BG.+AMS -II.G.+AMS-I.E.

Uni ted Arab Emirates

Dubai Electricity and Water Authority (DEWA)

This PoA involves the installation of small-scale Solar PVDubai Electricity and Water

Authority (DEWA)Installation of Solar PV p lant with capacity of 3 .878MWInfrastructure Development

Company L imitedTo accelerate dissemination of b iogas application in rural Bangladesh using micro-creditIn frastructure Development

Company L imitedMicro-type b iogas digesters (typica lly, biogas generationcapacity of 2 .4–4.8 m3/day) and supply biogas for households in rura l Bangladesh

Fossil Natural Gas Substitution by Renewable Natural Gas Produced from Anaerobic Digestion ofVinasse Programme of Activi ty in Brazil

Ecometano Empreendimentos Ltda.

Fossil fue l switch through the production and utilization of biogas through anaerobic decomposition of vinasse (by product of sugarcane mills)

Ecometano Empreendimentos Ltda.

Biogas production in an anaerobic digester on the basis of vinasse from sugar mills

Support development and implementation of utili ty scale solar photovoltaic (Solar PV) pro jects in Rwanda

This CPA wi ll insta ll a 8.5MW Solar PV plant in the Rwamagana District o f Rwanda

Scal ing-Up Solar Photovoltaic Power Generation across Africa and the Levant Region

Burkina Faso, Cote d' Ivorie, Egypt, Ghana, Jordan, Kenya,

The operating and implementation framework of this PoA is to develop and implement a range ofScal ing-Up Solar Photovoltaic Power Generation across Africa and the

Levant Region (CPA-001)This CPA involves the development, construction and operation of a 33MWp PV power generation pro ject

The purpose of this PoA is to develop large scale sustainably managed forest plantation

The Lurio Forest CPA is planting eucalyptus and to a lesser extent acacia in 3 d iscreet areas in the Nampula Province

Development Bank of Ethiopia (DBE)

The purpose of this PoA is to distribute domestic biogas plants (DBPs), generating biogas for cooking in rural communities in Ethiopia.

AMS-I.I.+AMS-I.E.+AMS-II.G.Development Bank of Ethiopia

(DBE)6000 Domestic biogas plants to be insta lled in rura l areas of Ethiopia.

AMS-I.I.+AMS-I.E.+AMS-II.G.Development Bank of Ethiopia

(DBE)13250 Domestic biogas p lants to be insta lled in rura l areas of Ethiopia.

AMS-I.I.+AMS-I.E.+AMS-II.G.Development Bank of Ethiopia

(DBE)This PoA wi ll promote off-grid energy access, through the installation of 150,000 solar household PV systems, 3 ,000 insti tu tional solar PV systems and

AMS-III.AR.+AMS-I.F.+AMS-I.L.+AMS-I.B.Development Bank of Ethiopia

(DBE)Through this CPA approximately 400,000 so lar lamps wil l be insta lled in Eth iopia.

AMS-III.AR.+AMS-I.F.+AMS-I.L.+AMS-I.B.Development Bank of Ethiopia

(DBE)This CPA wi ll include approximate ly 15,797 SHS to be insta lled in Ethiopia

AMS-III.AR.+AMS-I.F.+AMS-I.L.+AMS-I.B.

Development Bank of Ethiopia (DBE)

This CPA wi ll include approximate ly 454,344 so lar lamps to be insta lled in Eth iopia

AMS-III.AR.+AMS-I.F.+AMS-I.L.+AMS-I.B.

Waste to energy using biomass Gasification in South East Asia LDCs programme of activi ties.

This PoA enta ils the dissemination of gasification uni ts (rice husks, o ther biomass residue) for electricity generation.

AMS-I.A.+AMS-I.B.+AMS-I.D.

Waste to energy using biomass Gasification in South East Asia LDCs programme of activi ties CPA-001

This CPA wi ll insta ll 3 biomass gasification uni ts in Cambodia, wi th a to tal capacity of 0 .36 MW

AMS-I.A.+AMS-I.B.+AMS-I.D.

Africa Growth and Energy Solutions (AGES)

Rural off-grid using hydro, biomass, s olar or windAfrica Growth and Energy

Solutions (AGES)SunLighting™ Côte d’ Ivo ire – Programme to rep lace kerosene lamps with micro PV LED systems

The purpose of this PoA is to rep lace kerosene lamps wi th micro PV LED systems

SunLighting™ Côte d’ Ivo ire – Programme to rep lace kerosene lamps with micro PV LED systems - CPA 1

The pro ject wil l sell /d istribute PV LED systems to households in Côte d ’Ivoi re

Reducing Methane Emissions and Improving Productivi ty in the Ugandan Dairy Sector Through Strategic Feed Supplementation

The Molasse Urea Product (MUP) supplement wil l improve the digestive efficiency of the ruminants, which will have the effect o f reducing methane emissions

Western Service Territory

The pro ject wil l improve the digestive efficiency of the ruminants to reduce methane emissions and increase mi lk productivi ty

Mehr Renewable Energy Company (MRE)

The PoA wi ll support the development of new grid connected small sca le hydropower generationpro jects throughout Iran.

Mehr Renewable Energy Company (MRE)

A s mall-sca le hydropower p lant that is run-of-river with a total installed capacity of 2 .3 MW

Chaharmahal and Bakhtiari

Mehr Renewable Energy Company (MRE)

A s mall-sca le hydropower p lant that is run-of-river with a total installed capacity of 2 .3 MW

Chaharmahal and Bakhtiari

Mehr Renewable Energy Company (MRE)

A s mall-sca le hydropower p lant that is run-of-river with a total installed capacity of 2 .3 MW

Mehr Renewable Energy Company (MRE)

A s mall-sca le hydropower p lant that is run-of-river with a total installed capacity of 2 .3 MW

Burkina Faso, Congo, Côte d'Ivoi re, Egypt, Ghana, Jordan,

The POA will develop and implement a range of utili ty scale Solar PV power generation pro jects

This CPA involves the development, construction and operation of a 33MWp PV power generation pro ject

Africa Growth and Energy Solutions (AGES)

This PoA aims to provide rural off-grid population of Cameroon with renewable electricity using loca lly available resources like hydro, biomass, solar or wind

Africa Growth and Energy Solutions (AGES)

The CPA Implementer plans to insta ll and operate 1MW solar PV

The CPA involves the manufacturing of renewable biomass briquettes which wil l be used in a total o f 4000 households

The CPA consists o f a 97.2 MW wind farm complex composed of four ad jacent wind farms

The CPA consists o f a 30 MW solar power plant with an estimated energy generation of 84,805 MWh/year

The CPA consists o f a 86 MW solar power plant The CPA consists o f a 132MW solar power plantThe CPA consists o f a 326.7 MW wind farm complex

This PoA aims to displace the use of non-renewable b iomass and fossil fuel for cooking in households through the dissemination of energy efficient cook

The CPA plans the dissemination of energy efficient cook stoves powered by renewable sources of biomass

The CPA plans the dissemination of energy efficient cook stoves powered by renewable sources of biomass

The CPA plans the dissemination of energy efficient cook stoves powered by renewable sources of biomass

Burkina Faso, Ghana, Mali

The POA will develop and implement a range of utili ty scale Solar PV power generation pro jects

This CPA involves the development, construction and operation of a 33MWp PV power generation pro ject

This CPA involves the development, construction and operation of a 20MW PV power generation projectThis CPA involves the development, construction and operation of a 17MW PV power generation project

Caribbean Hotel and Tourism Association (CHTA)

The POA involves the implementation of energy efficiency and renewable energymeasures in hotels located in the Caribbean region

Caribbean Hotel and Tourism Association

Energy Efficiency and Renewable Energy measures at the Crane Resort inBarbados

Caribbean Hotel and Tourism Association (CHTA)

Specifical ly, the Crane Resort intends to instal l two measures: more efficient electric engines for water pumps and a photovol ta ic system.

Caribbean Hotel and Tourism Association

Energy Efficient Bui lding Materials Production Technologies Development Program

Greentech Carbon Solutions Limi ted

The POA supports the development o f new brick production facili ties throughout Bangladesh that wi ll employ energy efficient technologies

Energy Efficient Bui lding Materials Production Technologies Development Program, CPA 001

Manikganj, Dhaka,Rangpur, Mymensingh

Greentech Carbon Solutions Limi ted

This CPA includes the establ ishment of the 3 (Three) Tunnel kiln technology brick manufacturing pro jects which wil l use sintering/fi ring process to produce brick/block .

Caribbean Hotel and Tourism Association (CHTA)

The POA involves the implementation of energy efficiency and renewable energymeasures in hotels located in the Caribbean region

AMS-II.N.+AMS-I.F.+AMS.II.E.

Caribbean Hotel and Tourism Association

Energy Efficiency and Renewable Energy measures at the Crane Resort inBarbados

Caribbean Hotel and Tourism Association (CHTA)

Specifical ly, the Crane Resort intends to instal l two measures: more efficient electric engines for water pumps and a photovol ta ic system.

AMS-II.N.+AMS-I.F.+AMS.II.E.

Caribbean Hotel and Tourism Association

National Programme for Energy Efficiency Improvement in the Brick Manufacturing Sector in Bangladesh

The PoA seeks to develop a platform for sustainable large scale deployment of energy efficiency measures in the brick manufacturing sector in Bangladesh

Energy Efficiency improvement in brick manufacturing sector in Bangladesh This CPA in particular wil l consist of 14 Brick Manufacturing uni ts to substitu te the FCK technology/measure of brick manufacturing by Zig Zag technology/measure

The PoA includes the in troduction of hybrid solar PV/d iesel generation in rural min i-grids, installation of Solar Home Systems (SHS) and d istribution of high quali ty solar lanterns.

Mal i Rura l Electrification Program – Hybrid Min i Grid CPA 01 The proposed CPA covers the hybridization of diesel -powered mini-grids with solar panels in 50 villages in Mali .

Micro Energy Credits Corporation Private L imited

The PoA seeks to promote clean energy product lines through the dissemination of efficient stoves, solar electric l ights and water purifiers

AMS-III.AR.+AMS-II.G.+AMS-III.AV.

MicroEnergy Credi ts – Microfinance for Clean EnergyProduct L ines – Africa – CPA 01

Micro Energy Credits Corporation Private L imited

The CPA involves marketing, distributing, and financing of solar lanterns, and improved cook stoves, for lowincome households and microentrepreneurs across Kenya

AMS-III.AR.+AMS-II.G.+AMS-III.AV.

Carbon Check (India) Private Ltd.

The PoA wi ll support the development of new grid-connected renewable energy power plants in India and wil l cover the solar/hydro/wind energy technologies

ACM2+AMS-I.F.+AMS.I.D.

Carbon Check (India) Private Ltd.

The CPA aims to insta ll a new 1 MW solar P V power p lant

ACM2+AMS-I.F.+AMS-I.D.

EnvironmentFi rst Energy Services (P) L imited

The PoA seeks to develop a platform for overcoming institutional , financia l hurdles for the construction of a series of renewable energy power p lants projects

Financial ;Tec hnological; Other

Telangana, Tami l Nabu

EnvironmentFi rst Energy Services (P) L imited

Installation of a new grid-connected 5 MW solar photovol ta ic (PV) power plant

Financial ;Tec hnological; Other

Agence Senegalaise d’Electrification Rurale (ASER)

The overall objective of the PoA is to contribute to the increase in rural electrification rates in Senegal from 24% in 2012 to 60% in 2017 and universal access in 2025

Agence Senegalaise d’Electrification Rurale (ASER)

The CPA consists o f the insta lla tion of solar home systems in rural communities.

Agence Senegalaise d’Electrification Rurale (ASER)

This CPA consists o f the new connections to the national grid of Senegal, both for consumers will no previous access and for those previously connected to a loca l min i-grid .Agence Senegalaise

d’Electrification Rurale (ASER)This CPA consists o f the insta lla tion of new solar home systems in rura l communities.

