september 13, 2013.pdf

7/29/2019 September 13, 2013.pdf

1/20

Vol. 131 No. 27 Friday, September 13, 2013

www.minnedosatribune.com

90 cents + tax

inside

New dam

installed

Jamboree

funds

dispersed

11

2

this week

We acknowledge the

financial support of the

Government of Canada

through the

Canada Periodical Fund

of the Department of

Canadian Heritage.

General Hugh Dyer 138, MinnedosaLegion Week Activities

Appreciation TeaWednesday, September 18th

2:00 - 4:00 p.m.

Appreciation B.B.QFriday, September 20th11:00 a.m. - 2:00 p.m.

50 -50 BingoSaturday, September 21st

1:00 - 4:00 p.m. /LFHQVH

Photos by Jennier Paige

By JENNIFER PAIGE

Harvest is well underway and armers through-out the province can be seen working in theirfelds around the clock.

According to the provincial crop report, above

normal temperatures last week resulted in signif-

cant crop ripening and maturity throughout much

o the Southwest Manitoba.

Along with the warm temperatures and humid

conditions came isolated and severe thunderstorms

that resulted in localized heavy rainall and hail

causing some crop damage to matured crops in a-

ected areas, including lodging o crops, shattering

o standing and swathed canola and cereal crops.

Harvest o spring wheat, barley, oats and cano-

la continues and armers have now begun seeding

winter wheat.

If your labelreads

Its time torenew!

Call 867-3816

13/09/30

Harvest in full swing

7/29/2019 September 13, 2013.pdf

2/20

2 Te Minnedosa ribuneFriday, September 13, 2013

A Salute toBroadway

featuring

$DURQ+XWWRQ

DQG)HPDOH9RFDOLVW

&DLWOLQ:RRG

ZLWK&KULVWRSKHU.D\OHU3LDQR

Minnedosa United Church

Saturday, September 287:30 p.m.

Tickets $15.00Sponsored by:

Preceptor Zeta Chapter

of Beta Sigma Phi

72:12)0,11('26$

+

7/29/2019 September 13, 2013.pdf

3/20

3Te Minnedosa ribune Friday, September 13, 2013

When planning your wedding, visit theMinnedosa Tribune for:

Invitations and EnvelopesEnvelope Seals

Scroll Rings

Thank You NotesKeepsake Bookmarks

Place Cards

Confetti CardsPersonalized Napkins

Personalized Match Books and Boxes

&oPe in and browse ourFatalogue ofFlassiFandFontePporary designs sure tot theliking of every bride and groom!

/8&.

7/29/2019 September 13, 2013.pdf

4/20


Darryl A. Holyk - Publisher & Editor- [email protected]

The Minnedosa Tribune Ltd.Box 930 Minnedosa, MB R0J 1E0

Published Friday o each week rom the premises oTe Minnedosa ribune Ltd. 14 - 3rd Ave. S.W.

Minnedosa, MB. R0J 1E0Member o Manitoba Community Newspapers Association

and Newspapers CanadaAudited twice a year by Canadian Media Circulation Audit

TRUSTED CONNECTED TARGETED

Phone: (204) 867-3816Fax: (204) 867-5171Cell: (204) 867 - 7000

Te Minnedosa ribune is independently owned and is theoldest weekly newspaper in the Canadian West and haspublished continuously rom the same premises sinceMarch o 1883. We acknowledge the fnancial support o theGovernment o Canada through the Canada Periodical Fund

(CPF) or our publishing activities.

E-Mail Addresses:

General: [email protected]/printing: [email protected]

Classifeds: [email protected]


T e Minnedosa ribune Ltd. does notguarantee the publication o all submitted articles andphotographs. Tese submissions, are at the discretion o thepublisher and will appear as space permits. Te Minnedosaribune reserves the right to edit any submission as deemednecessary by the publisher.

We are not responsible or ax transmissions or emailsubmissions that are not received. o guarantee that suchsubmissions have been received please confrm with a phonecall or in person.

All contents copyright 2013

Around

TownByDarrylHolyk

Ag Hall of FameDo you know someone who has made outstanding

contributions to the improvement o agriculture and thebetterment o rural living in Manitoba? I so, nominatethem or induction to the Manitoba Agricultural Hall oFame 2014. Nominations are now being accepted and

will be accepted until October 31st. For more inorma-tion and nomination orms, please contact Pat Bailey at204-728-3736, email [email protected] visit www.manitobaaghalloame.com

Fundraisers returnWith September comes the return o two exciting

undraisers, the erry Fox Run and the Heart and StrokeBig Bike Ride. Minnedosa UC is hosting the local erryFox Run this Sunday, September 15th with registrationtaking place at 9 a.m. at MCCC. On uesday, September17th, the Big Bike will roll into town. Tis year marks the20th year o the Heart and Stroke Foundations Big BikeRide which is scheduled to start at 5:30 p.m. rom MCCC.

Old buildings featurewo o my avourite magazines are T is Old House

and Old House Journal and apparently I am not alone inmy interest o old buildings. Ive received some encour-aging comments on the eature on Motherwell Home-stead in last weeks paper. I would be happy to showcasemore old homes and buildings rom time to time and i

you have an old home or building that might have an in-teresting story, historic character or just a neat old build-ing and you would be willing to allow us to eature it in anarticle or photo spread, please let me know.

Found in the garden...

By DARRYL HOLYK

For millions o people around the world, today is ananxiety flled, dreaded day. Yes, many people o allages and all walks o lie ear Friday the 13th.

Many people simply joke about the Friday the

13th superstition but there are some who genuinelyear this day. Tere are two terms or the ear o Fridaythe 13th Paraskevidekatriaphobia and/or Friggatris-kaidekaphobia. I was somewhat surprised to learnthat it is not uncommon or people to hold o on theirplans or daily routines on a Friday that happens to bethe thirteenth day o the month. Some people reuseto leave the saety o their home on this day. Some re-ported aects o Friday the 13th include drops in busi-ness sales or investments and ewer people using air-lines and other modes o transportation. Tis is morethan a silly superstition; it is a very real ear and belieor some. Many also consider the number 13 and any-thing related to it unlucky. Te ear o the number 13 iscalled riskaidekaphobia.As one o the most popular and widely believedsuperstitions, unlucky number 13 is oten omitted.

You may have noticed some high rise buildings do nothave a 13th oor. Now in reality, this is ridiculous as

we all know the oor above the 12th oor will alwaysbe the 13th but oten this oor is relabelled as some-thing dierent. Some buildings label the oor abovethe 12th as the 1 4th or oor 12A. I have stayed in hotelsthat do not include a 13th oor and whether you havenoticed it or not, most o you probably have as well.

Te same goes or room numbers, many buildings donot have a room with a number 1 3 in it. In some cases,the building designers or owners may actually believethe unlucky 13 superstition but more likely it is simplya case o omitting 13 to put the minds o superstitiouspatrons at ease. Its also better or business, as some

people would actually reuse to stay in room 13 or any-where on oor 13.

Tere does not seem to be any logical or scien-tifc evidence to support the idea that the number 13or Friday the 13th are unlucky but there are all kindso dierent stories and belies dating back hundredso years that still have people eeling uneasy about allthings related to this number and day.

Tis superstition has certainly worked well or theflm industry with the popular horror series, appro-priately titled Friday the 13th. Since the frst movie in1980, there have been 12 related flms making it thehighest grossing horror ranchise in North America.Box o ce revenue, video sales, video rentals and oth-er Friday the 13th related merchandise sales come inclose to $700,000,000.

Looking back through history there have beentragic events and major disasters that have occurredon Friday the 13th and some say thats all the proothey need. In reality, bad things happen every day, nomatter what the date. oday is the frst Friday the 13tho 2013 but its not the only one this year. We will haveanother one in December. Tere is no need to ear Fri-day the 13th its just another day on the calendar.

Just another day on the calendar

Tis is the time o theyear when people begin

harvesting their gardensand now and then comeacross an oddity that hasproduced over the grow-ing season. Tis week wehave a potato grown byDarwin Matthews whichresembles a rabbit or someother animal. Te potatohas two distinct ears, asnout, two little arms andlegs. You just never know

what youre going to fndin the garden!

Pic of the week...With harvest underway,

sights such as this oneare common on our

roadways. A reminder

to all drivers to be

cautious and patient

with large farm

machinery on the road.

Tey may be slow

moving but they have an

important job to do. Put

aside your road

rage and share the

road with them!

