the physics of proteins
DESCRIPTION
Protein folding, magic numbers and hinge forces. The Physics of proteins. Dymanics of proteins, solitons. Per-Anker Lindgård Risoe National Laboratory, Roskilde, DTU, Denmark. Proteins very interesting. We need ~100.000 different for life (why so many?) Are the nano-machines of life - PowerPoint PPT PresentationTRANSCRIPT
![Page 1: The Physics of proteins](https://reader035.vdocuments.us/reader035/viewer/2022070423/568167e0550346895ddd4377/html5/thumbnails/1.jpg)
The Physics of proteins
Per-Anker Lindgård Risoe National Laboratory, Roskilde,
DTU, Denmark
Protein folding, magic numbers and hinge forces
Dymanics of proteins, solitons
![Page 2: The Physics of proteins](https://reader035.vdocuments.us/reader035/viewer/2022070423/568167e0550346895ddd4377/html5/thumbnails/2.jpg)
Proteinsvery interesting
We need ~100.000 different for life (why so many?)Are the nano-machines of life
Globular (free floating)Membrane bound
• Structure: Rather dense, but not like a crystal, frac. dim. = 2.5
• Function: Act on light pulse or chem. binding: HOW?• Folding: Spontanous, rather fast: HOW? • Aggregation: (avoid) HOW?
![Page 3: The Physics of proteins](https://reader035.vdocuments.us/reader035/viewer/2022070423/568167e0550346895ddd4377/html5/thumbnails/3.jpg)
Water channel (no H+) very important 1.000.000.000 w./sec.
![Page 4: The Physics of proteins](https://reader035.vdocuments.us/reader035/viewer/2022070423/568167e0550346895ddd4377/html5/thumbnails/4.jpg)
Protein structureglobular – membrane
primary, secondary, tertiary structure• Primary structure: The sequence
~100 long (20 letters – amino acids)IAMWRITINGTOINFORMYOUTHATWEHAVEANEWPROGRAMOFCROSSDISCIPLINARYFELLOWSHIPSFORYOUNGSCIENTISTSQUALIFIEDINTHEPHYSICALSCIENCESW
HOARELOOKINGFORPOSTDOCTORALTRAININGABROADINBIOLOGY.(208 characters) HFSP see DPL home page: http://DPL.Risoe.DK
• How can it fold on an information like this• We can now identify ’words’ > 80% sure:
α-helix, -sheet, turns…
I am writing to inform you that we have a new program of Cross-Disciplinary Fellowships for young scientists qualified in the physical sciences who are looking for postdoctoral training abroad in biology.
![Page 5: The Physics of proteins](https://reader035.vdocuments.us/reader035/viewer/2022070423/568167e0550346895ddd4377/html5/thumbnails/5.jpg)
Secondary structuretypical folding times
α-helix (~ 0.1 µsec)-sheet (~ 6 µsec)Turns (maybe faster)
Tertiary 1 msec – few sec
![Page 6: The Physics of proteins](https://reader035.vdocuments.us/reader035/viewer/2022070423/568167e0550346895ddd4377/html5/thumbnails/6.jpg)
Protein foldingProteins come as a piece of rope
First they must foldTwo real cases:1qpu: Cytochrome b562, chain A, oxygen transport (106 aminoacids)ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYHQKYR
2hmq: Hemerythrin, chain A, electron transport (114 aminoacids)GFPIPDPDPYCWDDISFRTFYTIVIDDEHKTLFNGILLLSQADNADHLNELRRCTGKHFLNEQQLMQASQYAGYAEHKKAHDDFIIHKLDTWDGDVTYAKNWLVNHIKTIDFKYRGKI
![Page 7: The Physics of proteins](https://reader035.vdocuments.us/reader035/viewer/2022070423/568167e0550346895ddd4377/html5/thumbnails/7.jpg)
Rectified structure:on a cubic latticeall lengths the sameHinge forces
H-H modelHydrophobic-Hinge model
Various representations of the structure1qpu: Cytochrome b562, chain A, oxygen transport (106 aminoacids)
i r i l i
![Page 8: The Physics of proteins](https://reader035.vdocuments.us/reader035/viewer/2022070423/568167e0550346895ddd4377/html5/thumbnails/8.jpg)
Structure must be known in the unfolded state
First come – first served principle
• To be predictable from the sequence• To prevent non-native contacts (like +…-)• To screen interactions• Non-equilibrium problem (in general)• Secondary/turns/loops form first – at least
partially
• Hinge-guide towards the native structure is the any evidence for this?