National Programme for Energy Efficiency Improvement in the Brick Manufacturing Sector in Bangladesh

The overall objective is to develop a platform for sustainable large scale deployment of energy efficiency measures in the brick manufacturing sector in Bangladesh

CPA 1 – Energy Efficiency improvement in brick manufacturing sector in Bangladesh

The CPA wi ll bring a change in the brick sector by improvising the FCK to Zig Zag kiln

The overall objective is the dissemination of the efficient improved cooking stove to the rura l and urban household of Madagascar

The CPA aims to disseminate efficient improved cooking stove sing le pot type based on woody b iomass to the rural household of Madagascar

1775CPA0492.02 10352-0002 Tandavanala TsinjoHarena Improved cookstoves in Madagascar-CPA002 Africa East Africa Madagascar Haute Matsiatra Tandavanala Registered EE households EE households Stoves AMS-II.G. 1 47.3 7 10 4-Apr-17 177.2KBS Norway (Norwegian Ministry of Finance) Tandavanala 17-Nov-16 4-Apr-17 30-Dec-99 8 6 5 4 1 0 No 47.31 47.31 47.31 47.31 47.31 47.31 47.31

1776CPA0492.03 10352-0003 Tandavanala TsinjoHarena Improved cookstoves in Madagascar-CPA003 Africa East Africa Madagascar Amoron'i Mania Tandavanala Registered EE households EE households Stoves AMS-II.G. 1 46.4 7 10 4-Apr-17 173.8KBS Norway (Norwegian Ministry of Finance) Tandavanala 17-Nov-16 4-Apr-17 30-Dec-99 8 6 5 4 1 0 No 46.42 46.42 46.42 46.42 46.42 46.42 46.42

1777PoA0493 YAI840427GED7AYIRFYOFN9I95UKVR Renewable Energy Programme of Activities Africa Southeast Africa Malawi Malawi Hestian Ltd. Replaced At Validation Mixed renewables Mixed renewables Solar & wind & hydro EPIC n.a. Hestian 18-Feb-17 5-Apr-17 CPA 30-Dec-99CPA 10 8 5 9 0 No

1778CPA0493.01 Nkula A Hydropower Plant Retrofit Africa Southeast Africa Malawi Southern region Hestian Ltd. Replaced At Validation Hydro Hydro Run of river 1 53.4 7 21 1-Jul-18 133.6EPIC n.a. Hestian 18-Feb-17 5-Apr-17 31-Dec-99 10 8 5 9 0 No 26.68 53.35 53.35 53.35 53.35 53.35 53.35 26.68

1779PoA0494 UHAZ7NYTCLLTKVDINFOBVOKXNPB2CY Promoting energy efficiency in households for Zimbabwe Africa East Africa Zimbabwe Zimbabwe Sepoc Enterprises Pvt Ltd At Validation EE households EE households Lighting AMS-II.J. 1 77.9 0.0 294.8EPIC 0.000 n.a. Sepoc Enterprises 21-Mar-17 CPA 30-Dec-99PoA 6 5 1 8 10 11 2 0.0 No

1780CPA0494.01 Africa East Africa Zimbabwe Marondera Sepoc Enterprises Pvt Ltd At Validation EE households EE households Lighting AMS-II.J. 1 77.9 7 21 21-Mar-17 294.8EPIC n.a. Sepoc Enterprises 21-Mar-17 30-Dec-99 6 5 1 8 10 11 2 No 77.92 77.92 77.92 77.92 77.92 77.92 77.92

1781PoA0495 BETLE4ZPQIQY9JU5ZIKAP63NJEINQ5 Renewable Energy Programme of Activities Africa Southeast Africa Malawi Malawi Hestian Ltd. At Validation Mixed renewables Mixed renewables Solar & wind & hydro 1 53.4 0.0 133.6EPIC 0.000 n.a. Hestian 5-Apr-17 PoA0493 CPA 30-Dec-99CPA 10 8 5 9 0 0.0 No

1782CPA0495.01 Nkula A Hydropower Plant Retrofit Africa Southeast Africa Malawi Southern region Hestian Ltd. At Validation Hydro Hydro Run of river 1 53.4 7 21 1-Jul-18 133.6EPIC n.a. Hestian 5-Apr-17 CPA0493-01 31-Dec-99 10 8 5 9 0 No 26.68 53.35 53.35 53.35 53.35 53.35 53.35 26.68

1783PoA0496 UHJXQQ0B2YJW343LTK0HS8FF1ZFGF4 Clean Energy Program Supported by Republic of Korea Asia & Pacific East Asia Myanmar Myanmar ECOEYE At Validation EE households EE households Stoves 1 41.2 4-Apr-17 0.0 412.1KBS 0.000 n.a. ECOEYE 13-Apr-17 CPA 30-Dec-99CPA 8 6 5 4 1 0 0.0 No

1784CPA0496.01 CPA MM 01 Asia & Pacific East Asia Myanmar Myanmar ECOEYE At Validation EE households EE households Stoves AMS-II.G. 1 41.2 10 1-May-18 412.1KBS n.a. ECOEYE 13-Apr-17 30-Dec-99 8 6 5 4 1 0 0.0 No 12.63 29.58 41.91 46.67 46.52 46.67 46.52 46.67 46.52 46.67

1785PoA0497 U61XNJJVUE9I8UKFN8IPW5JZYR3RZN Africa West Africa Ghana Ghana AERA GROUP At Validation EE households EE households Stoves AMS-II.G. 1 10.0 26-Apr-17 0.0 30.0Earthhood 0.000 n.a. AERA GROUP 30-Jun-17 PoA 30-Dec-99PoA 6 10 9 2 0 0.0 No

1786CPA0497.01 Africa West Africa Ghana Brong-Ahafo Region AERA GROUP At Validation EE households EE households Stoves AMS-II.G. 1 10.0 7 21 1-Jan-18 30.0Earthhood n.a. AERA GROUP 30-Jun-17 30-Dec-99 6 10 9 2 0 No 8.93 12.16 11.40 7.64 4.85 12.86 12.16

1787PoA0498 M3QPLG76GIGTI7TOR8DLM41LJ3KB9H Peruvian PoA for NCRE projects Latin America South America Peru Peru ENGIE Energía Perú S.A. At Validation Mixed renewables Mixed renewables Solar & wind & hydro ACM2 1 51.7 18-Nov-15 0.0 155.2TÜV-Nord 0.000 n.a. ENGIE Energia 19-Jul-17 CPA 30-Dec-99PoA 10 1 5 11 3 40.0 No

1788CPA0498.01 Intipampa Solar PV CPA Latin America South America Peru Moquegua ENGIE Energía Perú S.A. At Validation Mixed renewables Mixed renewables Solar & wind & hydro ACM2 1 51.7 7 30 1-Jan-18 155.2TÜV-Nord n.a. ENGIE Energia 19-Jul-17 30-Dec-99 10 1 5 11 3 40.0 108404 0.456 No 52.45 52.45 52.45 52.45 52.45 52.45 52.45

1789PoA0499 MARKBYEM1G99K3SQSL8W7M0G750R8W Africa Southeast Africa Malawi Kenya, Malawi Hestian Innovation Ltd At Validation EE households EE households Stoves AMS-I.E.+AMS-II.G. 1 39.8 0.0 136.0BV Cert 0.000 n.a. Hestian 6-Aug-17 PoA 30-Dec-99PoA 1 6 5 8 10 3 0.0 No

1790CPA0499.01 Africa Southeast Africa Malawi Malawi Hestian Innovation Ltd At Validation EE households EE households Stoves AMS-I.E.+AMS-II.G. 1 39.8 7 21 1-Aug-17 136.0BV Cert n.a. Hestian 6-Aug-17 30-Dec-99 1 6 5 8 10 3 No 21.41 42.83 42.83 42.83 42.83 42.83 42.83

1791PoA0500 4WK33KSPNYV9LVY46IXR8TAFZPVDB7 Africa East Africa Rwanda Rwanda At Validation EE households EE households Stoves AMS-II.G.+AMS-I.E. 2 88.1 22-Jun-17 28.0 0.0 880.7 CTI 0.000 n.a. Inyenyeri 13-Oct-17 12-Jan-18 PoA 30-Dec-99PoA 6 2 8 1 0 0.0 No

1792CPA0500.01 Africa East Africa Rwanda Rubavu District At Validation EE households EE households Stoves AMS-II.G.+AMS-I.E. 1 44.0 10 5 1-Dec-17 440.4CTI n.a. Inyenyeri 13-Oct-17 12-Jan-18 30-Dec-99 6 2 8 1 0 No 44.04 44.04 44.04 44.04 44.04 44.04 44.04 44.04 44.04 44.04

1793CPA0500.02 Africa East Africa Rwanda Rubavu District At Validation EE households EE households Stoves AMS-II.G.+AMS-I.E. 1 44.0 10 5 1-Dec-17 440.4CTI n.a. Inyenyeri 13-Oct-17 12-Jan-18 30-Dec-99 6 2 8 1 0 No 44.04 44.04 44.04 44.04 44.04 44.04 44.04 44.04 44.04 44.04

1794PoA0501 7P1K5434XTPKX5RH4V2M2FKCJPVQZZ Promoting energy efficiency in households for Zimbabwe Africa East Africa Zimbabwe Zimbabwe Sepoc Enterprises Validation Terminated EE households EE households Lighting AMS-II.J.+ASB1 1 53.2 7 0.0 248.8EPIC 0.000 n.a. Sepoc Enterprises 24-Nov-17 PoA 30-Dec-99PoA 1 10 5 8 2 0.0 No

1795CPA0501.01 Promoting energy efficiency in households for Zimbabwe (CPA 1) Africa East Africa Zimbabwe Sepoc Enterprises Validation Terminated EE households EE households Lighting AMS-II.J.+ASB1 1 53.2 7 29-Apr-16 248.8EPIC n.a. Sepoc Enterprises 24-Nov-17 30-Dec-99 1 10 5 8 2 No 53.20 53.20 53.20 53.20 53.20 53.20 53.20

1796PoA0502 0CQ93VYA03J9GMXFUTLWFTBNSBAIWO Improved cookstove program in Bangladesh supported by the Republic of Korea Asia & Pacific Southern Asia Bangladesh EcoEye At Validation EE households EE households Stoves AMS-II.G. 1 751.5 0.0 248.8Earthhood 0.000 n.a. ECOEYE 15-Feb-18 PoA 30-Dec-99 6 10 9 2 0 0.0 No

1797CPA0502.01 Asia & Pacific Southern Asia Bangladesh EcoEye At Validation EE households EE households Stoves AMS-II.G. 1 751.5 22-Jun-18 248.8Earthhood n.a. ECOEYE 15-Feb-18 30-Dec-99 6 10 9 2 0 No 751.52 751.52 751.52 751.52 751.52 751.52 751.52

1798PoA0503 WT5GZS68YLDF84YQ6O266PIORE5KL2 Colombia Photovoltaic Incentive Programme Latin America South America Colombia At Validation Solar Solar Solar PV 1 7.4 7 0.0 22.2Earthhood 0.000 n.a. First Climate 6-Mar-18 PoA 30-Dec-99PoA 1 10 5 0 0.0 No

1799CPA0503.01 SSC CPA1 Latin America South America Colombia At Validation Solar Solar Solar PV 1 7.4 7 21 1-Jan-18 22.2Earthhood n.a. First Climate 6-Mar-18 30-Dec-99 1 10 5 0 No 7.39 7.39 7.39 7.39 7.39 7.39 7.39

1800PoA0504 DSZSNA6Q8U6F9GIY2PCZWSQ7A3MHEA Asia & Pacific Southern Asia Sri Lanka At Validation Mixed renewables Mixed renewables Solar & wind AMS-I.D. 4 58.0 0.0 150.1 CCSC 0.000 n.a. Ecoeye 16-Mar-18 CPA 31-Dec-99CPA 1 10 5 11 8 0 40.0 No

1801CPA0504.01 10MW Solar One Ceylon (Pudukadumalai) Solar Power Project Asia & Pacific Southern Asia Sri Lanka At Validation Solar Solar Solar PV AMS-I.D. 1 15.0 7 30 1-Jun-18 38.7CCSC n.a. Ecoeye 16-Mar-18 31-Dec-99 1 10 5 11 8 0 10.0 19727 0.759 No 14.98 14.98 14.98 14.98 14.98 14.98 14.98

1802CPA0504.02 10MW Nedunkulam Solar Power Project Asia & Pacific Southern Asia Sri Lanka At Validation Solar Solar Solar PV AMS-I.D. 1 12.9 7 30 1-Jun-18 33.5CCSC n.a. Ecoeye 16-Mar-18 31-Dec-99 1 10 5 11 8 0 10.0 17038 0.759 No 12.94 12.94 12.94 12.94 12.94 12.94 12.94

1803CPA0504.03 10MW Anorchi (Baruthankanda) Solar Power Project Asia & Pacific Southern Asia Sri Lanka At Validation Solar Solar Solar PV AMS-I.D. 1 15.1 7 30 1-Jun-18 39.0CCSC n.a. Ecoeye 16-Mar-18 31-Dec-99 1 10 5 11 8 0 10.0 19841 0.759 No 15.07 15.07 15.07 15.07 15.07 15.07 15.07

1804CPA0504.04 Iris (Baruthankanda) Solar Power Project Asia & Pacific Southern Asia Sri Lanka At Validation Solar Solar Solar PV AMS-I.D. 1 15.1 7 30 1-Jun-18 39.0CCSC n.a. Ecoeye 16-Mar-18 31-Dec-99 1 10 5 11 8 0 10.0 19841 0.759 No 15.07 15.07 15.07 15.07 15.07 15.07 15.07

1805PoA0505 SWXCMYHCILVLT7A2QTEK0VTT3OUJEL The Haidar El Ali Mangrove Initiative (HEAMI) Africa West Africa Senegal At Validation Reforestation Reforestation Reforestation AR-AMS3+AR-AM14 1 233.2 10 30 0.0 2331.6EPIC 0.000 n.a. Oceanium 20-Mar-18 PoA 30-Dec-99PoA 5 7 3 0 0.0 No