Photo by Jennier Paige

7/29/2019 September 13, 2013.pdf

5/20


TOP RATE1 year

1.75%**Rates subject to changeCertain conditions may apply

3 year

2.10%*5 year

2.40%*

Dave McDonaldBruce McNabbwww.ricefnancial.com

Call For More Terms & Rates 867-3946

Te Minnedosa Tribune welcomes Letters to theEditor. All letters must include the writers ull name,address, and telephone number. Only the writersname will be published; address and phone numberare required or confrmation. Anonymous letters willnot be published. Letters that are deemed libelous,

in bad taste, or describe an incident involving otherpeople, will not be published. Te Minnedosa Tribune reserves the right toedit letters based on taste, legality, clarity, andlength. Letters to the Editor can be submitted inperson, sent by mail to Box 930, Minnedosa, MBR0J 1E0, by ax (204) 867-5171, or by email [email protected]

Tribune FounderWilliam Gibbens

Born - 1854 at London, EnglandDied - February 20, 1932

at Cornwall, Ontario

LetterstotheEditor

Letters to the Editor

The Minnedosa

& District

FoundationWhen planning your

estate, a donation tothe Minnedosa &

District Foundationwill reduce your taxes.

Call Brock Alexanderat 204-705-0156

To Minnedosa and area citizens,

As some people may have heard, the MinnedosaHandivan has not been operating to its ull capacitylately due to waiting on a new lit or the handivan. Un-ortunately this is not a quick fx, but hopeully the vanlit will be operational by the end o September.

BU- due to a shortage o Handivan drivers, thehandivan will only be operating two weeks in Octoberand two weeks in November. Unortunately our plea or

volunteer drivers has gone unanswered. We (t he board)

were hoping that by oering an incentive o one thou-sand dollars ($1,000.00) to your avourite charity/orga-nization/club in return or a year o volunteering wouldpossibly draw in some new volunteers, it sadly did notinterest even one person. So the Handivan can no lon-ger oer its service on a weekly basis until more volun-teer drivers come orward to help the existing drivers.I anyone has any questions ple ase eel ree to call

Brenda Hales @ 204 867 2569Te ollowing weeks are the scheduled hour s o op-

eration or the handivan: October 6th - 12th and 20th- 26th, November 3rd - 9th and 17th - 23rd.

Sincerely;

Brenda Hales,

Secretary,Minnedosa Centennial Handivan Association

Dear Editor,

My name is ChrisCory. For the lasttwo seasons I have beentrying to make a go o acertain tourist and townattraction.

First o , I would like

to say thank you or thesupport I have receivedrom everyone rom resi-dents to visitors o thisgreat place.As I sit here on the

deck looking at the mostamazing beach a greattown and community can

have, I wonder why thereis no town support or this.

For past two years Isit here day in and dayout looking at an emptybeach, beautiul waterand amazing surrounding

views. I have had somegood days running the

canteen but a lot o daysI sit here with no sales. I

wonder is it my pr oduct oris it me? Ten reality hitsme, Ive got a campgroundnext to me that seems verynice to be at, always busy,but the people who runit dont use me as an as-

set to their campground

and dont tell people I amhere. In my knowledge ohumanity we should not

just look ater ourselvesbut look out or peoplearound us.In this case, we have

a great beach, beautiulview and a pavilion look-ing over the water and

valley. Someone runningand trying to make a liv-ing in the canteen to serve

your community and acampground and beachbut struggling to makeends meet.

As I did last year andthis year whenever thereis daycare or sports campI give ree ice cream tothe kids as they grow andhave un at the beachhere. I only shop local sothe money I make goesback into the communityand I have built a greatrelationship with Burgess,Co-op, and the ever deli-cious bakery you have inthis great town and cant

orget my night retreats

at the Gateway Motel andthe great people there.

As a small businessowner, I know ood andbeverage/hospitality isa tough one but i we all

work together instead oapart we can and will havea convenience or thiscommunity to appreciateand have.

Over the past ewyears when I talk to mycustomers they are sohappy that I am up andrunning as they miss hav-ing this at their beach and

campground.Te only day this tour-

ist and community spot isadvertised is on CanadaDay as I do very well each

year, I cannot bank mywhole summer on justthat one day. We needto get together and bringback this community goldmine and all enjoy it.

Chris Cory

Dear Editor,

his letter is to advisethe community o thepresent situation. As o thisdate, we are without any-one to act in the position oCo-ordinator or this groupo volunteers. Unortu-nately, none o the presentmembers are able to as-sume the responsibility atthis time.Ideally, two people are

needed to act in this capac-ity to share the duties, Te

primary workload takesplace during the frst threeweeks o December, butsome preliminary work isrequired ahead o time. Forthat reason it is necessaryto have someone on boardas soon as possible.

Tis group has alwayshad exceptional com-munity support and veryhard working and dedi-cated volunteers. It hasulflled a very real need inthe community or many

years. However, in orderto continue, leadership isrequired. We are hopingsomeone will step up andaccept this very rewarding

volunteer opportunity.Feel ree to contact me

or any urther inormationat 204-867-2660 or [email protected] you or any help youmay be able to provide.

Sincerely,

Gail V. GravesMinnedosa, MB

Handivan driver

shortage forcesservice cuts

Work together instead of apart

Co-ordinator needed

for Xmas Cheer Board

More Letters to the Editor

on Page 7

7/29/2019 September 13, 2013.pdf

6/20


*UDQW$SSOLFDWLRQIRU0LQQHGRVDDQG'LVWULFW)RXQGDWLRQ,QF

0,66,2167$7(0(17

7KH0LQQHGRVDDQG'LVWULFW)RXQGDWLRQ,QFLVFRPPLWWHGWRHQKDQFH

WKHTXDOLW\RIOLIHIRURXUFLWL]HQVE\

SURPRWLQJFKDULWDEOHHGXFDWLRQDODQGFXOWXUDOHQGHDYRUV

WRHQFRXUDJHDQGLQVSLUHGRQRUVLQFKDULWDEOHJLYLQJIRUWKHEHQHWRI

WKHFRPPXQLW\DQGWR/($9($/(*$&

7/29/2019 September 13, 2013.pdf

7/20


13092gg04

Wheelchair access

is available.

Five days notice

required.

HEARING:

The Public Utilities Board (Board) anticipates holding a public hearing

of an application from Manitoba Public Insurance Corporation (MPI)

for approval of rates and premiums for compulsory vehicle and driver

insurance as of March 1, 2014. The hearing would take place at the

Boards Hearing Room, 4th Floor, 330 Portage Avenue, Winnipeg, MB

(commencing at 9:30 a.m.) on September 24, 2013.

RATE IMPACT:

The Corporation is requesting approval for Basic Autopac vehicle and

drivers licence insurance rates and premiums effective March 1, 2014,

which, if approved, would result in a 1.8% overall increase in MPIs

Basic premium revenue (excluding the impact of vehicle upgrades and

an increased overall driver and vehicle population).

Actual vehicle and driver premiums would vary depending on claim

and driving experience, insurance use, territory and vehicle rategroup. Full particulars, including the rate impact and application, can

be found on the Manitoba Public Insurance website www.mpi.mb.ca.

Reminder Notice Of Public Hearing

Applicant:Manitoba Public Insurance Corporation

PARTICIPATION:

Parties wishing to submit a brief or to express comments at the

hearing should contact the Board Secretary (204-945-2638 or

1-866-854-3698, toll free).

GENERAL INFORMATION:

Interested parties should take note that the Board does not have

jurisdiction over the MPI lines of business denoted as Ex tension or

SRE, or as to MPIs Driver and Vehicle Licensing operation.

Persons seeking further information as to MPIs application, or

with respect to the Boards process, and/or wishing to address

the public hearing in French should notify the Board Secretary by

September 16, 2013. As well, interested parties may examine MPIs

application and supporting materials, either at the offices of the

Corporation or on its website, or the Boards office.

DATED this 7th day of August, 2013.

H. M. Singh

Secretary

The Public Utilities Board

Dear Editor,

Our Conservative gov-ernment recentlyannounced that Employ-ment Insurance rates thatemployers and employ-ees pay will be rozen orthe next three years. Tismeans that businessesand their employees righthere in Dauphin-SwanRiver-Marquette will bekeeping more money intheir pocket, which isgreat news or the smallbusinesses that are theback-bone o our ruraleconomy.Our Government, like

no other beore, under-stands that small businessis a cornerstone o oureconomy, creating jobsthat support amilies inour communities. Tats

why we have introducednumerous measures tohelp them out, like a hir-

ing credit or growing theirbusinesses and expandingthe workorce.