![Page 9: The Physics of proteins](https://reader035.vdocuments.us/reader035/viewer/2022070423/568167e0550346895ddd4377/html5/thumbnails/9.jpg)
Studies of small proteins point towards case 1Recent studies accumulate evidence in favor of case 2
1) spin glass– funnel model - ‘concerted’ motion, folding nucleus equilib. , second and tertiary simultaneous (Fersht, Wolynes …….)
2) Hierarchical, diffusion-collision model, turns & secondary first (partially) (Balwin, Rose, Karplus)
Support basis for the H-H-model
Highly controversial:Schools are forming
![Page 10: The Physics of proteins](https://reader035.vdocuments.us/reader035/viewer/2022070423/568167e0550346895ddd4377/html5/thumbnails/10.jpg)
Is the spin glass scenario correct?
• Spin glass: multitude of energy minima no definite structure
• what is a ‘funnel’upside down
• More like a ‘single crystal’just one form, produced by ‘seeds’
![Page 11: The Physics of proteins](https://reader035.vdocuments.us/reader035/viewer/2022070423/568167e0550346895ddd4377/html5/thumbnails/11.jpg)
Solid state structures• 230 symmetry groups
or different structures: bcc, fcc, hcp etc.• Can we do the same for protein structures?• How many fold classes?• Simplify:
simple metals always have liquid -> bcc‘parent’ bcc -> closed packed ‘variants’
• Can we do the same for protein structures?
![Page 12: The Physics of proteins](https://reader035.vdocuments.us/reader035/viewer/2022070423/568167e0550346895ddd4377/html5/thumbnails/12.jpg)
My scenarioProtein
Unfolded
Molten globule
Parent structure
Final ‘native’ str.
Solid state
Gas
Liquid
bcc
Closed packed
![Page 13: The Physics of proteins](https://reader035.vdocuments.us/reader035/viewer/2022070423/568167e0550346895ddd4377/html5/thumbnails/13.jpg)
Computer simulation of (un) folding
α-helix (en-HD) -sheet (FBP28 WW) Fersht et al Nature 421, 843 (2003) Fersht et al PNAS 98, 13008 (2001)
![Page 14: The Physics of proteins](https://reader035.vdocuments.us/reader035/viewer/2022070423/568167e0550346895ddd4377/html5/thumbnails/14.jpg)
Hydrophobic-hinge model• Problem reduced from 2100 random
contact tests (Levinthals paradox) to• Pack 20 sticks as closely as possible!• How many ways can that be done? (count)• How to select just one of those? (hinge)
• The name (irili) Hamiltonian: Int. b. spins H = - J Σ Sn • Sm - K Σ Sn x Sm
• First how manyi ~J l ~K
![Page 15: The Physics of proteins](https://reader035.vdocuments.us/reader035/viewer/2022070423/568167e0550346895ddd4377/html5/thumbnails/15.jpg)
Total number of dense folds
2 x 2 x 2 box, coordination number z = 4 and z = 5. Number of configurations as a function of elements. #elements #dense(z=4) #total(z=4) #dense(z=5) 1 1 1 12 1 1 1 3 1 4 1 4 6 15 8 5 9 53 12 6 8 161 8 7 6 444 6 8 24 1100 36 9 76 2590 164 10 84 5560 192 11 48 11412 146 12 120 20384 584 13 722 35280 3984 14 988 52078 6488 15 424 76116 3264 16 396 90936 5464 17 172 106728 4220 18 160 97362 8440 19 2908 87696 115084 20 6366 57460 313360 21 1752 36684 86115 22 3300 15088 496650 23 656 5812 242210 24 848 924 865544 25 0 0 780625 26 0 0 206692
(z/e)N
27-mer
36-mer
![Page 16: The Physics of proteins](https://reader035.vdocuments.us/reader035/viewer/2022070423/568167e0550346895ddd4377/html5/thumbnails/16.jpg)
How many fold classes?• We know all the names:
‘PROTEINFALTUNG’• 3 2 2=
2 times1 2 2+1
4000 fold classes, if all used (up to 17 elements) 1000 fold classes suggested by Chothia
"firilifarufilifil" "filirifabufarufar"
17 elements ~ 100 amino acids
![Page 17: The Physics of proteins](https://reader035.vdocuments.us/reader035/viewer/2022070423/568167e0550346895ddd4377/html5/thumbnails/17.jpg)
Hinge forces?• Native structure must know in extend. state• Lift conf. degeneracy as H= - Σ J Sn• Sm – h Σ Sn
z
(small h lift inf. deg.)