1806CPA0505.01 The Haidar El Ali Mangrove Initiative (HEAMI). CPA 1 Africa West Africa Senegal At Validation Reforestation Reforestation Reforestation AR-AMS3+AR-AM14 1 233.2 10 30 1-Jul-18 2331.6EPIC n.a. Oceanium 20-Mar-18 30-Dec-99 5 7 3 0 No 10.00 80.00 338.00 958.00 2146.00 3954.00 6386.00 9444.00

1807PoA0506 CB6JG08HSVIOVTI2SSVS5OEV5F79VR Latam Landfill PoA Latin America South America Brazil Brazil BENG Engenharia Ltda. At Validation Landfill gas Landfill gas Landfill power ACM1 1 0.0 7 0.0 0.0Earthhood 0.000 n.a. BENG Engenharia 6-Apr-18 CPA 30-Dec-99PoA 5 10 0 0.0 No

1808CPA0506.01 CPA not available Latin America South America Brazil BENG Engenharia Ltda. At Validation Landfill gas Landfill gas Landfill power ACM1 1 0.0 7 1-Jun-18 0.0Earthhood n.a. BENG Engenharia 6-Apr-18 30-Dec-99 5 10 0

1809PoA0507 LVHQHYFKDG1MUQ2R7SI4MKGARZZCFC SHINE – Distribution of LED Lightbulbs in India Asia & Pacific Southern Asia India India At Validation EE households EE households Lighting AMS-II.C. 1 400.0 7 16 0.0 1034.6Carbon Check 0.000 n.a. C Quest Capital 24-Apr-18 PoA 31-Dec-99PoA 5 6 10 0 0.0 No

1810CPA0507.01 SHINE – Distribution of LED Lightbulbs in India-1 Asia & Pacific Southern Asia India Telangana At Validation EE households EE households Lighting AMS-II.C. 1 400.0 7 16 1-Jun-18 1034.6Carbon Check n.a. C Quest Capital 24-Apr-18 30-Dec-99 5 6 10 0 No 400.04 400.04 400.04 400.04 400.04 400.04 400.04

222.722

The CPA aims to disseminate efficient improved cooking stove sing le pot type based on woody b iomass to the rural household of Madagascar

The CPA aims to disseminate efficient improved cooking stove sing le pot type based on woody b iomass to the rural household of Madagascar

The overall objective is to encourage the use of renewable energy to meet an increasing demand for electricity in Malawi and reduce carbon emissions.

AMS-I.A.+ACM2+AMS.I.D

The CPA foresees the retrofit and modernisation of Nkula A Hydropower Plant

AMS-I.A.+ACM2+AMS.I.D

The energy efficiency programme is targeting nationwide implementation of efficient l ighting technologies

Promoting energy efficiency in households for Zimbabwe (CPA 1) This CPA aims at rep lacing the incandescent lamps (baseline lamps) with the L ighting Emitting Diodes (LEDs) (pro ject lamps) in Marondera town

The overall objective is to encourage the use of renewable energy to meet an increasing demand for electricity in Malawi and reduce carbon emissions.

AMS-I.A.+ACM2+AMS.I.D

The CPA foresees the retrofit and modernisation of Nkula A Hydropower Plant

AMS-I.A.+ACM2+AMS.I.D

The objective is to promote diss emination of Improved Cooking Devices

AMS-I.E.+AMS-II.G.+AMS.III.R

Improved heating, drying and cooking devices, biogas digesters

Man and Man Enterprise Improved Cooking Stoves CDM Programme in Ghana supported by Republic o f Korea

The objective is to reduce non-renewable wood fuel consumption and greenhouse gas emissions of users by sell ing affordable ICSs in replacement o f tradi tional cooking stoves

Man and Man Enterprise Improved Cooking Stoves CDM Programmein Ghana supported by Republ ic of K orea – CPA001

Affordable Improved Cooking Stoves (ICSs)

The PoA seeks to foster the implementation of mul tiple NCRE pro jects, providing an important contribution to renewable and clean non-conventional al ternatives for electricity generation

Installation of a Greenfield so lar photovol ta ic (PV) power p lant

Energy efficiency and renewable energy measures in thermal applications of biomass

The PoA introduces efficient thermal energy generation units utilizing non-renewable b iomass or re tro fi tting of existing units

Energy efficiency measures in thermal applications of biomass CPA 1 The CPA aims to in itial ly disseminate approximately 2 730 improved institu tional stoves that are more efficient and use less wood for cooking

Sustainable Fuelwood and Microgasification Cooking Solutions for rura l and urban Households

“Inyenyeri” A Rwandan Socia l Benefit Company

The PoA distributes highly e fficient microgasi fcation cook stoves and pellets to households

Sustainable Fuelwood and Microgasification CookingSolutions for rura l and urban Households – CPA1

“Inyenyeri” A Rwandan Socia l Benefit Company

The CPA aims at disseminating microgasification cookstoves burning fuelwood pel lets very efficiently and clean.

Sustainable Fuelwood and Microgasification CookingSolutions for rura l and urban Households – CPA2

“Inyenyeri” A Rwandan Socia l Benefit Company

The CPA aims at disseminating microgasification cookstoves burning fuelwood pel lets very efficiently and clean.

The PoA targets nationwide implementation of efficient l ighting technologies

The CPA wi ll employ quali ty long li fe self-ba llasted (in tegrated) LEDs as rep lacement for incandescent lamps (ICL) and CFL in residential

Widespread adoption of ICS to households across Bangladesh.

Improved cookstove program in Bangladesh supported by theRepublic of Korea – CPA 01

Temporary Union “Bonos Fotovol ta icos”

The PoA aims to promote the implementation of photovoltaic (PV) power generation

AMS-I.A.+ACM2+AMS-I.F.+AMS-I.D.

Temporary Union “Bonos Fotovol ta icos”

The CPA generates renewable electric energy

AMS-I.A.+ACM2+AMS-I.F.+AMS-I.D.

Programme of Activities for Smal l Scale Solar and Wind Power Generation in Sri Lanka

Koho Trading & Consultancy (Private) Limited

The PoA involves implementation of small -scale solar and wind pro jects

Koho Trading & Consultancy (Private) Limited

The pro ject activity is the instal lation of a new grid-connected 10 MW solar photovol ta ic (PV) power p lant

Koho Trading & Consultancy (Private) Limited

The pro ject activity is the instal lation of a new grid-connected 10 MW solar photovol ta ic (PV) power p lant

Koho Trading & Consultancy (Private) Limited

The pro ject activity is the instal lation of a new grid-connected 10 MW solar photovol ta ic (PV) power p lant

Koho Trading & Consultancy (Private) Limited

The pro ject activity is the instal lation of a new grid-connected 10 MW solar photovol ta ic (PV) power p lant

Guinea-Bissau, Gambia

EPIC S ustainabi lity Services Pvt. Ltd.

The PoA is a plan for the reforestation of the degraded lands in the mangrove patches

EPIC S ustainabi lity Services Pvt. Ltd.

The CPA wi ll estab lish a total o f 2,000 ha of plantations

The objective to avoid emission of Greenhouse Gases (GHG) through col lection, flaring/combustion and energy use of the LFG

Brightspark Energy Private Limi ted

Distribution of LED Lightbulbs in Ind ia to reduce fossil -fuel based electricity consumption for l ighting

Brightspark Energy Private Limi ted

Distribution of L ight Emitting Diodes (LEDs) for domestic lighting in the households, smal l & medium enterprises (SMEs)

The Pipeline was produced by Joergen Fenhann, UNEP DTU Partnership, 1st June 2018, [email protected], Phone (+45)40202789

Table 1Status of PoAs NumberAt validation 83Request for registration 1Request for review 0Correction requested 0Under review 0Total in the process of registration 1Withdrawn 5Rejected by EB 3Validation negative by DOE 0Validation terminated by DOE 71Registered, no issuance of CERs 260Registered, CER issued 51Total registered 311Total number of different PoA-DDs 474Replaced PDDs 31Total number of PoA-DDs submitted 505

Table 2 (this table do not include PoAs that are rejected, terminated or resubmitted)Number of PoAs

Type Sub-types used in CDM projects At Request Registered Total Of thesevalidation with issuance

Agriculture Irrigation 0 0 1 1 0total: Energy efficiency 0 0 0 0 0

1 Alternative fertilisers 0 0 0 0 0No tillage 0 0 0 0 0Rice crops 0 0 0 0 0Bagasse power 0 0 1 1 0

Biomass Palm oil solid waste 2 0 1 3 0Energy Agricultural residues: other kinds 2 0 0 2 0total: Agricultural residues: rice husk 2 0 2 4 0

18 Agricultural residues: mustard crop 0 0 0 0 0Agricultural residues: poultry litter 0 0 0 0 0Black liquor 0 0 0 0 0Forest residues: sawmill waste 0 0 0 0 0Forest residues: other 1 0 1 2 0Forest biomass 0 0 0 0 0Industrial waste 0 0 0 0 0Gasification of biomass 2 0 1 3 0Switch from fossil fuel to piped biogas 0 0 0 0 0Biomass briquettes 1 0 2 3 1Biodiesel 0 0 0 0 0Biodiesel from waste oil 0 0 0 0 0Ethanol 0 0 0 0 0

Cement Clinker replacement 0 0 0 0 0CO2 usage CO2 recycling 0 0 0 0 0

0 CO2 replacement 0 0 0 0 0Coal Mine Methane 1 0 1 2 0

Coal Mine/ Coal Bed Methane 0 0 0 0 0bed CH4 CMM & Ventilation Air Methane 0 0 1 1 0

4 Ventilation Air Methane 1 0 0 1 0District heating 0 0 0 0 0

Energy Replacement of district heating boilers 0 0 0 0 0distribution Connection of Isolated grid 0 0 1 1 0

5 Efficient electricity distribution 0 0 4 4 1EE Lighting 4 0 24 28 2

Solar lamps 2 0 9 11 0Households: Stoves 8 0 55 63 23

108 Lighting & Insulation & Solar 1 0 0 1 0Appliances 0 0 5 5 2Chemicals 0 0 0 0 0

EE Petrochemicals 0 0 0 0 0industry Paper 0 0 0 0 0

total: Cement 0 0 0 0 08 Iron & steel 0 0 2 2 0

Machinery 0 0 0 0 0

Textiles 0 0 1 1 0Electronics 0 0 0 0 0Food 0 0 0 0 0Building materials 2 0 2 4 0Glass 0 0 0 0 0Non-ferrous metals 0 0 0 0 0Coke oven 0 0 0 0 0Mining 0 0 0 0 0Construction 0 0 1 1 0Metal products 0 0 0 0 0Wood 0 0 0 0 0Recycling 0 0 0 0 0Chemicals heat 1 0 0 1 0

EE Petrochemicals heat 0 0 0 0 0Own generation Carbon black gas 0 0 0 0 0

total: Cement heat 0 0 0 0 01 Iron & steel heat 0 0 0 0 0

Building materials heat 0 0 0 0 0Glass heat 0 0 0 0 0Non-ferrous metals heat 0 0 0 0 0Coke oven gas 0 0 0 0 0HVAC & lighting 3 0 0 3 0

EE Air conditioning 0 0 0 0 0service EE new buildings 0 0 0 0 0total: Street lighting 0 0 2 2 019 Lighting in service 0 0 3 3 0

Water pumping 0 0 0 0 0Water purification 0 0 5 5 1EE public stoves 0 0 0 0 0EE public buildings 1 0 0 1 0EE commercial buildings 4 0 1 5 0Single cycle to combined cycle 0 0 0 0 0Cogeneration 0 0 1 1 0Co-firing with biomass 0 0 0 0 0

EE Higher efficiency coal power 2 0 0 2 0

supply side Higher efficiency oil power 0 0 0 0 0total: Higher efficiency using waste heat 0 0 0 0 0

3 Power plant rehabilitation 0 0 0 0 0Higher efficiency steam boiler 0 0 0 0 0

Forests Afforestation 1 0 0 1 03 Mangroves 0 0 0 0 0

Agroforestry 0 0 0 0 0Reforestation 2 0 0 2 0Coal to natural gas 0 0 0 0 0

Fossil Coal to oil 0 0 0 0 0fuel switch Lignite to natural gas 0 0 0 0 0

total: New natural gas plant 0 0 0 0 03 New natural gas plant using LNG 0 0 0 0 0

Oil to electricity 0 0 0 0 0Oil to LPG 1 0 1 2 0Oil to natural gas 0 0 1 1 0Oil field flaring reduction 1 0 2 3 0

Fugitive Oil and gas processing flaring 0 0 0 0 0total: Natural gas pipelines 0 0 0 0 0