Little wonder smallbusiness has been such akey part o Canadas recov-ery rom the recent globaleconomic downturn. Inact, with the help o smallbusinesses, Canada hascreated over one millionnew jobs since the end othe global recession thebest record among all theG-7 countries.But as we all know, the

global economic recoveryremains challenging. Tisis especially true or Can-adas key trading partners

the United States andEurope. With our big ex-port markets still on shakyground, thats going to a-

ect Canadas economy.T ats why our Gov-

ernment is staying o-cused on the economy.One way were doing thisis through a three-yearreeze on EI rates. Tismeans rates or employ-ees and employers willstay at or below the 2013level ($1.88 per $100 oinsurable earnings) until2016. Tis will leave $660million in the pockets o

job creators and workersin 2014 alone, comparedto what they would have

otherwise had to pay un-der the projected ormula.Tis means more moneystays in Dauphin-SwanRiver-Marquette helping

to support our local econ-omy.

Im proud our Con-servative government is

promoting such a positiveplan or the economy, asthats what Canada needs not NDP leader TomasMuclairs big-tax hike planor Liberal leader Justinrudeaus admission thissummer he didnt have aplan at all on how to helpCanadas economy!

By remaining o-cused on the economyour government is ensur-ing that the jobs, growthand long-term prosperity

will be there or our ruralcommunities in Dauphin-

Swan River-Marquette.

Robert Sopuck,M . P . D a u p h i n - S w a nRiver-Marquette

EI freeze good news

for local economyLetterstotheEditor

By JENNIFER PAIGE

Scorching temperaturesdidnt detour SpecialOlympic athletes romgathering at the Minnedo-sa gol course or a goltournament on Sunday,

August 25th.

wenty-our golersrom all across Manitoba,including Minnedosa,Steinbach and Winnipeg,came together or a riend-

ly gol tournament.T e athletes played

two tournaments. Athletesthat shot 75 or better in 9holes, played individualgames, and athletes thatshot 76 or better played al-ternate shot with a amilymember or partner.

T is was the frsttime that we have triedthis ormat, it seemed tobe successul, says rudy

Adamson, event coordina-

tor. Te maximum shotsthey can have per hole is10, so with doing the alter-nate shot, it gives them thechance to putt.

Normally the athleteswalk the 9-hole course butdue to 33 degree tempera-tures the golers were able

to ride in gol carts. First,second and third place rib-bons were handed out ineach division and the dayconcluded with a meal.

Special Olympics

Tournament a Success

Photo submitted

By DOREEN TROTT

We are pleased tohear that MargaretNortham, who had sur-gery in Brandon is homerom the hospital. All thebest Margaret! Hope youare soon out playing soc-cer.

Church services be-gan this Sunday at Cadu-rcis with Elgin Hall onceagain at the helm. Sun-day school also started onSunday.

CADURCIS

NEWS

7/29/2019 September 13, 2013.pdf

8/20


585$/081,&,3$/,7

7/29/2019 September 13, 2013.pdf

9/20


ON THE FARM

Pioneer would like to welcome

Drew CardyCardy Crop Solutions Ltd.

for Minnedosa and surroundingarea.

(204)868-5961

Please give Cardy Crop Solutions Ltd. a call to discuss the Pioneerbrandseed products that will work for your operation. Offering a lineup of

premium seed for:

CANOLA CORN SOYBEANS SUNFLOWERS ALFALFA FORAGEINOCULANTS

www.pioneer.com/canada

The DuPont Oval Logo is a registered trademark of DuPont.

, TM, SM Trademarks and service marks of Pioneer. 2012PHL.

By ELMER KASKIW

Good harvest prog-ress over the last 7-10days has provided us with

some initial yield resultsthat are some o the high-est ever experienced in

the region. It seems wecan go or years where orone reason or another we

see yields reduced andthe ull genetic potentialo newer varieties are not

being realized. Ten weget a growing season likethis year where just about

everything seemed to alignin regards to weather and

we are experiencing frst-

hand the huge jump inyields that these varietiesclaimed when they were

initially released. Te big-gest di erence maker inregards to the 2013 grow-

ing season was the justin time rains and cooler

temperatures experiencedduring the critical ow-ering and flling periodthroughout much o July.

Delayed maturity con-

cerns due to the cool Julywere then alleviated once

we got into August whenwe saw above average tem-peratures and below nor-

mal precipitation whichallowed the crop to matureonly slightly behind what

would be considered nor-mal.

Fall Weed ControlProgram Critical

A all weed controlprogram is not only im-

portant in battling spe-cif c weed problems butis also important in our

battle against the increas-ing number o herbicideresistant weeds. Fall spray-

ing attacks weeds whenthey are most susceptibleand it also allows us to

use dierent herbicidegroups or combinations ogroups. Fields which have

a pre-harvest or all sprayprogram implementedare always virtually trou-

ble ree when it comes toplanting next spring. Te

warm above normal tem-peratures and rost ree

conditions over the lastcouple o weeks have beenideal or winter annual

weed germination andthe re-growth o perennial

weed problems. Te rost

ree conditions and stillrelatively warm tempera-tures to date, gives us an

excellent window in con-trolling this population o

winter annual and peren-

nial weeds. Most all spray-ing can begin somewherearound mid September as

by this time germinationo most winter annualshas occurred and peren-

nial weeds have recoveredrom the cutting or swath-ing operation.

In terms o productsmost all applications willhave a base glyphosate

component at various ratesdepending upon the level

o grassy weed and peren-nial weed growth. Tis

would include trouble-some weeds such as quack

grass, Canada thistle, sow

thistle and oxtail barley.In most instances there is

a need to boost glyphosateactivity or more di cultto control weeds such as

narrow lea hawks beardand dandelion. In thespring growers are limited

to Group wo products toprovide this boost in ac-tivity due to residual con-

cerns with phenoxys anddicambas. Fall applica-tions open the door to the

use o both phenoxy anddicamba products aloneor in combination with

Group 2s which can helpin our management o her-bicide resistant weeds.

Fall spraying has alsobecome critical i youhave grown winter wheat

over the last three to fveyears in your rotation.Winter wheat is notori-

ous in volunteering in theall and is the main vector

in spreading wheat streak

mosaic virus into springwheat crops. Te control

o winter wheat needs tobe complete as even a ew

volunteers can be respon-

sible or spreading thevirus. Tis persistence owinter wheat means that

one must also target feldsthat may have had winter

wheat grown on them any-

time within the last threeto fve years.

Fall Weed Control

in Yardsites

Now is also the time toimplement a weed control

program in your lawns andyard sites to control weedssuch as dandelion, broad

lea plantain, creepingcharlie, and henbit. Most24-D containing products

will control these weedsquite easily and at a rac-tion o the rate required to

control them in the spring.

In the case o creepingcharlie and its severity

one might want to includea 24-D product that alsocontains the active ingre-

dient called mecoprop.T is is also a good

time to tackle the bur dock

and round lead mallowthat has inected many

yards. Glyphosate at this

time o year will controlseedling burdock that hasgerminated this all and is

more easily done withinshelterbelts now that theleaves have allen. Round

lea mallow has a huge taproot and usually requires aglyphosate application on

established plants while a24-D application will usu-ally do a good job on all

germinated plants. Oneneeds to be careul withglyphosate around sucker-

ing trees such as lilacs andtowering poplars.

MAIL THIS FORM WITH PAYMENT TO BOX 930,MINNEDOSA, MB R0J 1E0 PHONE 204-867-3816

NAME:

ADDRESS:

TOWN:

PROVINCE:

POSTAL CODE:Online subscriptions at


Within Manitoba:

$37.29 tax included

Other Canadian locations:

$34.65tax included

New Subscription

Renewal

Subscribe to The Minnedosa Tribune

Ag report... Fall weed control

By ZELDA FIRBY

September 4th markedthe frst day o schoolor students and teachers

o the 2013 2014 schoolyear. Students either re-turning to or beginning

at the University o Mani-toba are Sam and Cassie

Ross, Gordie and CamRoss, Christopher Cardy,

Anna and Holly Donohoe.Hope everyone has a suc-cessul year.

Congratulations toCharles and Meriel aver-nor on becoming grand-

parents o a baby boy.Proud parents are Darren

and Alice Alord o Winni-peg.

Mark and Sylvia Fir-by and amily along withthe Reg Clarke amily o

Minnedosa spent a weekcamping at Lake Meti-goshe recently.

BASSWOOD NEWS

7/29/2019 September 13, 2013.pdf

10/20


Yadong Guan TrioEast-meets-West concert featuring the pipa, an

ancient Chinese instrument.October 29, 2013

at 7:30 p.m.Minnedosa United Church

Jimmy Rankinof The Rankin Family, performs a concert

full of yuletide cheerDecember 2, 2013

at 7:30 p.m.Minnedosa Community Conerence Centre

Red Moon RoadWinnipeg trio with poignant stories and smooth

harmonies.January 14, 2014

at 7:30 p.m.Tanners Crossing School Band Pit

MTC Play Miracle on South Division Street

A comedy about an imperfect family, faithand changing ti mes.

