Upload File

what can i do now that i couldn't do before?

  • Home
  • Sports
  • What Can I Do Now That I Couldn't Do Before?
52
What Can I Do Now That I Couldn’t Do Before? New Tools, New Pedagogies flickr and wikis in a classroom Darren Kuropatwa http://adifference.blogspot.com Building Learning Communities 2007

Upload: darren-kuropatwa

Post on 20-Aug-2015

2.496 views

Category:

Sports


1 download

Report

Tags:

TRANSCRIPT

  1. 1. What Can I Do Now That I Couldnt Do Before? New Tools, New Pedagogies flickr and wikis in a classroom Darren Kuropatwa http://adifference.blogspot.com Building Learning Communities 2007
  2. 2. Smile!
  3. 3. Is it that easy? What can I do now that I couldn't do before? Galleries of Thought How can I get them to make their thinking transparent? Watch it. Do it. Teach it.
  4. 4. What Can I Do Now That I Couldnt Do Before? links
  5. 5. What Can I Do Now That I Couldnt Do Before? links tags
  6. 6. What Can I Do Now That I Couldnt Do Before? links tags rss
  7. 7. What Can I Do Now That I Couldnt Do Before? K12 Online 2007: Liz Kolb K12 Online 2006: Steve Dembo
  8. 8. Smarties Probability
  9. 9. My Favourite Number
  10. 10. My Favourite Number
  11. 11. My Favourite Number
  12. 12. First(?) assignment ... trigonometry grade 12 results grade 11 results
  13. 13. Developing the rubric ...
  14. 14. Developing the rubric ...
  15. 15. Finding the focus ... descriptors
  16. 16. Finding the focus ... weighting descriptors
  17. 17. Finding the focus ... weighting descriptors creativity
  18. 18. Finding the focus ... weighting descriptors creativity
  19. 19. The rubric ...
  20. 20. The results ... the parabola sequence
  21. 21. The (post rubric) results ...the trigonometry sequence
  22. 22. The results ...the exponential functions sequence
  23. 23. The difficulties ...Chris, Graeme, Craig speak (56 sec)
  24. 24. The Red Hot Chili Peppers ...doing calculus
  25. 25. Look
  26. 26. See
  27. 27. Value Craig, Chris, Graeme (30 sec)
  28. 28. Tests Vincent, Craig (43 sec)
  29. 29. Push Me Pull You links
  30. 30. Push Me Pull You links tags
  31. 31. Push Me Pull You links tags rss
  32. 32. flickr your teaching ...
  33. 33. flickr their learning ...
  34. 34. Cell Phones? Not in the classroom ...
  35. 35. The future of digital photography ...
  36. 36. What Can I Do Now That I Couldnt Do Before? with a wiki ...
  37. 37. Wikis are used to collaborate There are two types of content creation on a wiki: i) A significant contribution original content creation ii) A constructive modification modification of pre-existing content
  38. 38. What Can I Do Now That I Couldnt Do Before? i) Have students create original content. ii) Have them modify (improve) another student's work.
  39. 39. The results ...
  40. 40. Assessment ...
  41. 41. Assessment ...
  42. 42. Assessment ...
  43. 43. Take away ... What does this tool do?
  44. 44. Take away ... How does it work?
  45. 45. Take away ... Think ...
  46. 46. Take away ... Think ... links
  47. 47. Take away ... Think ... links tags
  48. 48. Take away ... Think ... links tags rss
  49. 49. Take away ... What will you be able to do now that you couldnt do before?
  50. 50. Take away ... a $250 wiki for free! i) Post a pictureto flickr that you can use in your teaching. Tag it: blc07, wikigiveaway ii) Create a free wiki at pbwiki.com. Put your picture on the wiki too. Include a description of how you will use it in your classroom and a link to the photo flickr page. iii) On flickr, describe how you will use this picture in your classroom and leave a link to your pbwiki.
  51. 51. Photo Credits Bright eyes and a warm smile ... http://flickr.com/photos/lapidim/29893744/ six http://www.flickr.com/photos/sc0ttbeardsley/8951408/ probability project http://www.flickr.com/photos/7529692@N02/441624496 You are number six ... http://www.flickr.com/photos/csb13/221584057/ The number 9 is IN-TER-EST-TING!!!! http://www.flickr.com/photos/94597307@N00/312125399 Leica IIIf http://www.flickr.com/photos/35237096015@N01/15216920 Gadget http://flickr.com/photos/davyrocket/82339986/ Obligatory Wiki Photo http://flickr.com/photos/cogdog/19490596/ push-me pull-you http://flickr.com/photos/91772025@N00/444044158/ Wake Up by Holmes http://myspace.com/imholmes Masaccio http://flickr.com/photos/ha112/414146234/ module2 http://flickr.com/photos/ha112/234233755/ Curtain trigonometry!! http://www.flickr.com/photos/94597307@N00/312125395 Dialjupiter http://www.flickr.com/photos/61703609@N00/158825397 tree hugger http://www.flickr.com/photos/69842277@N00/282926763 Blaise Arguera y Arcas @ TED Talks http://www.ted.com/index.php/talks/view/id/129 exponential function - "e" http://flickr.com/photos/26219483@N00/346257046/ Dentist's office http://flickr.com/photos/7421887@N03/432557147/ Related Rates #1 http://flickr.com/photos/85068725@N00/366758089/ My version of a quadratic ! http://flickr.com/photos/40256716@N00/316074893/ Music Video motion study experiment http://flickr.com/photos/monkeyc/112350059/ Cell Phone Tour http://flickr.com/photos/48318190@N00/520866159/ math http://flickr.com/photos/akash_k/125489887/ Dollar Store floor http://flickr.com/photos/telstar/313182873/