3 Non-hydrocarbon mining 0 0 0 0 0Spontaneously ignition of coal piles 0 0 0 0 0Charcoal production 0 0 0 0 0

Geothermal Geothermal electricity 0 0 1 1 02 Geothermal heating 0 0 1 1 0

HFCs HFC23 0 0 0 0 00 HFC134a 0 0 0 0 0

Hydro Run of river 3 0 28 31 3total: Existing dam 0 0 2 2 0

Higher efficiency hydro power 0 0 0 0 038 New dam 1 0 4 5 0

Landfill flaring 0 0 1 1 0Landfill gas Landfill power 5 0 5 10 2

total: Combustion of MSW 1 0 0 1 018 Gasification of MSW 0 0 0 0 0

B138
Including incineration

Biogas from MSW 1 0 2 3 1Landfill aeration 0 0 0 0 0Integrated solid waste management 0 0 0 0 0Switch from fossil fuel to piped landfill gas 0 0 0 0 0Landfill composting 1 0 2 3 1Manure 5 0 17 22 2Domestic manure 2 0 13 15 3

Methane Waste water 2 0 7 9 0avoidance Industrial solid waste 0 0 0 0 0

59 Palm oil waste 2 0 7 9 0Aerobic treatment of waste water 0 0 0 0 0Composting 0 0 4 4 0

Mixed Solar & wind 0 0 0 0 1Solar & hydro 0 0 1 1 0

renewables Solar & wind & hydro 1 0 0 1 02 Solar & wind & other 0 0 0 0 0

Wind & hydro 0 0 0 0 0N2O Adipic acid 0 0 0 0 0total: Nitric acid 0 0 0 0 0

0 Caprolactam 0 0 0 0 0PFCs+SF6 PFCs 0 0 0 0 0

0 SF6 0 0 0 0 0Solar Solar PV 7 1 45 53 5

Solar PV water disinfection 0 0 1 1 0total: Solar thermal power 0 0 1 1 068 Solar thermal 0 0 0 0 0

Solar water heating 3 0 10 13 2Solar cooking 0 0 0 0 0

Tidal Tidal 0 0 0 0 0Bus Rapid Transit 0 0 0 0 0

Transport Motorbikes 0 0 0 0 0

total: Mode shift: Road to rail 0 0 3 3 07 More efficient train system 0 0 0 0 0

More efficient vehicles 1 0 2 3 0Rail: regenerative braking 0 0 0 0 0Metro: efficient operation 0 0 0 0 0Scrapping old vehicles 0 0 1 1 1Biodiesel for transport 0 0 0 0 0Cable cars 0 0 0 0 0

Wind Wind 3 0 22 25 0Offshore wind 0 0 0 0 0

Total 83 1 311 395 51

Table 5 (this table do not include PoAs that are rejected, terminated or resubmitted)Host region/Host country of first CPA At validation Request registration

Number kCERs 2012 kCERs Number kCERsLatin America 14 266 652 0 0Argentina 1 65 0 0 0

D196
1 kCER = 1000 CER
E196
1 kCER = 1000 CER

BahamasBarbados 1 14.00 0 0 0BelizeBoliviaBrazil 4 68 0 0 0Chile 1 32 0 0 0Colombia 2 8 0 0 0Costa RicaCubaDominican RepublicEcuador 0 0 0 0 0El Salvador 0 0 0 0 0Guatemala 0 0 0 0 0GuyanaHaiti 0 0 0 0 0Honduras 0 0 0 0 0JamaicaMexico 2 22 21 0 0Nicaragua 1 5 25 0 0PanamaParaguayPeru 2 52 606 0 0Trinidad and Tobago 0 0 0 0 0Uruguay 0 0 0 0 0Asia & Pacific 45 2956 572 0 0Bangladesh 3 804 2 0 0BhutanCambodia 0 0 0 0 0China 13 875 333 0 0FijiIndia 7 647 109 0 0Indonesia 4 265 39 0 0Lao PDRMalaysia 4 121 3 0 0

Mongolia 0 0 0 0 0Myanmar 1 41 0 0 0Nepal 0 0 0 0 0North Korea 0 0 0 0 0Pakistan 1 7 0 0 0Papua New Guinea 0 0 0 0 0Philippines 4 55 54 0 0Singapore 2 5 1 0 0South Korea 2 14 33 0 0Sri Lanka 3 93 0 0 0Thailand 0 0 0 0 0Timor-Leste 0 0 0 0 0Vanuatu 0 0 0 0 0Vietnam 1 31 0 0 0Europe & Central Asia 1 2 0 0 0Albania 0 0 0 0 0Armenia 1 2 0 0 0AzerbaijanBosnia and HerzegovinaCyprusGeorgiaKyrgyzstanMacedonia 0 0 0 0 0MaltaMoldovaMontenegroSerbiaTajikistanTurkmenistanUzbekistanAfrica 22 1253 207 1 68AlgeriaAngolaBurkina Faso 0 0 0 0 0Burundi 0 0 0 0 0

Cameroon 0 0 0 0 0Cape VerdeChad 0 0 0 0 0Congo DR 0 0 0 0 0Côte d'Ivoire 1 60 0 0 0Djibouti 0 0 0 0 0Egypt 0 0 0 0 0Equatorial GuineaEthiopia 0 0 0 0 0GabonGambiaGhana 1 10 0 0 0Kenya 2 120 0 0 0LesothoLiberia 0 0 0 0 0LibyaMadagascar 0 0 0 0 0Malawi 2 93 0 0 0Mali 1 7 0 0 0MauritiusMorocco 0 0 0 0 0Mozambique 1 232 0 0 0Namibia 0 0 0 0 0NigerNigeria 1 64 43 0 0Rwanda 1 88 0 0 0Senegal 1 233 0 1 68Sierra Leone 0 0 0 0 0Somalia 0 0 0 0 0South Africa 6 139 70 0 0Sudan 0 0 0 0 0SwazilandTanzania 1 50 35 0 0Togo 0 0 0 0 0Tunisia 0 0 0 0 0

Uganda 2 68 59 0 0Zambia 1 12 0 0 0Zimbabwe 1 78 0 0 0Middle East 1 3 0 0 0Iran 0 0 0 0 0IraqIsrael 0 0 0 0 0JordanKuwaitLebanon 1 3 0 0 0OmanQatarSaudi Arabia 0 0 0 0 0SyriaUnited Arab Emirates 0 0 0 0 0Yemen 0 0 0 0 0Total 83 4478 1431 1 68LDC countries 14 1627 96 1 68

Table 6:% comparison of regional distribucion of pCDM vs CDMRegion pCDM CDM pCDM CDMLatin America 16% 13% 65 1097Asia & Pacific 48% 82% 188 6832Europe & Central Asia 1% 1.0% 3 84Africa 33% 2.9% 132 242Middle-East 2% 1.3% 7 111LDCs 19% 1.6% 77 130Total 100.0% 100.0% 395 8366

Latin America Asia & Pacific Europe & Central Asia

Africa Middle-East LDCs0%

10%

20%

30%

40%

50%

60%

70%

80%

90%

16%

48%

1%

33%

2%

19%

13%

82%

1.0% 2.9% 1.3% 1.6%

% comparison of regional distribution of pCDM and CDM

pCDM CDM

Table 7:Multi country PoAs covering NumberGlobal 2All LDC countries 1All Middle East countries 1 3-5 Middle East countries 4All ASEAN countries 1 3-10 countries in Asia 321 countires in Asia and Latin America 1 2-3 countrins in Latin America 6All Latin America and Africa 2All Africa 1All Southern Africa 32-3 African countries 18 4-8 African countries 15>10 African countries 8Total multicountry PoAs 66

Latin America Asia & Pacific Europe & Central Asia

Africa Middle-East LDCs0%

10%

20%

30%

40%

50%

60%

70%

80%

90%

16%

48%

1%

33%

2%

19%

13%

82%

1.0% 2.9% 1.3% 1.6%

% comparison of regional distribution of pCDM and CDM

pCDM CDM

The Pipeline was produced by Joergen Fenhann, UNEP DTU Partnership, 1st June 2018, [email protected], Phone (+45)40202789

kCERs Number of MW kCERs Number ofissued for CPAs Total issued for CDM projects

PoAs for PoAs CDM+PoAs +CPAs Chart 1:0 1 0 0 20 0 0 0 00 0 0 0 00 0 0 0 00 0 0 0 00 1 91 9906 1170 3 12 5681 490 3 12 17147 2617 25 28 9473 174

Dec

/07

Mar

/08

Jun/

08S

ep/0

8D

ec/0

8M

ar/0

9Ju

n/09

Sep

/09

Dec

/09

Mar

/10

Jun/

10S

ep/1

0D

ec/1

0M

ar/1

1Ju

n/11

Sep

/11

Dec

/11

Mar

/12

Jun/

12S

ep/1

2D

ec/1

2M

ar/1

3Ju

n/13

Sep

/13

Dec

/13

Mar

/14

Jun/

14S

ep/1

4D

ec/1

4M

ar/1

5Ju

n/15

Sep

/15

Dec

/15

Mar

/16

Jun/

16S

ep/1

6D

ec/1

6M

ar/1

7Ju

n/17

Sep

/17

Dec

/17

Mar

/18

0

5

10

15

20

25

Number of CDM PoAs starting the public comments period each month

Number of different PoAs submitted, that are alive

Num

ber o

f Pro

ject

s ea

ch m

onth

0 0 0 763 110 0 0 299 70 0 0 1440 80 0 0 7554 370 3 15 2957 380 0 0 339 80 0 0 24 90 4 0 1 160 0 0 18 33 12 0 45 340 0 0 0 20 0 0 0 10 0 0 0 00 0 0 12397 250 0 0 10 30 0 0 0 10 2 3 59730 800 0 0 0 20 1 5 222 180 1 2 0 110 0 0 2349 110 0 0 0 20 3 0 316 6

76 10 0 76 142906 163 0 3638 207

0 14 0 0 183047 277 0 3504 319

0 1 0 10 2712 17 0 886 20

0 0 0 1058 180 0 0 2171 160 0 0 493 150 0 0 51 90 2 0 7 90 0 0 0 5

Dec

/07

Mar

/08

Jun/

08S

ep/0

8D

ec/0

8M

ar/0

9Ju

n/09

Sep

/09

Dec

/09

Mar

/10

Jun/

10S

ep/1

0D

ec/1

0M

ar/1

1Ju

n/11

Sep

/11

Dec

/11

Mar

/12

Jun/

12S

ep/1

2D

ec/1

2M

ar/1

3Ju

n/13

Sep

/13

Dec

/13

Mar

/14

Jun/

14S

ep/1

4D

ec/1

4M

ar/1

5Ju

n/15

Sep

/15

Dec

/15

Mar

/16

Jun/

16S

ep/1

6D

ec/1

6M

ar/1

7Ju

n/17

Sep

/17

Dec

/17

Mar

/18

0

5

10

15

20

25

Number of CDM PoAs starting the public comments period each month

Number of different PoAs submitted, that are alive

Num

ber o

f Pro

ject

s ea

ch m

onth

0 1 0 80 3 Table 4:0 0 0 0 5 Type PoAs PoAs% Normal %0 0 0 2 4 EE demand side 135 34.2% 3.0%0 4 0 423 27 Waste 77 19.5% 13.0%0 0 0 41 2 Solar 68 17.2% 5.4%0 0 0 649 7 Hydro 38 9.6% 26.2%0 0 0 0 0 Wind 25 6.3% 30.8%0 0 0 15 4 Biomass energy 18 4.6% 8.7%0 1 0 0 1 EE supply side 9 2.3% 5.7%0 0 0 0 0 Transport 7 1.8% 0.4%0 0 0 0 0 Coal Mine Methane 4 1.0% 1.3%0 0 0 0 1 Fossil fuel switch 3 0.8% 1.5%0 1 0 2260 19 Forestry & Agriculture 4 1.0% 0.9%0 0 0 1669 10 Fugitive 3 0.8% 1.0%0 0 0 387 6 Geothermal 2 0.5% 0.4%0 0 0 10971 150 Mixed renewables 2 0.5% 0.01%0 0 0 53212 109 Industrial gases 0 0.0% 1.7%0 0 0 165 1 Total PoAs 395 100.0% 100.0%0 0 0 0 50 0 0 114 70 0 0 12925 600 3 0 0 17 Chart 3:0 0 0 95 10 0 0 9 50 29 0 0 320 3 0 0 40 0 0 0 2

35 47 0 35 480 0 0 0 30 1 0 124 50 5 0 0 90 0 0 3919 300 1 2 113 320 0 0 0 00 2 0 2880 17

EE deman

d side

Waste Solar

HydroWind

Biomass energ

y

EE su

pply side

Transp

ort

Coal Mine M

ethan

e

Fossi

l fuel s

witch

Fores

try & Agri

cultu

re

Fugiti

ve

Geotherm

al

Mixed re

newab

les

Industrial

gases

-5%

0%

5%

10%

15%

20%

25%

30%

35%

Number of PoAs compared to normal CDM

PoAs%Normal %

0 0 0 53 20 0 0 476 40 0 0 246 80 0 0 54 30 1 0 751 120 0 0 0 10 0 0 419 40 2 0 11208 570 0 0 541 170 0 0 0 00 0 0 0 00 0 0 47298 560 0 0 14697 140 0 0 0 10 2 0 0 20 1 0 4232 380 3 11 24611 270 0 0 165 140 0 0 16480 150 0 0 36 10 0 0 0 00 0 0 100 7 Most active host countries:0 1 35 11849 330 1 0 28 40 0 0 539942 190 0 0 0 3 Top 10 host countires for submitted PoAs PoAs