February 7, 2014at 7:30 p.m.

Minnedosa Community Conerence Centre

Season TicketsAdult: $55 Student Under 18: $30

Family (children under 18) $120 Single Parent Family: $65Available from Minnedosa Regional Library

45 1st Ave S.E. 204-867-2585or at the door

Minnedosa Perorming Arts Committee presents:

Rosie and the RivetersThe spirit of Gospel music with a side of Folk and

the charm of the 1940sOctober 2, 2013

at 7:30p.m.Minnedosa Community Conerence Centre

SUBMITTED

Manitoba Youth BeeRound Up is pleasedto announce the twoscholarship winners or

2013; Justin Kristjansson oForrest and Laura Hornero Minnedosa.

Justin has begun hisDoctor o Veterinary Medi-cine at the Western College

o Veterinary Medicine inSaskatoon, SK. He wasraised on a commercial

cow cal operation andpurchased his frst pure-bred shorthorn at age 13.

Justin has participated inRound Up since 2011 andbelieves the coming to-

gether o purebred breed-ers and commercial pro-ducers is a great way to

strengthen the bonds nec-essary to keep the bee in-dustry successul in Mani-

toba and develop the nextgeneration o cattle pro-

ducers in a way that will

ensure the longevity o ourindustry.

Laura has entered intoher f rst year at BrandonUniversity taking a Bach-

elor o Science in hopeso applying to the WesternCollege o Veterinary Med-

icine. She was raised on acommercial cow cal oper-ation and enjoys showing

cattle and volunteering atthe local veterinary clinic.She has participated in

Round Up since 2011 andstates that Round Up hasgiven her the opportunity

to meet others that havethe same interests as her.Laura enjoys working with

the younger members toeducate and encouragethem to be part o the bee

industry.T e Manitoba Youth

Bee Round Up Scholar-

ship is unded by Manitobabreeders, producers and

industry. Each year at the

Annual Breed Meetingsin January, an auction to

raise unds or this schol-arship is held. ickets areauctioned o at $10 each

to be drawn or the hon-ours o having your armor business name on the

Round Up shirts the ol-lowing year. Supporters olast years auction allowed

the scholarship commit-tee to give these two verydeserving young people

each a $1,000 scholarship.Tey are the uture leaderso our industry!

Manitoba Youth Bee Roundup presents frst scholarships

Photo submitted

(L-R) Manitoba YouthBeef Round Up

committee memberAndrea Bertholet,

recipients LauraHorner and JustinKristjansson and

committee memberKen Williams.

0LQQHGRVD/DXQGU\2 NEW machines that can do large loads

including blankets and duvets!28 minute wash cycle time.

31 2nd Avenue S.E., Minnedosa

8:00 a.m. - 9:00 p.m.Seven days a week!

By RAVENS GLEN WI

Shirley Pederson had her sister Bernice Atkinson, hus-band Art along with her niece and great niece Cindyand Kendra Poncsak o Brandon visit, on September 7th.Tey enjoyed a day at the arm.Mona Moyer took a ull Handivan o seniors to the

Deerboine Hutterite Colonys 23rd Annual Fall Sale obaking, produce and hand-made items. Everyone en-

joyed the shopping and a delicious lunch, especially

sticky buns! Several more olks rom town also attendedthe sale on Friday, a very hot day.Some local members attended the Minnedosa Horti-

culture Plant & Produce Sale last week. Tey also visitedErna Stemmers garden where she was selling some oher plants.

Newdale United Church began services last Sunday,starting on a new venture this year, as we are without a

Minister. Te Committee has lined up several Lay Minis-ters and Ministers to come once or twice a month which

we eel ortunate to have acquired. Tis will certainly be anew experience or the members who have agreed to take

the services as needed.Last weekend saw several boys rom our area trying

out or the Yellowhead Chies as the new hockey season

starts next month. High school hockey will also be start-ing or those that preer the recreational league.

Best wishes to Brent Waddell who is in Winnipeg

Hospital ater a reak boating accident at Sandy Lake lastweekend.

Hilda Davies spent last week, September 4th-11th,

holidaying in Mississauga, ON with daughter Doris andDwayne Waddell.We were sorry to hear that Gaylene Stimpson is back

in Brandon Hospital ater a all at home. Hope you aresoon back home.Birthday wishes are extended to Irene Creber and Ida

Bradley who both celebrated birthdays last week, we allwish you many more!

We all need to be aware o the large machinery on

our roads this time o year as harvest gets into ull swing!Early yields look good or many crops.

NEWDALE NEWS

HAVENEWS? LETUSKNOW!

The Minnedosa Tribune

204-867-3816

[email protected]

7/29/2019 September 13, 2013.pdf

11/20


13092gg09

13092aa00

By JENNIFER PAIGE

he Little SaskatchewanRiver ConservationDistrict recently fnishedconstruction o a new dam,

which will help slow down

currents and prevent ero-sion, just north o Clanwil-liam.

Colleen Cuvelier, dis-trict manager o the LittleSaskatchewan River Con-

servation District, explainsthat this portion o the wa-tershed is very rolling and

the water gets moving veryast and that can cause ero-sion, which can eventually

damage inrastructure.Putting this dam in

puts a little bit o a break

in the system where you

can slow the water down.

Water that is slowed downisnt as erosive and losessome o its hydraulic ener-

gy to a certain extent, saysCuvelier. All that waterends up here in the lake in

Minnedosa and then car-

ries on throughout the wa-

tershed. When water isntslowed, it causes erosionand can take out roads and

cause major problems.Te conservation dis-

trict spent the last ew

months planning the damconstruction, surveying,designing, and determin-

ing costs, fnding contrac-tors and where materials

would come rom.

We built up the oldlane way and then we putthe spillway in, the water

comes through and fllsup so ar and then runsthrough the spillway. It

is important to note thatwe are not creating a wa-ter reservoir, not like the

Minnedosa dam, we are

just creating a temporary

pause or heavy rains dur-ing the growing seasonor spring runo. Te dam

has a storage capacity o20 acre-eet, Cuvelier ex-plains.

Te conservation dis-

trict co-ordinated all sup-plies to be ready upon thestart o construction. Te

rocks or the project wererom a near-by landown-ers rock pile and hauled

to the site beore con-struction crews arrived.Construction o the dam,

named Andersons Creekor Andersons Drain, took

just over a week.

Te conservation dis-trict also created a culvert

within the dam, enabling

the ability to hold the wa-ter back and once the wa-ter begins to move at an

appropriate pace the gatecan be opened and the wa-ter released.

T e dam was cre-ated on local armer, Glen

Crawleys land. Crawleywas willing to p artner withthe district or the projectand also donated some

unds or the creation othe dam. Te R.M. o Mintoand the Assiniboine Water

Quality Fund provided the

rest o the money neces-sary.When we do any type

o project involving rockswe lay geo textile throughthe bottom o the spillway.

Ten we put rocks on top.And because the land-owner still needs to access

his felds on the other sideo the dam, we put somesmaller stones and grav-

el down. Tat is also thereason or the gentle sideslopes here, so that he can

get through with machin-

ery, Cuvelier continues.Tose are just some othe considerations you

have to throw in whenyou are planning to makesure that once the project

is complete, the site willstill service everyone in-volved.

Cuvelier and T e Lit-tle Saskatchewan RiverConservation District

technician, Kyle Brownwere on site last weekf nishing up the project,

planting a mixture o grass

seed in order to get somevegetation gro wing.

Te grass will help

with the erosion aspectbecause there is such aorce o water coming

through and i there is novegetation and just thebare soil, it gets washed

away and your probabilityo ailure increases. Even iit doesnt get that tall, that

little bit o grass growinggives the water somethingto come up against.

New Dam created to help prevent erosion



7/29/2019 September 13, 2013.pdf

12/20


YeOld

Trib

2003 Tis school year, students attending Kinder-garten and Grade One in RRSD will beneft rom aSounds Field Amplif cation System. Te system isbasically a small PA system that amplifes the teach-ers voice providing better communication with stu-dents.

1993 Robert Earle Gordon, publisher o TeMinnedosa ribune rom 1950 until 1985 passedaway September 8th. During his span o ownership,many changes took place at Te ribune as it wasbrought rom the age o cast metal type into the ageo the computer.

1983 Do you remember these local advertisers?Mr. Zees Quality Meats in Erickson, V.E. HamptonLtd. Electric, Heating and Rerigeration, MacDon-ald Carpet and Upholstery Cleaning, Big Valley Re-alty and ri-Mor Agro.