6 folds: N- and C CN
NC
Hinge: to place the rest on the right sideStructures need not be perfect
We need to learn how to identify the hingesαhelix length - turns are candidates
![Page 18: The Physics of proteins](https://reader035.vdocuments.us/reader035/viewer/2022070423/568167e0550346895ddd4377/html5/thumbnails/18.jpg)
Configurational entropy
![Page 19: The Physics of proteins](https://reader035.vdocuments.us/reader035/viewer/2022070423/568167e0550346895ddd4377/html5/thumbnails/19.jpg)
Phase diagram as for a martensitic transformation
![Page 20: The Physics of proteins](https://reader035.vdocuments.us/reader035/viewer/2022070423/568167e0550346895ddd4377/html5/thumbnails/20.jpg)
Magic numbers and abundance
Representative data base of foldsRost & Sander J. Mol. Biol.232, 584 (92)
Prediction from the H-H model
![Page 21: The Physics of proteins](https://reader035.vdocuments.us/reader035/viewer/2022070423/568167e0550346895ddd4377/html5/thumbnails/21.jpg)
Conclusion• Alternative, simplistic (but ambitious) view• Consider 2nd & loops/turns on same footing• Hydrophobic packing 4000 fold classes
domains (100 a.acid) abundance, magic numb.
• Hinge force: a method to reach corr. fold’native’ known in the extend. statepredict tertiary str. from sequence
• Problem: ‘native’ may be distorted difficult to find 2nd & loops and hinges
Per-Anker Lindgård J. Phys. Cond. Matter 15, S1779 (2003)Per-Anker Lindgård&Henrik Bohr PRL 77, 779 (96), PRE 56, 4497 (97)
![Page 22: The Physics of proteins](https://reader035.vdocuments.us/reader035/viewer/2022070423/568167e0550346895ddd4377/html5/thumbnails/22.jpg)
Dynamics of proteins• Now they are folded, interesting to
test the properties.• Pump-probe experiments with
LASER -like a piano tuner
• Soliton theory for αn α–helix -the exact Toda solitons
![Page 23: The Physics of proteins](https://reader035.vdocuments.us/reader035/viewer/2022070423/568167e0550346895ddd4377/html5/thumbnails/23.jpg)
Free-electron Laser: FELIX
As good as a grand piano
![Page 24: The Physics of proteins](https://reader035.vdocuments.us/reader035/viewer/2022070423/568167e0550346895ddd4377/html5/thumbnails/24.jpg)
Interpretation?• Bacteriorhodopsin
(85% -helix)• Line at 115 cm-1
specially long-living • Strange if on large
scale •We have suggested a new interpretation:F. D’Ovido, PA Lindgård & H.Bohr, PRE 71, 026606 (2005)
•H-bond excitations alongthe -helixas in poly-amidesO.Fauerskov
Moritsugu et al, PRL 85, 3970 (2000)
![Page 25: The Physics of proteins](https://reader035.vdocuments.us/reader035/viewer/2022070423/568167e0550346895ddd4377/html5/thumbnails/25.jpg)
Optical spectrum of a soliton• Moving pulse (Tsunami) - is not an oscillation• Difficult to measure• Gives no resonance peak• Gives a 1/ω 2 ‘background’ peak around ω =0• More fancy effects:• Frequencies inside bump are different
(local different struc. self-trapped)• Non-perfect soliton emits slowly phonons
(i.e. can seemingly sustain phononsand give long life-time)
• Possible energy channel
![Page 26: The Physics of proteins](https://reader035.vdocuments.us/reader035/viewer/2022070423/568167e0550346895ddd4377/html5/thumbnails/26.jpg)
H-bonds in an -helix
![Page 27: The Physics of proteins](https://reader035.vdocuments.us/reader035/viewer/2022070423/568167e0550346895ddd4377/html5/thumbnails/27.jpg)
LJ- & Toda potentials
Analytic tools for solitons and periodic waves in helical proteinsPhys. Rev. E 71, 026606 (2005)
LJ: k = 1.4 104 dyn/cmm = 1.7 10-22 ghν= 100 cm-1
118 cm-1 (full)
![Page 28: The Physics of proteins](https://reader035.vdocuments.us/reader035/viewer/2022070423/568167e0550346895ddd4377/html5/thumbnails/28.jpg)
Solitons on 3-H-chainsboth for Toda and LJ
time
Position Molecular Dynamics simulations
![Page 29: The Physics of proteins](https://reader035.vdocuments.us/reader035/viewer/2022070423/568167e0550346895ddd4377/html5/thumbnails/29.jpg)
Propagation of a energy pulse in a helix
Molecular Dynamics simulation
Time (ps)
site
![Page 30: The Physics of proteins](https://reader035.vdocuments.us/reader035/viewer/2022070423/568167e0550346895ddd4377/html5/thumbnails/30.jpg)
Conclusion• Proteins are important and interesting• Folding: a very major problem in Science
• Dynamics: interesting non-linear excitationsSolitons
• Lots of interesting work for physicists, mathematicians and computer people
Thank you for your attention