476 97 165 152266 1676 China 560 2 35 12301 101 India 380 0 0 420 4 South Africa 370 12 37 119960 518 Kenya 180 1 0 41842 129 Indonesia 14

1255 12 46 57437 197 Brazil 140 1 18 2630 41 Chile 110 0 0 0 3 Vietnam 10

EE deman

d side

Waste Solar

HydroWind

Biomass energ

y

EE su

pply side

Transp

ort

Coal Mine M

ethan

e

Fossi

l fuel s

witch

Fores

try & Agri

cultu

re

Fugiti

ve

Geotherm

al

Mixed re

newab

les

Industrial

gases

-5%

0%

5%

10%

15%

20%

25%

30%

35%

Number of PoAs compared to normal CDM

PoAs%Normal %

24 3 1 24 5 Mexico 100 0 0 0 1 South Korea 90 0 0 259 100 0 0 19 2

17 15 0 1380 45 Top 10 host countires for submitted CPAs CPAs41 1093 3 15223 1350 Brazil 1076

2761 108 0 4975 153 India 1800 12 5 13552 294 China 1560 0 0 0 0 South Africa 660 14 7 162 67 Uganda 600 0 0 242 2 Bangladesh 490 5 0 277 51 Kenya 60

10 1 0 18 18 Vietnam 450 1 0 0 1 Mexico 350 1 40 0 1 Madagascar 310 0 0 0 10 0 0 31 10 0 0 250792 40 0 0 79641 980 0 0 2015 30 0 0 105 60 0 0 7426 12 Most popular sub-types:

1783 135 741 4630 5290 1 0 0 3 Top 10 sub-types of submitted PoAs PoAs0 1 100 495 14 EE households: stoves 630 0 0 0 2 Solar PV 53

477 32 0 616 38 Hydro: run of river 310 0 0 2715 18 EE households: lighting 280 0 0 1727 1 Wind 250 0 0 1092 14 Methane avoidance: manure 220 0 0 0 4 Methane avoidance: domestic manure 15

0 5 0 2487 13 Solar water heating 130 0 0 0 0 Methane avoidance: waste water 90 3 0 1 4 Methane avoidance: palm oil waste 90 0 0 225 10 0 0 0 0 Top 10 sub-types of submitted CPAs CPAs

223 3 0 223 3 Methane avoidance: manure 10930 0 0 0 3 EE households: stoves 2770 0 0 17 1 EE households: lighting 1630 51 1268 236133 2627 Solar PV 1350 0 0 0 2 Methane avoidance: domestic manure 108

13852 2261 2679 1919199 10627 Hydro: run of river 97Wind 51Solar water heating 32Agricultural residues: rice husk 25Methane avoidance: palm oil waste 14

Request registration Registered Total Issued2012 kCERs Number kCERs 2012 kCERs Number kCERs 2012 kCERs 2020 kCERs Number

0 51 7709 2686 65 16.5% 7975 3338 42.1% 52482 60 1 24 0 2 0.5% 89 0 0.0% 715 0

N196
1 kCER = 1000 CER

0.0% 0.0%0 0 0 0 1 0.3% 14 0 0.0% 56 0

0.0% 0.0%0.0% 0.0%

0 10 4496 2517 14 3.5% 4564 2517 31.8% 26999 10 10 858 1 11 2.8% 890 1 0.0% 6547 10 3 205 0 5 1.3% 214 0 0.0% 2087 0

0.0% 0.0%0.0% 0.0%0.0% 0.00%

0 1 14 0 1 0.3% 14 0 0.0% 115 00 2 101 55 2 0.5% 101 55 0.7% 862 00 3 149 0 3 0.8% 149 0 0.0% 821 0

0.0% 0.00%0 2 68 0 2 0.5% 68 0 0.0% 566 00 3 463 35 3 0.8% 463 35 0.4% 2095 1

0.0% 0.0%0 8 717 75 10 2.5% 739 96 1.2% 7090 20 2 120 3 3 0.8% 124 28 0.4% 1000 0

0.0% 0.0%0.0% 0.0%

0 4 221 0 6 1.5% 273 606 7.7% 1432 10 1 82 0 1 0.3% 82 0 0.0% 576 00 1 190 0 1 0.3% 190 0 0.0% 1522 00 143 15656 2797 188 47.6% 18612 3369 42.5% 142025 170 8 1713 83 11 2.8% 2517 84 1.1% 12061 2

0.0% 0.0%0 1 8 0 1 0.3% 8 0 0.0% 35 00 43 2709 107 56 14.2% 3583 440 5.6% 29441 2

0.0% 0.0%0 31 6245 2139 38 9.6% 6892 2247 28.4% 54953 50 10 293 68 14 3.5% 558 107 1.3% 5463 0

0.0% 0.0%0 5 424 76 9 2.3% 545 79 1.0% 5311 0

0 1 150 0 1 0.3% 150 0 0.0% 891 10 1 34 0 2 0.5% 75 0 0.0% 754 00 4 696 126 4 1.0% 696 126 1.6% 5060 20 2 160 0 2 0.5% 160 0 0.0% 1132 00 4 672 3 5 1.3% 678 3 0.0% 6651 00 1 35 0 1 0.3% 35 0 0.0% 178 00 4 1033 40 8 2.0% 1087 94 1.2% 9316 10 1 6 0 3 0.8% 11 1 0.0% 111 00 7 24 0 9 2.3% 38 33 0.4% 333 00 2 54 1 5 1.3% 146 1 0.0% 593 10 7 247 4 7 1.8% 247 4 0.0% 2222 20 1 138 0 1 0.3% 138 0 0.0% 664 00 1 11 0 1 0.3% 11 0 0.0% 80 00 9 1005 151 10 2.5% 1035 151 1.9% 6776 10 2 20 0 3 0.8% 21 0 0.0% 172 00 1 9 0 1 0.3% 9 0 0.0% 55 00 0 0 0 1 0.3% 2 0 0.0% 11 0

0.0% 0 0.0%0.0% 0.0%0.0% 0 0.0%0.0% 0 0.0%0.0% 0 0.0%

0 1 11 0 1 0.3% 11 0 0.0% 106 00.0% 0 0.0%0.0% 0 0.0%0.0% 0.0%

0 0.0% 0 0.0%0 0.0% 0 0.0%

0.0% 0.0%0 0.0% 0 0 0.0%

0 109 21894 985 132 33.4% 23214 1192 15.0% 167001 280.0% 0.0%0.0% 0.0%

0 1 50 0 1 0.3% 50 0 0.0% 443 10 1 168 41 1 0.3% 168 41 0.5% 1375 0

0 1 72 0 1 0.3% 72 0 0.0% 629 20.0% 0.0%

0 0 83 0 0 0.0% 83 0 0.0% 554 00 2 123 23 2 0.5% 123 23 0.3% 783 00 1 184 0 2 0.5% 244 0 0.0% 1873 00 0 73 0 0 0.0% 73 0 0.0% 295 00 2 21 0 2 0.5% 21 0 0.0% 214 1

0.0% 0.0%0 6 669 10 6 1.5% 669 10 0.1% 7975 1

0.0% 0.0%0.0% 0.0%

0 5 667 7 6 1.5% 677 7 0.1% 5114 00 16 2592 65 18 4.6% 2712 65 0.8% 16521 4

0.0% 0.0%0 0 145 0 0 0.0% 145 0 0.0% 1108 1

0.0% 0.0%0 2 3349 0 2 0.5% 3349 0 0.0% 18529 00 6 1578 63 8 2.0% 1671 63 0.8% 7921 20 2 78 0 3 0.8% 85 0 0.0% 754 1

0.0% 0.0%0 3 813 0 3 0.8% 813 0 0.0% 5822 10 2 273 0 3 0.8% 504 0 0.0% 4215 00 0 60 0 0 0.0% 60 0 0.0% 403 0

0.0% 0.0%0 4 884 23 5 1.3% 947 66 0.8% 6582 20 7 1055 58 8 2.0% 1143 58 0.7% 8067 30 3 116 19 5 1.3% 416 19 0.2% 3358 00 0 112 0 0 0.0% 112 0 0.0% 747 00 0 92 0 0 0.0% 92 0 0.0% 596 00 31 5149 503 37 9.4% 5288 573 7.2% 50932 20 1 56 0 1 0.3% 56 0 0.0% 391 0

0.0% 0.0%0 2 108 3 3 0.8% 157 38 0.5% 1122 00 2 189 0 2 0.5% 189 0 0.0% 1192 10 1 42 16 1 0.3% 42 16 0.2% 418 1

0 6 2556 154 8 2.0% 2623 213 2.7% 14974 30 2 417 0 3 0.8% 429 0 0.0% 2985 20 0 122 0 1 0.3% 200 0 0.0% 1109 00 6 147 21 7 1.8% 149 21 0.3% 815 00 1 84 0 1 0.3% 84 0 0.0% 314 0

0.0% 0.0%0 1 48 0 1 0.3% 48 0 0.0% 341 0

0.0% 0.0%0.0% 0.0%

0 0 0 0 1 0.3% 3 0 0.0% 26 00.0% 0.0%0.0% 0.0%

0 2 7 0 2 0.5% 7 0 0.0% 61 00.0% 0.0%

0 1 1 0 1 0.3% 1 0 0.0% 7 00 1 7 21 1 0.3% 7 21 0.3% 67 00 311 45426 6489 395 100.0% 49972 7920 100% 362496 510 62 13650 601 77 19.5% 15344 696 8.8% 95034 19

Chart 6:Chart 4:

Latin America Asia & Pacific Europe & Central Asia

Africa Middle-East LDCs0%

10%

20%

30%

40%

50%

60%

70%

80%

90%

16%

48%

1%

33%

2%

19%

13%

82%

1.0% 2.9% 1.3% 1.6%

% comparison of regional distribution of pCDM and CDM

pCDM CDM

Latin America Asia & Pacific Europe & Central Asia

Africa Middle-East LDCs0%

10%

20%

30%

40%

50%

60%

70%

80%

90%

16%

48%

1%

33%

2%

19%

13%

82%

1.0% 2.9% 1.3% 1.6%

% comparison of regional distribution of pCDM and CDM

pCDM CDM

Dec

/07

Mar

/08

Jun/

08S

ep/0

8D

ec/0

8M

ar/0

9Ju

n/09

Sep

/09

Dec

/09

Mar

/10

Jun/

10S

ep/1

0D

ec/1

0M

ar/1

1Ju

n/11

Sep

/11

Dec

/11

Mar

/12

Jun/

12S

ep/1

2D

ec/1

2M

ar/1

3Ju

n/13

Sep

/13

Dec

/13

Mar

/14

Jun/

14S

ep/1

4D

ec/1

4M

ar/1

5Ju

n/15

Sep

/15

Dec

/15

Mar

/16

Jun/

16S

ep/1

6D

ec/1

6M

ar/1

7Ju

n/17

Sep

/17

Dec

/17

Mar

/18

0

5

10

15

20

25

Number of CDM PoAs starting the public comments period each month

Number of different PoAs submitted, that are alive

Num

ber o

f Pro

ject

s ea

ch m

onth

Chart 4:

Dec

/07

Mar

/08

Jun/

08S

ep/0

8D

ec/0

8M

ar/0

9Ju

n/09

Sep

/09

Dec

/09

Mar

/10

Jun/

10S

ep/1

0D

ec/1

0M

ar/1

1Ju

n/11

Sep

/11

Dec

/11

Mar

/12

Jun/

12S

ep/1

2D

ec/1

2M

ar/1

3Ju

n/13

Sep

/13

Dec

/13

Mar

/14

Jun/

14S

ep/1

4D

ec/1

4M

ar/1

5Ju

n/15

Sep

/15

Dec

/15

Mar

/16

Jun/

16S

ep/1

6D

ec/1

6M

ar/1

7Ju

n/17

Sep

/17

Dec

/17

Mar

/18

0

5

10

15

20

25

Number of CDM PoAs starting the public comments period each month

Number of different PoAs submitted, that are alive

Num

ber o

f Pro

ject

s ea

ch m

onth

EE demand side34.4%

Waste19.6%Solar

17.3%

Hydro9.7%

Wind6.4%

Biomass energy4.6%

EE supply side2.3%

Transport1.8%

Coal Mine Methane1.0%

Fossil fuel switch0.8% Forestry & Agriculture

1.0%Fugitive

0.8%Geothermal

0.5%

PoA distribution by type

EE demand side34.4%

Waste19.6%Solar

17.3%

Hydro9.7%

Wind6.4%

Biomass energy4.6%

EE supply side2.3%

Transport1.8%

Coal Mine Methane1.0%

Fossil fuel switch0.8% Forestry & Agriculture

1.0%Fugitive

0.8%Geothermal

0.5%

PoA distribution by type

EE deman

d side

Waste Solar

HydroWind

Biomass energ

y

EE su

pply side

Transp

ort

Coal Mine M

ethan

e

Fossi

l fuel s

witch

Fores

try & Agri

cultu

re

Fugiti

ve

Geotherm

al

Mixed re

newab

les

Industrial

gases

-5%

0%

5%

10%

15%

20%

25%

30%

35%

Number of PoAs compared to normal CDM

PoAs%Normal %

EE deman

d side

Waste Solar

HydroWind

Biomass energ

y

EE su

pply side

Transp

ort

Coal Mine M

ethan

e

Fossi

l fuel s

witch

Fores

try & Agri

cultu

re

Fugiti

ve

Geotherm

al

Mixed re

newab

les

Industrial

gases

-5%

0%

5%

10%

15%

20%

25%

30%

35%

Number of PoAs compared to normal CDM

PoAs%Normal %

AlbaniaArgentinaArmeniaBangladeshBarbadosBrazilBurkina FasoBurundiCambodiaCameroonChile