1973 Te Clanwill iam Greys captur ed the Mani-

toba Senior C sotball championship as they camethrough with three victories; 4-1 over CNRA o Win-nipeg, 6-4 over Doerkson o Winnipeg and 7-5 overBrandon Simplot.

1963 In the Good Roads Association awards theVillage o Strath clair won the beautifcation cate go-ry with the R.M. o Odanah winning second prize orbest kept municipal roads (Mileage under 50).

1943 An o cial low o 23.5 degrees h as complete -ly fnished the vegetable and late bloom gardens.

1923 Odanahs money bylaw is approved by Rose-neath School District rate payers. Tey municipalit ycan now issue debentures up to 42,500 to cover the

defcit.

1903 R.C. Boyd cut 122 acres in six days with onebinder. He only kept each team on or our hours ata time.

SUBMIED

W

elcome back bowlers new and old.Good games this week: Shirley Mickoski 234,

220; Jim Clark 169; Don Jones 186; Fred Stonehouse 152;Paul Chapski 136; Florence Haywood 121; Pat Delbridge136; Vivian Penner 180; Robert Hendry 211, 224; ClaySearle 184; Gladys Murray 165; Bud Amy 115, 113; GwenOrr 121; Shirley Davies 188, 180; Hazel Stonehouse 137;Bev Chapski 150; Ev Baisley 117; Geraldine Swiscoski139; Rosemary Hamilton 189; Vivian Cullen 155, 160 ; KenGill 152, 151.Anyone interested in a un aternoon, come out on

Monday aternoons at 1:00 p.m.Good luck next week.

Bowling resultsGolden Agers +55

By JENNIFER PAIGE

Ma n y i n d i v i d u a l sacross the countrywill be tying up their run-ning shoes this weekendto take part in the annualerry Fox Run. Markingits 33rd year, the erry FoxRun continues to raiseunds or cancer research.

T ere are regularparticipants we see every

year and then there alwaysseems to be a ew new ac-es, says Kathy Stone, or-ganizer with UC. We are

working together to outrun

cancer. Tis event is vol-unteer-driven and there isno entry ee or minimumpledge. We encourage ev-eryone to come out andenjoy the day.

Te erry Fox Run willbe taking place on Sunday,September 15th beginningat the Minnedosa Com-munity Conerence Centerat 10 a.m. Likewise events

will be taking place in over750 other communitiesacross Canada and 28 di-erent countries aroundthe world. 9,000 runs take

place in Canada every yearand organization eortsare all volunteer-led.

Te erry Fox Foun-

dation is one o the larg-est non-governmental

unders o cancer researchin the country and orevery dollar donated, 84cents goes directly to can-cer research.

Currently the Foun-dation has unded 1139cancer research projectsand in 2012, invested $29.3million into cancer re-search. Current multi-yearstudies include lung, ovar-ian, colorectal, pancreatic,oral, liver, oncolytic virusesand many more.

I became involved

because I was interestedin UC and part o UCsmission is awareness ocancer, so we do undrais-ing and awareness cam-paigns, we are involved inthis every year as well asour Daphodill campaign inMarch. Recently, UC hasbeen busy organizing vol-unteers, advertising, andgathering pledges, Stoneexplains.

UC volunteers willbe oering registration atBurgess Quality Foods onSaturday, as well as online

at www.terryox.org, andpledge orms are availableat the library and ModernLooks Unisex Hair Design.

Interested parties can reg-ister up until an hour be-

ore the run starts on Sun-day.We will run, walk or

bike rom the MCCC acrossthe dam to Minnedosabeach and then back to thecommunity centre or ourBBQ we have planned atnoon, says Stone.Organizers will hold a

BBQ ater the run at MCCCor partakers and any-one interested. Last yearMinnedosa held a success-ul run, seeing a number oenthusiastic participants

and beautiul weather.We appreciate and

are grateul or the com-munitys support. Last year

with donations rom thecommunity we sent in over$3,400.00, says Stone.Stone is a breast cancersurvivor, hersel. While sheis healthy today, she wasdiagnosed with breast can-cer in 2009 and has seenthe dierence advance-ments in cancer researchcan make, through her owntreatment and through oth-ers she met within the can-

cer community.Tere will be a little

group o us that will bewearing red -shirts on

Sunday. We wear thesebecause we are all cancer

survivors. Some o us havebeen through chemo andradiation and been a parto the cancer communityboth in Brandon and Win-nipeg.

Te erry Fox Foun-dation began 33 years ago

when erry Fox made hisiconic run through Canada.

Tats the thing aboutcancer. I am not the onlyone, it happens all the timeto people. Im not spe-cial. T is just intensifes

what I did. It gives it more

meaning. Itll inspire morepeople. I just wish people

would realize that any-things possible i you try.

When I started this run, Isaid that i we all gave onedollar, wed have $24 mil-lion or cancer research,and I dont care, man,theres no reason that isntpossible. No reason, saidFox while in Tunder Bay,Ontario, on September 1st,1980. erry had run 3,339miles, or 5,374 km.

Since 1980 there hasbeen more than $600 mil-

lion raised or cancer re-search and it is sae to saythat errys run is still in-spiring today.

Gearing Up for Another Run

By DIANE BACHEWICH

Gail Burns returnedback to her home inColumbus, Ohio, USA aterspending some time with

mom Sadie Rystephanukwho is doing fne ater herhospital stay.

Walter Prokopchuko Vancouver, BC who hasspent the past month withhis sister, Elsie Spitula andother amily members, hasreturned to his home.Earl and Liz Andrusiak

o Edmonton have beenvisiting in and around here,Clear Lake and Brandon,

while here, Earl put on amagical perormance showat the Drop-in Centre.Spending the weekend

with Helen Derhak was Aland Nancy Derhak o Rid-

ing Mountain; Butch andJoan Derhak o Oakburn,and Jenny Coulson o Dau-phin.

We would like to bidarewell to Rob Browningand Terse Anderson whohave moved to make theirhome in Winnipeg, whereT erse has a principalteaching position at RoseauRiver Res. We welcomeChad and Melissa Davies

and little Hayden who havetaken over their residence.

A large number at-tended the prayers anduneral service or the lateCarrie Bachewich which

was held at Ozerna St.Nicholas Catholic Church.

T e Legion Mens50/50 draw or the montho August was won by Di-ane Bachewich.

Welcome to RacheleBone o Elphinstone whois the new resident at theSandy Lake Personal CareHome.

Lillian Setter and Leoo Kelowna, BC called in ora surprise visit with IreneShandala. Tey were ontheir way home rom Win-

nipeg. Also, Brian Shan-dala and Louise Buckmireo Brandon spent the week-end with mom, Irene.Visitors with Olga Pro-

sken on the weekend wereGail and Lloyd Lekness, Ju-lie and Ed Alexiuk, Harold,Joyce and Mary Joy Pro-sken, all o Winnipeg.

Robert and Liz Man-

dzuk have returned backhere ater visiting with theirdaughter and son-in-lawand granddaughter at Nel-son, BC or a while.

Sympathy is extended

to Sadie Rystephanuk andamily on the passing o herbrother Nick Matachuk oEdmonton, AB.

Get well wishes toJoyce Coulson who hadopen heart surgery at theSt. Boniace Hospital in

Winnipeg.Al Derhak o Riding

Mountain is spending aweek with cousin, Ken Por-ter at Kens Panderaa.

Jenny Coulson spentMonday with Ida Andrey-chuk and with her sister,

Sophie Ellchuk in Newdale.Sympathy is extendedto Elsie Kristalovich andamily on the passing oElsies uncle, Mourice Pele-shak o Winnipeg. Alsosympathy to Cecil and DaleKristalovich and amily o

Alexander, MB on the pass-ing o Dales mother, BalConley o Brandon.

SANDY LAKE NEWS

DONT FORGET!Advertising deadline is

TUESDAYS AT NOON

Call

204-867-3816

or email ads to

adsales@

minnedosatribune.com

7/29/2019 September 13, 2013.pdf

13/20


$FFODLPHG0XQLFLSDO%\(OHFWLRQ

2IFLDOIRUWKH5XUDO0XQLFLSDOLW\

RI6DVNDWFKHZDQ

&RXQFLOORU:DUG+HQU\+DOHV

$FFODLPHG

%UHQGD)DQVKHU

6(25XUDO0XQLFLSDOLW\RI6DVNDWFKHZDQ

7HOHSKRQH

)D[

HPDLOUPVN#PWVQHW

The Minnedosa Golf & Country Club and the Rockin the Fields Par 3

Tournament Committee would like to thank all of the sponsors who

supported our event this past Saturday, September 7. It is your continued

support that makes this event a true success each year!