med.stanford.edu · Chair caused her discomfort, and she couldn't sleep at ... I couldn't cook dinner or clean. I'd just count the ... Experts say a woman should find out if her lo-

iWish I Couldn't Lie

 · see 1 really couldn't sing 1 could Ñever really sing what 1 couldn't do 1 have trouble with . it goes all around my it's a terrifying see, 1 really couldn't hear which note was

Couldn't Be Happier

A National Blue Ribbon School of Excellence · 2014-08-18 · sports?” Well I have a confession to make; I don't pay for my kids to do sports. Personally, I couldn't care less about

Autumn 2012- Newsletter - RSI-vereniging · Tips & Tools—Gadgets to help with medicines 10 Do cetylated fatty acids help with ... We're always looking for great new sites. I couldn't

MY BANKER'S CONFLICTED AND I COULDN'T BE HAPPIER: THE

Go Get ‘EM · Quite simply, "Did I do those three things?" "No. Alright. If not, why not?" "Well, I was too bum lazy and sat down and couldn't be bothered to do it." "OK, is there

… the easy way! Image © Wikimedia CC. Please visit our Gold Sponsor stands, we couldn't do it without you…

"I couldn't make it as a security officer, so I started a company."

Longing: places I desired and couldn't find

I couldn't come up with a name - Gen Quiz (Finals)

Trifles scene · 2018. 10. 21. · 984 Trifles belong to the Ladies' Aid. I suppose she felt she couldn't do her part, and then you don't enjoy things when you feel shabby. I heard

The Little Seagull That Couldn't Fly

I Couldn't Care Less Neu Solostimme, Sopran, Alt

There are things frequently said about time: "I don't have enough time." "I couldn't find time to do it." "Time flies." "There aren't enough hours in the day." Most of us have felt,

With AI & future tech, will the service of a · Alexa, play Nightwish radio. I couldn't find a station for Nightwish. Alexa, play Nightwish radio. I couldn't find a station called

PRESBYLASIK - Lasik Fort Lauderdale FL, LASIK Eye Surgery ... · ing problems. I couldn't see TV with - out glasses--every - thing was a blur -- and I couldn't see signs when I was

The pug who couldn't run

Lesson 7: Amy's First Korean Food - "That's incredible"/"However, I couldn't have done it without.."

Everything I enjoy doing I just couldn't do ... · 1 ‘Everything I enjoy doing I just couldn’t do’: biographical disruption for sport-related injury . Dominic Malcolm (Loughborough

We Couldn't Do It Without Them

INSURANCE AGENCY.nyshistoricnewspapers.org/lccn/sn84035540/1870-04-30/ed-1/seq-1.pdf · “Well don’t cry, my boy, I told your mother, ai you remember, that what you couldn't do

Kelsey Kiel: “Never in a Million Years Would I Have ... · out what I wanted to do, so I couldn't really afford a full membership at a CrossFit gym, which is something that people

What Can I Do Now That I Couldn't Do Before? v1.02

How To Become A Christian: It certainly couldn't Also, if you … · 2011-12-16 · Christmas to do what I could not do to die for me, so I can live with You. I don't understand it

Publication Name · THE MOTH double ear infection, and strep throat all at the same time. I couldn't see, I couldn't hear, I couldn't talk. And it was mainly because I was taking

Uncollect…  · Web view · 2013-10-12"Couldn't we get on as other people do?" said Rosalys, trying not to cry at these arguments. "I am so tired of concealment, and I don't

jacksonvillemom.com...What would you do if mommy got hurt at home and couldn't talk? the What would you doifyougotlostsomewnereP What do YOU do if the smoke detector goes {Where do

Till Tenth Generation Press Kit - National Center for ... Tenth Generation_Press Kit.pdf · "I never sat them down and told them my story. I couldn't do it." It was only after Tomi

The Equation That Couldn't Be Solved

Could and Couldn't

Looking Forward to God's BlessingSecure Site  · Deuteronomy 33: 1 2 — 34: 1 2 Die, my dear Doctor? That's the last thing I shall do! Henry, 3rd Viscount Palmerston They couldn't

City Tech OpenLab Web viewI couldn't write anything, even though I always had a story to tell, when it was coming about a story about my dream I just couldn't write anything, because

everydayenglishphilippines.weebly.comeverydayenglishphilippines.weebly.com/uploads/4/9/6/1/49612279/unit-10.pdfBob couldn't do his homework because he had a stomachache. Sally couldn't