China

ColombiaCongo DRCôte d'IvoireEcuadorEgyptEl SalvadorEthiopiaGhanaGuatemalaHaitiHondurasIndiaIndonesiaIranIsraelKenya

LebanonMacedoniaMadagascarMalawiMalaysiaMaliMexico

Issued Rejected With- Rejected No. of MongoliakCERs by DOEs drawn by EB CPAs Morocco

1832 8 1 0 1175 Mozambique0 0 0 0 2 Myanmar

S196
1 kCER = 1000 CER

Nepal0 0 0 0 1 Nicaragua

NigeriaNorth Korea

1244 2 0 0 1076 Pakistan245 2 1 0 12 Papua New Guinea

0 3 0 0 5 PeruPhilippinesRwandaSaudi Arabia

0 0 0 0 1 Senegal0 0 0 0 3 Singapore0 0 0 0 8 South Africa

South Korea0 0 0 0 2 Sri Lanka

38 0 0 0 16 SudanTanzania

262 0 0 0 35 Thailand0 1 0 0 3 Togo

Trinidad and TobagoTunisia

42 0 0 0 9 Uganda0 0 0 0 1 United Arab Emirates0 0 0 0 1 Uruguay

8464 32 2 1 639 Vanuatu1225 0 1 0 49 Vietnam

Yemen0 0 0 0 2 Zambia

1909 7 1 0 156 ZimbabweTotal number of PoAs:

3526 9 0 0 1800 3 0 0 15

0 0 0 0 14

217 0 0 0 30 0 0 0 2

996 2 0 0 140 2 0 0 20 1 0 0 570 0 0 0 2

27 3 0 0 260 0 0 1 30 2 0 0 367 1 0 0 16

130 2 0 0 150 0 0 0 10 0 0 0 1

427 0 0 0 450 1 0 0 30 0 0 0 10 0 0 0 1

0 1 0 0 1

3557 27 1 2 431

24 0 0 0 20 0 0 0 1

5 0 0 0 4

0 2 0 0 10 1 0 0 30 1 0 0 40 0 0 0 1

223 2 0 0 4

227 0 0 0 16

463 1 0 0 11234 1 0 0 60

0 0 0 0 2

0 0 0 0 31309 0 0 0 41

3 0 0 0 3

11 0 0 0 30 0 0 0 80 0 0 0 1

167 0 0 0 27362 1 0 0 36

0 1 0 0 80 0 0 0 10 0 0 0 1

698 13 1 1 660 0 0 0 1

0 1 0 0 11271 0 0 0 4

90 2 0 0 8

105 0 0 0 60366 0 0 1 10

0 1 0 0 20 2 1 0 130 0 0 0 4

0 0 0 0 4

0 0 0 0 1

0 2 0 0 2

0 0 1 0 10 0 0 0 1

13852 70 5 3 22613887 8 1 1 309

75 Countries with PoAs

Latin America Asia & Pacific Europe & Central Asia

Africa Middle-East LDCs0%

10%

20%

30%

40%

50%

60%

70%

80%

90%

16%

48%

1%

33%

2%

19%

13%

82%

1.0% 2.9% 1.3% 1.6%

% comparison of regional distribution of pCDM and CDM

pCDM CDM

Latin America Asia & Pacific Europe & Central Asia

Africa Middle-East LDCs0%

10%

20%

30%

40%

50%

60%

70%

80%

90%

16%

48%

1%

33%

2%

19%

13%

82%

1.0% 2.9% 1.3% 1.6%

% comparison of regional distribution of pCDM and CDM

pCDM CDM

EE demand side34.4%

Waste19.6%Solar

17.3%

Hydro9.7%

Wind6.4%

Biomass energy4.6%

EE supply side2.3%

Transport1.8%

Coal Mine Methane1.0%

Fossil fuel switch0.8% Forestry & Agriculture

1.0%Fugitive

0.8%Geothermal

0.5%

PoA distribution by type

EE demand side34.4%

Waste19.6%Solar

17.3%

Hydro9.7%

Wind6.4%

Biomass energy4.6%

EE supply side2.3%

Transport1.8%

Coal Mine Methane1.0%

Fossil fuel switch0.8% Forestry & Agriculture

1.0%Fugitive

0.8%Geothermal

0.5%

PoA distribution by type

1 Run of river+new dam1 Landfill flaring, 1 Wind1 Run of river1 Lighting, 2 Stoves, 1 Textiles, 2 Building materials, 1 Water purification, 1 Biogas from MSW, 1 Domestic manure, 1 Composting, 1 Solar PV1 EE commercial buildings2 Gasification of biomass, 2 New dam, 1 Landfill power, 1 Combustion of MSW, 1 Manure, 1 Composting, 4 Wind, 1 Wind & Solar1 Stoves, 1 Biogas from MSW2 Stoves1 Agricultural residues: rice husk1 Solar PV2 Run of river, 1 Landfill power, 1 Solar & wind & other, 3 Solar PV, 1 Mode shift: Road to rail, 2 Wind, 1 Geothermal electricity+Wind+Tidal+Solar PV+Solar thermal power

2 Oil field flaring reduction, 1 Run of river, 1 Landfill flaring, 1 Solar PV2 Stoves1 Solar lamps, 1 Stoves1 Palm oil waste1 Oil to natural gas, 1 Scrapping old vehicles2 Stoves1 Gasification of biomass, 1 Solar lamps, 4 Stoves3 Stoves, 1 Landfill power, 1 Composting, 1 Solar & wind & other1 Stoves, 2 Run of river2 Stoves1 Stoves, 2 Run of river

1 Water purification, 2 Run of river, 1 Biogas from MSW, 4 Waste water, 4 Palm oil waste, 1 Composting, 1 Agricultural residues: rice husk+Bagasse1 Run of river1 Solar PV

1 Solar water heating1 Run of river2 Stoves1 Solar lamps, 6 Stoves, 1 Solar & wind & hydro2 Palm oil solid waste, 1 Agricultural residues: other kinds, 1 EE public buildings, 4 Palm oil waste, 1 More efficient vehicles1 Stoves, 2 Solar PV1 Lighting, 1 Stoves, 1 Lighting & Insulation & Solar, 1 Appliances, 1 EE new buildings, 1 Existing dam, 3 Manure, 1 Waste water, 1 Solar & wind & other

1 Appliances1 Landfill power, 1 Solar & wind, 1 Wind1 Stoves, 1 Afforestation, 1 Solar & Hydro2 Stoves, 1 Appliances

1 Coal Mine Methane, 1 CMM & Ventilation Air Methane, 1 Ventilation Air Methane, 1 Efficient electricity distribution, 15 Lighting, 1 Stoves, 1 Construction, 1 EE commercial buildings, 2 Higher efficiency coal power, 1 Geothermal heating, 2 Run of river, 2 New dam, 14 Manure, 6 Domestic manure, 1 Waste water, 4 Solar PV, 1 More efficient vehicles, 1 Run of river+new dam

1 Irrigation, 2 Agricultural residues: other kinds, 1 Agricultural residues: rice husk, 1 Efficient electricity distribution, 2 Lighting, 2 Solar lamps, 4 Stoves, 2 Appliances, 2 Iron & steel, 1 HVAC & lighting, 1 Lighting in service, 1 Landfill composting, 1 Domestic manure, 2 Solar & wind, 2 Solar & wind & hydro, 4 Solar PV, 2 Solar water heating, 1 Mode shift: Road to rail, 3 Wind, 1 Solar & Wind, 1 Solar & Wind

1 Efficient electricity distribution, 1 Lighting, 4 Solar lamps, 5 Stoves, 1 Geothermal electricity, 1 Run of river, 2 Domestic manure, 1 Solar & wind & hydro, 2 Solar & wind & other

2 Stoves, 1 Run of river, 1 Domestic manure1 Reforestation, 1 Domestic manure, 1 Wind3 Stoves, 1 EE public buildings, 1 Mode shift: Road to rail1 Coal Mine Methane, 1 Waste water1 Lighting, 1 Domestic manure, 1 Solar & wind & hydro, 1 Solar & wind & other, 1 Solar PV1 Run of river3 Oil to LPG, 3 Run of river, 1 Solar & wind & hydro1 Lighting, 1 EE commercial buildings, 1 Run of river, 1 Landfill power, 1 Manure, 2 Solar & wind & other, 1 More efficient vehicles4 Stoves, 1 Water purification, 1 Solar PV, 1 1 EE commercial buildings, 1 Solar & wind1 Lighting, 2 Stoves, 1 Reforestation, 1 Solar PV1 Lighting, 2 HVAC & lighting

1 Chemicals heat, 1 Street lighting, 1 Waste water, 1 Solar & wind & other, 5 Solar PV1 Agricultural residues: other kinds, 1 Forest residues: other, 1 Run of river, 1 Landfill composting, 1 Solar & wind1 Domestic manure1 Solar lamps, 1 Solar & wind & other, 1 Solar PV water disinfection1 Forest residues: other, 1 Street lighting, 1 Manure, 1 Waste water, 3 Solar PV1 Stoves1 Oil field flaring reduction1 Solar water heating1 Connection of Isolated grid, 3 Stoves, 2 Water purification, 1 Landfill composting, 1 Manure1 Solar PV1 Wind1 Stoves1 Biomass briquettes, 1 Building materials, 4 Run of river, 1 Landfill power, 1 Domestic manure, 1 Solar water heating, 1 Wind1 Efficient electricity distribution1 Biomass briquettes, 2 Stoves1 Lighting

393

1 Agricultural residues: other kinds, 1 Lighting, 1 Solar lamps, 1 Stoves, 1 Building materials, 2 Lighting in service, 1 EE commercial buildings, 1 Cogeneration, 1 Run of river, 2 Landfill power, 1 Manure, 3 Solar & wind, 1 Solar & wind & hydro, 2 Solar & wind & other, 6 Solar PV, 1 Solar thermal power, 9 Solar water heating, 3 Wind

Table 3:PoAs with new CPA's included (the first CPA is not counted here) RefCUIDEMOS Mexico (Campana De Uso Intelegente De Energia Mexico) - Smart Use of Energy Mexico 2535Installation of Solar Home Systems in Bangladesh 2765Methane avoidance, Brazil 2767SGCC In-advance Distribution Transformer Replacement CDM Programme 2896Egypt Vehicle Scrapping and Recycling Program 2897Sichuan Rural Poor-Household Biogas Development Programme 2898

Municipal waste composting Project, Uganda 2956CFL lighting scheme, India 3223Masca Small Hydro Programme 3562Promotion of Biomass Based Heat Generation Systems in India 4041SASSA Low Pressure Solar Water Heater Programme, South Africa 4302Solar Water Heater Programme in Tunisia 4659Improved Cooking Stoves in Bangladesh 4791Efficient Lighting Initiative of Bangladesh (ELIB) 4793The programme to promote efficient lightings in local areas 5019Malaysia Biogas Projects 5034Improved Cooking Stoves for Nigeria Programme of Activities 5067Than Thien Small Hydropower Programme of Activities Managed by INTRACO 5324Efficient Cook Stove Programme: Kenya 5336Improved Cooking Stoves Programme of Activities in Africa 5341African Improved Cooking Stoves Programme of Activities 5342First Solar PoA in India by SENES Consultants 5588Punjab State Electricity Board: High Voltage Distribution System for Agricultural Consumers in the Rural Areas of the Punjab 5787International water purification programme 5962Methane recovery and combustion with renewable energy generation from anaerobic animal manure management systems under the Land B5979Standard Bank Low Pressure Solar Water Heater Programme for South Africa 5997Sustainable Small Hydropower Programme of Activities (PoA) in Viet Nam 6095Barefoot Power Lighting Programme 6110Renewable Energy PoA in India 6161Tunki Small Scale Hydropower Program of Activities 6198Improved Cook Stoves programme for Rwanda 6207Small-Scale Renewable Energy PoA in Thailand 6222Distribution of fuel-efficient improved cooking stoves in Nigeria 6283National Solar Power Development Programme, India 6328Mexican Renewable Energy Alliance Programme of Activities (PoA) 6434Caixa Econômica Federal Solid Waste Management and Carbon Finance Project 6573Landfill gas recovery and combustion with renewable energy generation 6707Vietnam Renewable Energy Development Program (REDP) 6810Fuel Efficient Stoves in Zambia 6864Improved Cook Stoves for East Africa (ICSEA) 7014Omega Wind Power Plants Programme of Activities 7156