We would also like to thank all those businesses and individuals

who donated additional prizes, our ladies who volunteered to act

as recorders and of course all of those who participated.

We look forward to this event being even bigger and better for 2014!

Wilsons Wheels

Minnedosa Insurance

Minnedosa Credit UnionMcReal Eavestroughing

Jim Henry Construction

Canadian Tire

Fowler Hyundai

ViterraSki Valley

Burton Electric

Mitch the Pool Guy

McReal Eavestroughing

Jim Henry Construction

Viterra

Dekalb Seeds

Minnedosa Credit Union

Johns Tax Service

Blazers Heritage Co-op

Gold Sponsors:

Silver Sponsors:

Hole in One Sponsors:

By MAXINE WOODCOCK

Resource Coordinator

Hello everyone! Myof ce has been verybusy over the summermonths. It has been apleasure getting to knowmany o the seniors anddisabled in the communityand I look orward to work-ing with you again!

Our Service Provid-ers are being kept busy, sodont orget i you needa hand, give me a call andI will match you up withsomeone willing to help

you out! Do you need aride in town or elsewhere?Some o our Service Pro-

viders are willing to driveoutside o town. Need help

with cleaning, errands,

shopping, yard work orgeneral home mainte-

nance?Service to Seniors

is partnered with Victo-ria Lie Line and pres-ently has 60 subscribersin Minnedosa and area.I you are interested inthis service call the of ce.ERIK kits (Emergency Re-sponse Inormation Kits)are also available.

At times we all eeloverwhelmed. I you arenot sure where to turn orinormation or help, giveme a call. I have contacts

or many resources and or-ganizations and will gladlytake the time to help you.My of ce is open Mondayto Friday 9:00 a.m. 12:00p.m. and 1:00 4:00 p.m.

Stop by or call 204-867-5190.

I hope to organize aew clinics and events ointerest to seniors. A chairexercise group is in theplanning stages, so watchTe Tribune or an update.In conjunction with theupcoming Foot Care Clin-ic, I hope you nd the ol-lowing inormation help-ul. For more inormationon the clinic, please seethe Coming Events sec-tion.

Are you taking care

of your feet?

As Canadians age, threeout o our will requiremedical attention or ootproblems.

We are born withhealthy eet, so it is in our

best interest to take careo them. Only a small per-centage o the populationis born with oot problems.aking the time or basicoot care can help to keep

your eet healthy. Foot

problems may lead to aloss o independence and

well-being.T e eet experience

more wear and tear in alietime than any otherbody part and reportedlyare the most neglectedpart o the body. Poorly tting ootwear, neglectand a lack o awareness oproper oot care can createproblems.Falling can be prevent-ed by maintaining goodbalance, and pain-ree,healthy eet help you tokeep your balance. Staying

healthy and active keepsyou strong, but in order tobe active, your eet mustbe healthy as well. When

your eet hurt and you be-come less active, you beginto lose strength. Walkinghelps to keep your weightdown, prevents blood clotsand keeps bones and mus-cles strong.It is very important to

check your eet on a regu-lar basis or early signs odiabetes, arthritis, nervedamage and poor circu-lation. Get to know your

eet!

Foot Care Nurses arespecially trained. Winni-

peg echnical College andAssiniboine CommunityCollege are two schoolso ering this training. Tenurses receive specializedtraining speci c to theoot and lower limbs. Tetraining provides a com-plete understanding o thestructure and unction othe oot as well as diseaseprocesses and how theyaect the oot. Foot CareNurses are aware o healthand saety and cleanliness

when providing oot care.

T ey work closely withother health care proes-sionals and make reerralsas necessary. CertiedFoot Care Nurses are regu-lated by the proession andare accountable and re-sponsible or their actions.

Foot Care Nurses areable to provide clients withimportant inormation re-garding their specic ootproblems. Tey are ableto teach proper oot caremaintenance and iden-tiy many oot problemsby recognizing early symp-

toms.

Minnedosa and District Services to Seniors report

By DOROTHY JONES

Where has the sum-mer gone? WithSeptember we all get intothe swing o things at the

Legion.Legion Week as you

can see by the ads in thepaper this week with theLadies Auxiliary Appre-ciation ea, the Branches

Appreciation BBQ and the50-50 Bingo.At the all meeting on

Monday, September 9th,Don and Dorothy reportedon the MB/NWO Com-mand Convention. Teyreported on the introduc-tion o the new LegionLogo. Tis logo has been

used in our ront pagebanner ad. Te main pur-

pose o the new logo is tomake the Legion more vis-ible. With the electronic

world we live in, the Le-gion is working at updat-ing to the time. In the last

edition o the Legion Mag-azine there is a good reporton the convention worthreading. Tey enjoyed theevent and denitely wouldattend another.

President Don Jonesthanks all involved in FunFest activities. It was greatto see the veterans on the oat, w ith other Legionmembers there were 18 onthe oat. Tanks to those

who supported the Vdraw and the 50-50 Bingo.Padre Garry MacDow-

all reported he has visitedseveral members.

Te 2014 membershipcards are now available.Purchasing as an EarlyBird places your name in adraw or a ree 2015 mem-bership.

Please note: our nextmeeting is on Tanksgiv-ing Monday, October 14th.

Amendments to our by-laws will be presented and

voted on at that time. Wewould like to see a goodturnout or that meeting.

Legion introduces new logo

Some healthy

tips for

everyone:

* Wear comortableshoes and socks

* Check your eetdaily. Watch or cuts,sores, swelling, blis-ters, redness, etc.

* Keep your eetclean. Keep toenailstrimmed and clean.

* Use unscentedcream on eet ithe skin is dry andcracked. Wipe o ex-cess and do not applybetween toes.

* Keep active every

day.

Ifyourlabelreads

13 /08 /31Itstimetorenew!

Call 867-3816

Running onEmpty?

Print jobs may take up to

2-3 weeks to complete.

Fill up before youre out!

Minnedosa Tribune

867-3816

7/29/2019 September 13, 2013.pdf

14/20

TO PLACE AN ADBY PHONE Call 867-3816

Hours to place, correct or cancel ads:Monday - Friday 9 a.m. - 4 p.m.

BY MAIL CLASSIFIED ADVERISINGTe Minnedosa ribune, P.O. Box 930,

Minnedosa, Manitoba R0J 1E0

BY FAX 204-8675171

BY E-MAIL [email protected]

Te Minnedosa ribune Ltd. reserves the right todelete any words or phrases deemed by Te Minnedosaribune Ltd. to be objectionable, or to reuse to publish anyadvertisement. Te Minnedosa ribune Ltd. shall not beresponsible or any loss or damage to any advertiser or thirdparty resulting rom the ailure o an advertisement to appearin Te Minnedosa ribune Ltd. or rom any error or omission

in any advertisement which is published.

RATES$9.00 or frst 40 words, additional words .10 each.Repeat ads - Hal Price.

Classifed Display - $9.00/col. inch each insert.

(Incl. logo, box & bolding, and centering).

Happy Snaps: (Birthday, Engagement, Wedding, Birth, &Graduation)- $16.00 or the frst 20 words and the picture.

Obituaries: $6.50 per col. inch.

Reach the entire province (50 weekly newspapers) $189.00Westman and Eastman: $119.00

All Ads plus 5% G.S..

DeadlinesClassifed advertisements must be submitted no laterthan noon uesday or insertion in the ollowing Fridaysedition. ALL CLASSIFIED ADVERISEMENS MUS BE

PREPAID BEFORE INSERION.

Te Minnedosa ribune is not responsible ortypographical errors published AFER the frst insertion, nordoes it assume responsibility or errors published as a result oan advertisement placed, changed, or cancelled, by telephone.o ensure your advertisement appears correctly please submit it

in person, by ax, mail, or email.

FOR SALE

14 Friday, September 13, 2013 The Minnedosa Tribune

TO PLACE AN ADBY PHONE Call 867-3816

Hours to place, correct or cancel ads:Monday - Friday 9 a.m. - 4 p.m.

Y MAI CLASSIFIED ADVERISINGTe Minnedosa ribune, P.O. Box 930,

Minnedosa, Manitoba R0J 1E0

Y A 2 4- 1 1

BY E-MAIL [email protected]

Te Minnedosa ribune Ltd. reserves the right todelete any words or phrases deemed by Te Minnedosaribune Ltd. to be objectionable, or to reuse to publish anyadvertisement. Te Minnedosa ribune Ltd. shall not beresponsible or any loss or damage to any advertiser or thirdparty resulting rom the ailure o an advertisement to appearin Te Minnedosa ribune Ltd. or rom any error or omission

in any advertisement which is published.