Green Power for South Africa 7167Enlightened Solar PoA 7191TUCANO CDM Programme of Activities for the Promotion of Small Hydropower Plants in Brazil 7211Municipal Waste Compost Programme in Sri Lanka 7237Wind Power Programme of Activities in Brazil 7271PoA for the Reduction of emission from non-renewable fuel from cooking at household level 7359South Africa Renewable Energy Programme (SA-REP) 7570AWMS Composting Project 7760The National CFL Project, Pakistan 7811Recovery and Avoidance of Methane from Industrial Wastewater Treatment Projects 7864Hydro Alliance Programme of Activities 7883Improved Cook stoves Programme – India 7997Thailand Small Scale Livestock Waste Management Program 8027Thailand energy efficiency improvement for street lightings 8055Improved Cookstoves Program for Zambia 8060MicroEnergy Credits – Microfinance for Clean Energy Product Lines - Mongolia 8142CDM Africa Wind and Solar Programme of Activities for South Africa 8260Programme of Activities (PoA) for Sustainable Renewable Energy Power Generation in Papua New Guinea (PNG) 8383Clean Cook Stoves in Sub-Saharan Africa by ClimateCare Limited 8438Distribution of ONIL Stoves—Guatemala 8480Green Light for Africa 8637Côte d’Ivoire and Cameroon Efficient Cookstoves Program 8696Solar Water Heater Program in India 8855Grid Connect Solar PV Power Generation Plant Programme 8868Guacamaya Small Scale Hydropower Programme of Activities 8950Improved Cookstoves Program in Honduras “Vida Mejor con Ecofogones de Alto Rendimiento” 9176MicroEnergy Credits – Microfinance for Clean Energy Product Lines – India 9181Programme of Activities to introduce renewable energy system into collective housing, Republic of Korea 9247PV Project Development in Chile 9251The programme to introduce renewable energy system into Seoul 9260Wind Energy Project PoA 9292Promotion of renewable energy generation in India- Programme of Activities 9416PoA on RE 9502Improved Cookstoves Program for Malawi and cross-border regions of Mozambique 9558

Nepal Biogas Support Program-PoA 9572DelAgua Public Health Program in Eastern Africa 9626Promoting Efficient Stove Dissemination and Use in West Africa 9666Paradigm Sub Saharan Africa Cook Stove Programme 9672Programme of Activities for Small Scale Hydropower CDM in Sri Lanka 9705Energy Efficient Stoves Program (EESP) 9769Improved Cook Stove Programme with Carbon Finance (ICF), Nepal 9811Renewable Energy CDM Programme of Rwanda (RECPR) 9847The MRTS PoA 9863PoA for Promotion of the Improved Water Mills (IWM) in Nepal 9889Tanzania Renewable Energy Programme 9904Impact Carbon Global Safe Water Programme of Activities (PoA) 9948Up Energy Improved Cookstove Programme, Uganda 9956Domestic Cooking Stoves substitution programme in Mozambique 9981The program to improve energy independence of public sewerage system through biogas increased efficiency in Korea 10014Empowering DRC communities through the use of Improved Cook Stoves 10053CDM Sustainable Energy Programme 10124Biomass Energy Conservation Programme 10182Accelerating Electrification through Grid Extension and Off-Grid Electrification in Rural Areas of Uganda 10186Ethiopia – Clean Cooking Energy Program 10268Ethiopia Off-Grid Renewable Energy Program 10285Brazilian PoA for NAMA incentivized NCRE Projects 10286Dissemination of improved cook stoves and generation of charcoal 10292Scaling-Up Solar Photovoltaic Power Generation 10320Project Gaia Cook Stove Programme of Activities (PoA) 10340Tandavanala TsinjoHarena Improved cookstoves in Madagascar 10352Total number of POAs with more than 1st CPA 101

Chart 5:

Mar

-11

May

-11

Jul-1

1Se

p-11

Nov-

11Ja

n-12

Mar

-12

May

-12

Jul-1

2Se

p-12

Nov-

12Ja

n-13

Mar

-13

May

-13

Jul-1

3Se

p-13

Nov-

13Ja

n-14

Mar

-14

May

-14

Jul-1

4Se

p-14

Nov-

14Ja

n-15

Mar

-15

May

-15

Jul-1

5Se

p-15

Nov-

15Ja

n-16

Mar

-16

May

-16

Jul-1

6Se

p-16

Nov-

16Ja

n-17

Mar

-17

May

-17

Jul-1

7Se

p-17

Nov-

17Ja

n-18

Mar

-18

0

10

20

30

40

50

60

70

80

90

100

Number of new CPAs included

New CPAs

Mar

-11

May

-11

Jul-1

1Se

p-11

Nov-

11Ja

n-12

Mar

-12

May

-12

Jul-1

2Se

p-12

Nov-

12Ja

n-13

Mar

-13

May

-13

Jul-1

3Se

p-13

Nov-

13Ja

n-14

Mar

-14

May

-14

Jul-1

4Se

p-14

Nov-

14Ja

n-15

Mar

-15

May

-15

Jul-1

5Se

p-15

Nov-

15Ja

n-16

Mar

-16

May

-16

Jul-1

6Se

p-16

Nov-

16Ja

n-17

Mar

-17

May

-17

Jul-1

7Se

p-17

Nov-

17Ja

n-18

Mar

-18

0

10

20

30

40

50

60

70

80

90

100

Number of new CPAs included

New CPAs

PoA Host Total New CPA bunches Jan-10 Feb-10 Mar-10 Apr-10 May-10 Jun-10 Jul-10 Aug-10Mexico 24 1

Bangladesh 12 2Brazil 1049 2 961China 3 1Egypt 2 2China 86 3

Uganda 11 3India 49 7

Honduras 3 1India 31 12

South Africa 6 3Tunisia 7 3

Bangladesh 18 2Bangladesh 8 1South Korea 13 3

Malaysia 5 1Nigeria 4 2Vietnam 12 3Kenya 1 1Kenya 6 4Ghana 5 4India 8 5India 3 1

Uganda 21 8Philippines 14 4

South Africa 4 2Vietnam 6 3Kenya 1 1India 1 1Peru 3 2

Rwanda 6 5Thailand 2 2Nigeria 3 2India 9 8

Mexico 1 1Brazil 1 1

Philippines 1 1Vietnam 12 5Zambia 2 1Uganda 7 2Brazil 1 1

South Africa 10 4Israel 3 2Brazil 2 2

Sri Lanka 1 1Brazil 4 4

Madagascar 64 5South Africa 2 1

Brazil 1 1Pakistan 52 1Indonesia 1 1Guatemala 5 3

India 1 1Thailand 2 1Thailand 4 2Zambia 3 2

Mongolia 2 1South Africa 6 2

Papua New Guinea 1 1Ghana 2 2

Guatamala 1 1Kenya 3 1

Côte d'Ivoire 2 2India 3 2China 11 1

Honduras 2 1Honduras 8 1

India 10 5South Korea 1 1

Chile 1 1South Korea 1 1

India 3 3India 15 13India 7 6

Malawi 4 2

Nepal 7 4Rwanda 15 2

West Africa 2 1Ethiopia 1 1

Sri Lanka 7 3Ethiopia 2 2Nepal 2 1

Rwanda 5 1India 1 1Nepal 2 2

Tanzania 8 6Rwanda 20 4Uganda 11 4

Mozambique 2 2South Korea 2 1Congo DR 1 1Senegal 1 1Malawi 24 2Uganda 1 1Ethiopia 1 1Ethiopia 1 1

Brazil 3 2India 1 1Mali 4 2

Ethiopia 2 2Madagascar 2 1PoAs with 1827 245 CPAs and CPA bunches 0 0 0 0 0 961

0.000

Mar

-11

May

-11

Jul-1

1Se

p-11

Nov-

11Ja

n-12

Mar

-12

May

-12

Jul-1

2Se

p-12

Nov-

12Ja

n-13

Mar

-13

May

-13

Jul-1

3Se

p-13

Nov-

13Ja

n-14

Mar

-14

May

-14

Jul-1

4Se

p-14

Nov-

14Ja

n-15

Mar

-15

May

-15

Jul-1

5Se

p-15

Nov-

15Ja

n-16

Mar

-16

May

-16

Jul-1

6Se

p-16

Nov-

16Ja

n-17

Mar

-17

May

-17

Jul-1

7Se

p-17

Nov-

17Ja

n-18

Mar

-18

0

10

20

30

40

50

60

70

80

90

100

Number of new CPAs included

New CPAs

Mar

-11

May

-11

Jul-1

1Se

p-11

Nov-

11Ja

n-12

Mar

-12

May

-12

Jul-1

2Se

p-12

Nov-

12Ja

n-13

Mar

-13

May

-13

Jul-1

3Se

p-13

Nov-

13Ja

n-14

Mar

-14

May

-14

Jul-1

4Se

p-14

Nov-

14Ja

n-15

Mar

-15

May

-15

Jul-1

5Se

p-15

Nov-

15Ja

n-16

Mar

-16

May

-16

Jul-1

6Se

p-16

Nov-

16Ja

n-17

Mar

-17

May

-17

Jul-1

7Se

p-17

Nov-

17Ja

n-18

Mar

-18

0

10

20

30

40

50

60

70

80

90

100

Number of new CPAs included

New CPAs

*

Sep-10 Oct-10 Nov-10 Dec-10 Jan-11 Feb-11 Mar-11 Apr-11 May-11 Jun-11 Jul-11 Aug-11 Sep-11

88

71 26 5 2

0 0 0 0 0 0 88 8 26 0 0 5 2

Oct-11 Nov-11 Dec-11 Jan-12 Feb-12 Mar-12 Apr-12 May-12 Jun-12 Jul-12 Aug-12 Sep-12 Oct-12

3

7 3 5

2 5 3 4 1 1 2 51

5

52

0 7 0 0 3 8 5 11 4 3 6 2 5

Nov-12 Dec-12 Jan-13 Feb-13 Mar-13 Apr-13 May-13 Jun-13 Jul-13 Aug-13 Sep-13 Oct-13 Nov-1324

7 5

1 152

1

32 4 1

1 41 1

85

23 7 2

11 11 1

1 4 13

12 2

11

1 2 1 1

2

2 2.0 51

402

1

2 15 9 6 2 56 37 16 44 8 1 5 15

Dec-13 Jan-14 Feb-14 Mar-14 Apr-14 May-14 Jun-14 Jul-14 Aug-14 Sep-14 Oct-14 Nov-14 Dec-14

20

1

10

5

12 1

1

1

3 2

21

1 1

1

1 3

12

1 1

116 2

152

21 3

21

1 1

11

2 1 1 11 2

2

3 16

1 12

1

3 5 2 26 4 22 3 4 6 61 1 19 16

Jan-15 Feb-15 Mar-15 Apr-15 May-15 Jun-15 Jul-15 Aug-15 Sep-15 Oct-15 Nov-15 Dec-15 Jan-16 Feb-16

14

3

8

3

1 1 3

11 1 2 1

21 1

1

3 1

11 1

12

1 2

4

1

3

1 211

1 3 1 2

1

1 11 1 1 1 1

1

2

1 3

5

3

1 2

21

19 14 10 8 5 3 8 3 7 4 5 16 11 2

Mar-16 Apr-16 May-16 Jun-16 Jul-16 Aug-16 Sep-16 Oct-16 Nov-16 Dec-16 Jan-17 Feb-17 Mar-17 Apr-17

1

6 1 41

1

1

11

4 31

14

1 21

2

11

28

31

2 1 1 11

2

19

2

11 1 1

41 1

21

15

1

21

24 12 2 6 2 8 13 10 8 6 10 9 2 5

May-17 Jun-17 Jul-17 Aug-17 Sep-17 Oct-17 Nov-17 Dec-17 Jan-18 Feb-18 Mar-18 Apr-18 May-18 Jun-18

3

49 3 2 1

1

4

1

2 1

5 3

1 1

3

11

11 1 9 94

191

1 11 2 1

1

7 5 3 20 4 24 14 6 6 5 1 3 0 0

Jul-18 Aug-18 Sep-18 Oct-18 Nov-18 Dec-18

0 0 0 0 0 0

ISO 4217 Currency codes Additional revenue Taxonomy for assessment of sustainable development benefits of CDM projectsUnited Arab Emirates Dirham Sales Savings Dimension URC code Criteria

Afghanistan Afghani Heat Heat

1 Air

Albania Lek Fuel Fuel2 Land

Armenia Dram Steam Steam

3 Water

Netherlands Antilles Guilder Biomass Biomass

4 Conservation

Angola Kwanza Biogas Social benefits 5 Jobs

Argentina Peso Electricity Electricity

6 Health

Australia Dollar Fees

7 Education

Aruba Guilder Production increase

8 Welfare

Azerbaijan New Manat Raw materials

Economic benefits 9 Growth

Ash

10 Energy access

Barbados Dollar Cement11 Technology

Bangladesh Taka CFLs12 Balance of Payments

Bulgaria Lev Clinker

Negative impacts 13 Do no harm

Bahrain Dinar Compost Other14

Burundi Franc Recyclables 15Bermuda Dollar TimberBrunei Darussalam Dollar Forest productsBolivia Boliviano Resin Additionality barriers:Brazil Real None None FinancialBahamas Dollar InvestmentBhutan Ngultrum TechnologicalBotswana Pula Prevailing practiceBelarus Ruble Other barriersBelize DollarCanada DollarCongo/Kinshasa FrancSwitzerland FrancChile PesoChina Yuan RenminbiColombia PesoCosta Rica ColonCuba Convertible PesoCuba PesoCape Verde EscudoCzech Republic KorunaDjibouti FrancDenmark KroneDominican Republic PesoAlgeria DinarEgypt PoundEritrea Nakfa

AED

AFNEnvironmental benefits

ALL

AMD

ANGAOA

ARS

AUD

AWG

AZN

BAMBosnia and Herzegovina Convertible Marka

BBD

BDT

BGN

BHDBIFBMDBNDBOBBRLBSDBTNBWPBYRBZDCADCDFCHFCLPCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERN

Ethiopia BirrEuro Member CountriesFiji DollarFalkland Islands (Malvinas) PoundUnited Kingdom PoundGeorgia LariGuernsey PoundGhana CediGibraltar PoundGambia DalasiGuinea FrancGuatemala QuetzalGuyana DollarHong Kong DollarHonduras LempiraCroatia KunaHaiti GourdeHungary ForintIndonesia RupiahIsrael ShekelIsle of Man PoundIndia RupeeIraq DinarIran RialIceland KronaJersey PoundJamaica DollarJordan DinarJapan YenKenya ShillingKyrgyzstan SomCambodia RielComoros FrancKorea (North) WonKorea (South) WonKuwait DinarCayman Islands DollarKazakhstan TengeLaos KipLebanon PoundSri Lanka RupeeLiberia DollarLesotho LotiLithuania LitasLatvia LatLibya DinarMorocco DirhamMoldova LeuMadagascar AriaryMacedonia DenarMyanmar (Burma) KyatMongolia TughrikMacau PatacaMauritania OuguiyaMauritius RupeeMaldives (Maldive Islands) RufiyaaMalawi KwachaMexico PesoMalaysia RinggitMozambique MeticalNamibia DollarNigeria NairaNicaragua CordobaNorway KroneNepal Rupee

ETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLTLLVLLYDMADMDLMGAMKDMMKMNTMOPMROMURMVRMWKMXNMYRMZNNADNGNNIONOKNPR

New Zealand DollarOman RialPanama BalboaPeru Nuevo SolPapua New Guinea KinaPhilippines PesoPakistan RupeePoland ZlotyParaguay GuaraniQatar RiyalRomania New LeuSerbia DinarRussia RubleRwanda FrancSaudi Arabia RiyalSolomon Islands DollarSeychelles RupeeSudan PoundSweden KronaSingapore DollarSaint Helena PoundSierra Leone LeoneSomalia ShillingSeborga LuiginoSuriname DollarSão Principe and Tome DobraEl Salvador ColonSyria PoundSwaziland LilangeniThailand BahtTajikistan SomoniTurkmenistan ManatTunisia DinarTonga Pa'angaTurkey LiraTrinidad and Tobago DollarTuvalu DollarTaiwan New DollarTanzania ShillingUkraine HryvnaUganda ShillingUnited States DollarUruguay PesoUzbekistan SomVenezuela Bolivar FuerteViet Nam DongVanuatu VatuSamoa Tala

East Caribbean Dollar

Yemen RialSouth Africa RandZambia KwachaZimbabwe Dollar

NZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSPL*SRDSTDSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUSDUYUUZSVEFVNDVUVWSTXAF Communauté Financière Africaine (BEAC) CFA Franc BEACXCDXDR

International Monetary Fund (IMF) Special Drawing Rights

XOFCommunauté Financière Africaine (BCEAO) Franc

XPFComptoirs Français du Pacifique (CFP) Franc

YERZARZMKZWD

Taxonomy for assessment of sustainable development benefits of CDM projects UNFCCC code Taxonomy for assessment of Technology Transfer in CDM projects Investment analysis typeIndicators TT code TT type Code Sub-step

7 -5 Non-key equipment is imported 1 Benchmark analysis

7 -4 2 Benchmark analysis

7 -3 3 Benchmark analysis

6 -2 4 Benchmark analysisCreation of new jobs and employment opportunities including income generation 1,2 -1 Project specifically states no technology transfer 5 Investment comparison analysis

11 0 No mention or indication of technology transfer in the PDD 6 Simple cost analysis

5,12 1 Technology transfer of equipment only

15 2 Technology transfer of knowledge only

1,4 3 Technology transfer of equipment and knowledgeImproved access, availability and quality of electricity and heating services such as coverage and reliability.

9 4 "Joint ventures" between two or more countries - i.e. technology transfer of expertiseDevelopment, diffusion of local or imported technology.

31

No information provided

Improving air quality by reducing air pollutants such as SOx, NOx, suspended particulate matter (SPM), Non Methane Volatile Organic Compounds (NMVOCs), dust, fly ash, odour and noise

Avoid soil pollution including avoided waste disposal and improvement of the soil through the production and use of e.g. compost, manure nutrient and other fertilizers

Technology is from a foreign multinational but is manufactured domestically (perhaps under license).

Improved water quality through e.g. wastewater management, water savings, safe and reliable water distribution, purification/sterilization and cleaning of water

Technology is well established and has been widely used all over the world. Technology may be imported but is not considered a transfer

Protection and management of resources (such as minerals, plants, animals and biodiversity but excluding waste) and landscapes (such as forests and river basins) Claims technology transfer but does not occur in accordance with the 2010 report

definition of TT - i.e. the stated TT occurs within the host country

Reduction of health risks such as diseases and accidents or improvement of health conditions, including safety, through activities such as construction of a hospital, running a health care centre, preservation of food, reducing health damaging air pollutants and indoor smoke

Facilitation of education, dissemination of information, research and increased awareness related to e.g. waste management, renewable energy resources and climate change through construction of a school, running of educational programs, site visits and tours. This indicator includes job related training.

Improvement of local living and working conditions, community or rural upliftment, reduced traffic congestion, poverty alleviation and income redistribution through e.g. increased municipal tax revenues. Empoverment of women.

Support for economic development and stability through initiation of e.g. new industrial activities, investments, establishment and maintenance of infrastructure, enhancing productivity, reduction of costs, setting an example for other industries and creation of business opportunities

Reduction in the use of foreign exchange through a reduction of imported fossil fuels in order to increase national economic independence.Violate human rights, Involve resettlements, do not preserve cultural heritage, violate labour rights, child labour, involve discrimination, unsafe & unhealthy work environment, involve corruption, spoil the environment and natural habitats.

Statement in the PDD: "Conforms to host country sustainable development requirements" but does not go into more detail. (The Designated National Authority checked the project against the sustainable development criteria of the country, finding that the p

Investment analysis type Barrier analysis type Additional Revenue Type of financial indicator Sub-region and Region by CountryOption Code Type Code Kind for sales Kind for savings Code Type Country Sub-region Region

Government bond rates 1 Financial 1 1 LC of electricity production Cameroon Central Africa Africa

Financing cost 2 Other 2 2 LC of delivered heat Central African Republic Central Africa Africa

Company internal benchmark 3 Methodological 3 3 IRR Chad Central Africa Africa

Government/official approved benchmark 4 Prevailing practice 4 4 NPV Congo Central Africa Africa5 Technological 5 5 Cost benefit ratio Congo DR Central Africa Africa

6 Investment 6 Equatorial Guinea Central Africa Africa

7 Gabon Central Africa Africa

8 Burundi East Africa Africa

9 Comoros East Africa Africa

10 Djibouti East Africa Africa

11 Eritrea East Africa Africa

12 Ethiopia East Africa Africa

13 Kenya East Africa Africa

14 Madagascar East Africa Africa15 Malawi East Africa Africa16 Mauritius East Africa Africa17 Mozambique East Africa Africa18 Rwanda East Africa Africa19 Tanzania East Africa Africa

Uganda East Africa AfricaAlgeria North Africa AfricaEgypt North Africa AfricaLibya North Africa AfricaMorocco North Africa AfricaSudan North Africa AfricaTunisia North Africa AfricaAngola Southern Africa AfricaBotswana Southern Africa AfricaLesotho Southern Africa AfricaNamibia Southern Africa AfricaSouth Africa Southern Africa AfricaSwaziland Southern Africa AfricaZambia Southern Africa AfricaZimbabwe Southern Africa AfricaBenin West Africa AfricaBurkina Faso West Africa AfricaCape Verde West Africa AfricaCôte d'Ivoire West Africa AfricaGambia West Africa AfricaGhana West Africa AfricaGuinea West Africa Africa

Guinea-Bissau West Africa AfricaLiberia West Africa AfricaMali West Africa AfricaMauritania West Africa AfricaNiger West Africa AfricaNigeria West Africa AfricaSenegal West Africa AfricaSierra Leone West Africa AfricaTogo West Africa AfricaChina East Asia Asia & PacificMongolia East Asia Asia & PacificNorth Korea East Asia Asia & PacificSouth Korea East Asia Asia & PacificFiji Pacific Asia & PacificKiribati Pacific Asia & PacificMarshall Islands Pacific Asia & PacificPalau Pacific Asia & PacificSamoa Pacific Asia & PacificTonga Pacific Asia & PacificBrunei Southeast Asia Asia & PacificCambodia Southeast Asia Asia & PacificIndonesia Southeast Asia Asia & PacificLao PDR Southeast Asia Asia & PacificMalaysia Southeast Asia Asia & PacificMyanmar Southeast Asia Asia & PacificPapua New Guinea Southeast Asia Asia & PacificPhilippines Southeast Asia Asia & PacificSingapore Southeast Asia Asia & PacificThailand Southeast Asia Asia & PacificTimor-Leste Southeast Asia Asia & PacificVietnam Southeast Asia Asia & PacificBangladesh Southern Asia Asia & PacificBhutan Southern Asia Asia & PacificIndia Southern Asia Asia & PacificMaldives Southern Asia Asia & PacificNepal Southern Asia Asia & PacificPakistan Southern Asia Asia & PacificSri Lanka Southern Asia Asia & PacificArmenia Central Asia Europe & Central AsiaAzerbaijan Central Asia Europe & Central AsiaGeorgia Central Asia Europe & Central AsiaKazakhstan Central Asia Europe & Central AsiaKyrgyzstan Central Asia Europe & Central AsiaTajikistan Central Asia Europe & Central AsiaUzbekistan Central Asia Europe & Central AsiaAlbania Europe Europe & Central AsiaBosnia and Herzegovina Europe Europe & Central AsiaCyprus Europe Europe & Central AsiaMacedonia Europe Europe & Central AsiaMalta Europe Europe & Central AsiaMoldova Europe Europe & Central AsiaMontenegro Europe Europe & Central AsiaSan Marino Europe Europe & Central AsiaSerbia Europe Europe & Central AsiaAntigua and Barbuda Caribbean Latin AmericaBahamas Caribbean Latin AmericaBarbados Caribbean Latin AmericaBelize Caribbean Latin AmericaCuba Caribbean Latin AmericaDominican Republic Caribbean Latin AmericaJamaica Caribbean Latin AmericaSaint Lucia Caribbean Latin AmericaTrinidad and Tobago Caribbean Latin AmericaCosta Rica Central America Latin AmericaCosta Rica Central America Latin America

El Salvador Central America Latin AmericaGuatemala Central America Latin AmericaHonduras Central America Latin AmericaNicaragua Central America Latin AmericaPanama Central America Latin AmericaMexico North America Latin AmericaArgentina South America Latin AmericaBolivia South America Latin AmericaBrazil South America Latin AmericaChile South America Latin AmericaColombia South America Latin AmericaEcuador South America Latin AmericaGuyana South America Latin AmericaParaguay South America Latin AmericaPeru South America Latin AmericaUruguay South America Latin AmericaKuwait Arabian Peninsula Middle-EastOman Arabian Peninsula Middle-EastQatar Arabian Peninsula Middle-EastSaudi Arabia Arabian Peninsula Middle-EastUnited Arab Emirates Arabian Peninsula Middle-EastYemen Arabian Peninsula Middle-EastIsrael Fertile Crescent Middle-EastJordan Fertile Crescent Middle-EastLebanon Fertile Crescent Middle-EastSyria Fertile Crescent Middle-EastAfghanistan Iranian Plateau Middle-EastIran Iranian Plateau Middle-East