RATES$9.00 or frst 40 wor s, a itiona wor s .10 eac .Repeat ads - Hal Price.

Classifed Display - $9.00/col. inch each insert.

(Incl. logo, box & bolding, and centering).

Happy Snaps: (Birthday, Engagement, Wedding, Birth, &Graduation)- $16.00 or the frst 20 words and the picture.

O ituaries: $6.50 per co . inc .

Reach the entire province (50 weekly newspapers) $189.00Westman and Eastman: $119.00

A A s p us 5% G.S..

DeadlinesClassifed advertisements must be submitted no laterthan noon uesday or insertion in the ollowing Friday sedition. ALL CLASSIFIED ADVERISEMENS MUS BE

PREPAID BEFORE INSERION.

Te Minnedosa ribune is not responsible ortypograp ica errors pu is e AFER t e frst insertion, nor

oes it assume responsi i ity or errors pu is e as a resu t oan a vertisement p ace , c ange , or cance e , y teep one.o ensure your advertisement appears correctly please submit it

in person, y ax, mai , or emai .

FOR RENT

FOR SALE

LAND FOR SALE

WANTED

REAL ESTATE

PETSHAPPY BIRTHDAY

PRODUCE

PAINTER

ANNIVERSARY

FARM

MACHINERY

RECYCLING

Selling something? Letour readers know! Place anad in Te ribune Classifedsstarting at $9.00 plus tax. (tn).

Signature Homestylesnew Fall/Winter line o home

decor and organizational bas-kets is now available to order.Great decorative Halloweenand Christmas items (get yourgit shopping done early!). In-dividual orders available orhave a catalogue party to re-ceive a FREE shopping spree!Contact independent rep-resentative at 204-867-5544,please leave a message. (23-tn)

6-man pop up tent trailerin good condition. Reuphol-stered. Wanting $750.00- $850.00 OBO. Call 204-867-5748, i not home leavemessage on answering ma-chine. (25-3x)

Farm ree range chick-ens and turkeys growing now,eeding oats, wheat and cornplus milk products, roastingtype. Chickens 5lbs and up.urkeys 12lbs and up. Also,Chev S10 Diesel, 1985, lowmiles, restored, new paint andsaety. Phone 204-725-4211.(27-4x)

Watkins. Call Elaine at

1-204-761-2398 (evenings).

1989 Ford L8000 andemGrain ruck, Air brakes, Sae-tied, Diesel, 20 t box, or moreino call 204-638-0998 or 204-868-5040. (26-3x)

Red potatoes, beets, car-rots. Phone Albert or JudyChristopherson at 204-867-2772. (27-2x)

Give away - kittens lovelycolours. Dalrymples 204-867-3317. (27-2)

wo, 2 bedroom apart-ments. Fridge, stove, washer,dryer. Available in October.Phone 204-868-5579 or 204-210-0081. (27-2)

Established 1901 His-toric Bed and Breakast. Fiveguest rooms. urnkey oper-ation. Includes 2 houses onlarge riverside lot in Minne-dosa, Manitoba. $575,000.00

w w w . t i l s o n p l a c e . c o m ,[email protected]. (26-3x)

+LVWRULF7LOVRQ3ODFH%HGDQG%UHDNIDVW

Open House September 14, 2-4 p.m.149-2nd Ave SW, Minnedosa, Manitoba

204-867-2830 [email protected]

)RU6DOH

R.M. o Minto, NE 18-16-17w, 160 acres cultivated.Mail oers to Box 182, Minne-dosa by October 5th 2013.Questions, phone 204-867-7679. Highest oer not neces-sarily accepted. (25-6x)

950 acres or rent in theR.M. o Minto, near the Vil-lage o Clanwilliam. Te landis mostly Crop Insurance soilclassifcation B and C,some D. We are invitingproposals or the 2014 crop

year, and beyond. erms, in-cluding length o agreementand dollar value o rent arenegotiable. Please be advisedthat frst, highest, or any oerare not necessarily accepted.

Any and all oers will be ser-

iously considered until Sep-tember 15th. Please contactGlen Crawley by telephone ortext message at 204-867-7049,or by email at [email protected] Please contactus by the above means, werespectully ask that you notcome to the arm, except byappointment. (24-4x)

LAND FOR RENT

Looking or something?Our readers may have it! Placean ad in Te ribune Classi-feds starting at $9.00 plus tax.(tn)

aluminum brass zinc steel

e-waste

lead catalytic converters

stainless steel batteries

copper

www.urbanmine.ca

204.774.0192

72 Rothwell RoadWinnipeg, MB

(1 block south of IKEA)

The trusted name in

metal recycling

Qualifed Painter with25 years experience. All workguaranteed. Call Blaine at204-874-2399. (43-tn)

John & Olga Wityshyn

September 19, 2013

For 60 years youve travelledthrough lie together building

so many memories withamily and riends. Trougheverything that lie can bringyouve always been there -

encouraging, supporting,believing. Your anniversary

is a time to celebrate allyouve achieved and to tell

you how much youre lovedor being the wonderul

parents you are. Our lives areso much richer because o

you both.

Love your amily.(x)

wo very special peoplecelebrated milestone

birthdays this year. Happy80th!

Mac DavidsonMay 8th

Love rom Marg; John,Rhonda, Mitch, Jenn, Cody,Nic & Brent; James, Shelley,

Chris & Luke

Jim FossumAugust 24th

Love rom Betty; Wayne;Angie, Alan, Michael, &Carlene; Shelley, James,

Chris & Luke(x)

HAPPY BIRTHDAY

Te amily o Marj

Bridgeman invite you or cakeand rereshments to celebrateher 90th birthday on Sunday,September 22nd, 2013 rom 2 4 p.m. at Rivers Leg ion Hall.(26-2x)

7/29/2019 September 13, 2013.pdf

15/20

15Friday, September 13, 2013The Minnedosa Tribune

HELP WANTED

TENDER

COMING EVENTS

Have an upcoming eventyoud like to let everyoneknow about? Get the wordout there with a ComingEvent listing in Te ribune.

Ads starting at $9.00 plus tax.(tn)

UC Bingo at UkrainianHall, uesday nights. Doorsopen at 6:00 p.m. Early bird at7:00 p.m. ollowed by regulargames. License #3359 B1 and3359 BO. (47-tn)

T ERRY FOX RUN

f Ca Rah Work-ing ogether to Outrun Can-cer * walk, wheel, ride: Pickup a pledge orm at the Li-brary, or Modern Looks Hair

Salon * sponsor a participant* volunteer to help with ourcommunity event by call-ing Kathy at 204-867-2932 *attend the barbeque: NoonDonations Sunday, Septem-ber 15th, 2013 MinnedosaConerence Centre 10:00 a.m. 2:00 p.m. Registration 9:00a.m. Sponsored by Minnedo-sa UC (25-3x)

Strathclair Old Iron ClubTreshing Demo will be heldSeptember 21st 22nd, 2013at the feld next to the auctionmart. Binder work will be at11:00 a.m., threshing will be

at 1:00 p.m. Everyone is wel-come. Rain Date is Septem-ber 28th 29th, 2013. (26-3x)

Minnedosa CovenantChurch will be doing a ooddrive or the local ood bankon Friday, September 13throm 6:30 9:00 p.m. Any nonperishable ood items wouldbe appreciated. Tanks inadvance or your generosity.(Please check the best beforedate on your donation). (26-2)

Te Minnedosa LegionLadies Auxiliary will be host-ing an Appreciation ea atthe Legion Clubrooms on

Wednesday, September 18th,2013 rom 2 4:00 p.m. Every-one welcome. (26-2)

All welcome - GospelServices. Shared simply, sin-cerely, and without obliga-tion. Sundays at 3:30 p.m. at50+ Activity Centre. For moreinormation contact 204-867-3435. (27-3x)

Fall Supper at BethanyCommunity Centre, Sunday,September 29th, 4:30-6:30p.m. Prices: Adults $12.00,Children 6-12 $6.00, Pre-schoolers FREE. (27-3)

Minnedosa Service toSeniors Congregate MealProgram serving suppermeals or seniors at theownview Manor 6thoor uesdays, Tursdays,Sundays starting at 5:00p.m. $8.00 dine in, $10.00delivered. Call 204-867-2198 ater 1:00 p.m. on dayo the meal or call 204-867-5190 or all other inquiries.

Service to Seniors

Menu:

Spmb 15h:

Roast chicken withgravy and dressing, rolls,

potatoes, vegetable, salad,pickles, dessert, tea and

coee

Spmb 17h:Grilled pork chops, rolls,

potatoes, vegetable, salad,pickles, dessert, tea and

coeeSpmb 19h:

Pot roast, rolls, potatoes,vegetable, salad, pickles,

dessert, tea and coee(12-tn)

AMAZING RACE 4KIDZ -5 Continents - 1Day, Grades K-6, SAURDAY, SEPEMBER 21S,9 a.m.-3 p.m. at the Minne-dosa Covenant Church(204 867 2810) Lunch isprovided! Tere will begames, stories, crats andsnacks. See you at the start-ing line! (27-2)

Foot Care Clinic: Wed-nesdays, beginning October2nd, 2013. ownview Manor.Certifed Foot Care Nurse. obook your appointment callLinda Nylen 204-867-2910.(27-2)

Come and help

Minnedosa 50+ Centre cel-ebrate 5 years in their newacility on Saturday Septem-ber 21st, 2:00 - 4:00 p.m. Doorprizes, Displays o Activities,Entertainment, Cake and IceCream. Everyone Welcome.(27-2)

Sandy Lake ShevchenkoDance Ensemble is startingtheir new season in Septem-ber. Anyone 4 yrs and up in-terested in dancing. Pleasecontact Darcy 204-585-2652to register or or more ino.

Te Riding MountainBiosphere Reserve is hostingthe 2013 At the Farm GateFall Harvest Market SaturdaySeptember 21st, 2013 at theRec Centre in Onanole rom10 a.m. 3 p.m. Come and en-

joy the wide variety and qual-ity o local arts, produce andproducts. Tis classic armersmarket oers tastes and goods

youll fnd nowhere else! Formore inormation or to booka table call Valerie at 204-848-0556 or email [email protected] .(27-2)

Pork-on-a-bun Supper

Friday, September 27th, 2013;4:30 - 6:30 p.m. Cost $10.00,Children under 12 $5.00. Heldat Minnedosa 50+ ActivityCentre, 31 Main Street South.Sponsored by Minnedosa Mu-seum & Heritage Village andMinnedosa 50+ Activity Cen-tre. (27-2)

Te Minnedosa UnitedChurch Sunday School Learn-ing groups (pre-school, schoolage and youth) will begin theall season on September 15that 11:00 a.m. I you would liketo help your children exploretheir aith, we would love tohave them join us! Everyone

welcome. (27-2)

Kids Jam is back atMinnedosa Calvary Church!Starting September 25th every

Wednesday rom 3:30 5:00p.m. Ages 4 to 10. Any ques-tions please contact RobynDragan at 204-210-0093. (27-2x)

50-50 Bingo: Minnedosa

Legion #138 on Saturday Sep-tember 21st, 1:00 4:00 p.m.License #1269. Join us or an

Appreciation BBQ on Friday,September 20th, 11:00 a.m. 2:00 p.m. Cribbage starts onuesday, September 17th at2:00 p.m. (27-2)

LESSONS

%HQV0XVLF/HVVRQV

Teaching guitar, bass,

drums, vocals,

recording lessons and

song writing.

Lessons for all ages

from student to adult.

For more information

Please call

Ben at 867-5461or 841-0970

Multi amily yard sale onSaturday, September 14th, 9a.m. 1 p.m. at 6th Ave NEbeside the Dari Isle.

Moving Sale - Soa andchair; arborite table and 6chairs; hand, yard and gardentools and equipment; enter-tainment centre; toys; books;

wool and crat supplies.Tree miles east o Bethany.wo day sale: Saturday, Sep-tember 21st rom 10 a.m. to 2p.m. and Sunday, September22nd rom 12 noon to 2 p.m.(27-2x)

Huge multi householdindoor garage sale on Friday,September 20th rom 5 p.m.until dark, Saturday, Septem-ber 21st and Sunday, Septem-ber 22nd rom 9 a.m. 4 p.m.Tree kms south o Minnedo-

sa on Hwy # 10 at Bay Al-paa Rah. Baby and chil-drens items, horse, poultry,pet, and cattle supplies, gar-dening, sports, tools (shovelsand orks), ence, aq,Halloween costumes, kids

VCR movies, books, businessand household items. (27-2)

YARD SALES

Farmland or lease bysealed tender . Approxi-mately 195 cultivated acres inthe ollowing land: NW 11-14-17 WPM in the R.M. o Od-anah, NE 11-14-17 WPM inthe R.M. o Odanah. Inter-ested persons are invited tosubmit sealed tenders or thelease o the above mentionedacres or a Tree (3) yearterm, indicating an annualrate per acre (and the intend-ed use o the property). en-der closing date is October18, 2013 at noon. Please sendsealed envelopes markedLand Lease to EvergreenEnvironmental echnologiesBox 947 Minnedosa, MB, R0J1E0. For more inormationregarding land and leasecontact: David MacDonaldat Evergreen Environmentalechnologies 204-868-6104or 204-867-7161. Highest orany tender not necessarilyaccepted. (27-2x)

WORK WANTED

Sharons Home CleaningNo job too big or small. Rate:$15.00 per hour. 204-867-3659 pr 204-868-6072 (cell).

Will do housecleaning,exible days and hours. Ihave many years experienceand have good reerences.Reasonable rates. Call 204-867-5925. Please leave a mes-sage. (27-2x)

Permanent ull timework: Looking or employeethats main job would be run-ning septic truck but will alsorequire running loader, tele-handler, and other generallaborer or local construc-tion company. Please or-

ward resumes to [email protected] or ax to204-848-2977. elephone #204-848-0358 (24-tn)

HELP WANTED

WEST REGION CHILD & FAMILY

SERVICES INC.

invites applications for a

URBAN SERVICES CFS WORKER(1 YEAR TERM)WINNIPEG, MB

WRCFS is a mandated First Nations Child and Family Services Agency responsible toprovide a ull range o services, including statutory servi ces, voluntary services andprevention services to the children and amilies o its nine First Nations, residingon and of reserve. The purpose o the programs o WRCFS is to sustain, support,and enhance amily and community lie. The agencys mission is to work with ourFirst Nations people to protect Aboriginal children, in keeping with our core values.

Reporting to the Urban Services CFS Supervisor, the worker will be responsibleto work as part o a team in delivering a ull range o child and amily serviceswith emphasis on prevention and resource services as a rontline approach. Dutieswill include; the provision o a ull range o statutory child welare services thatinvolves child protection; court work; case management; intake; on-call;

advocacy; special needs, age o majority and the application o the StructuredDecision Making Assessment tools when working wi th amilies.

Qualifcations: BSW degree with two (2) years o child welare experience, preerably

in First Nations child and amily services. An equivalent combination otraining and experience may be considered.

Must have working knowledge o the CFS Act and a commitment to FirstNations child and amily services, community based planning and servicedelivery.

Knowledge o and appreciation or Ojibway culture and aspirations areessential.

The ability to speak Ojibway will be considered a denite asset. Demonstrated ability to communicate efectively, both orally and in writing Must have demonstrated ability to work as part o a team and within a

multi-disciplinary approach. Must have good organizational skills Must be able to respond to completing deadlines in a ast paced work

environment Must have computer training and/or knowledge o Microsot Oce

Have amiliarity with the Structured Decision Making Assessment tools,Intake & CFSIS.

Salary: Commensurate with experience and training andaccording to Provincial pay scale.

WRCFS ofers a supportive, progressive and innovative work environment,competitive salaries, a great benets package, and training opportunities. Thesuccessul applicant must provide WRCFS with a current criminal record checkand child abuse registry check and drivers abstract prior to commencement oemployment. Travel is required. A valid drivers license and access to means otransportation or work is a condition o employment.

Please submit your resumes with a covering letter to:

Verna McIvor, MSW, RSWDirector o Urban Services

West Region Child and Family Services, Inc.255 Sherbrook St.

Winnipeg, MB.R3C 2B8 Fax: (204) 985-4079

DEADLINE FOR APPLICATIONS IS: Tuesday, September 17, 2013

We thank all who apply, however, only those selectedfor an interview will be contacted.

*ODGVWRQH7UDQVIHU/WG

LVFXUUHQWO\WDNLQJDSSOLFDWLRQV

IRUWKHIROORZLQJSRVLWLRQ&ODVV6GULYHUVVXSHU%KRSSHUZRUNWKUX

3UDLULH3URYLQFHV'HGLFDWHGURXWHVWRVXLWGULYHUV

SUHIHUUHGODQHRIWUDIF

6XFFHVVIXOFDQGLGDWHVPXVWSRVVHVVWKHZLOOLQJQHVVWR

ZRUNLQDWHDPHQYLURQPHQWDQGZRUNZLWKODWHPRGHO

VDIHHTXLSPHQW

&KHFNXVRXWDWZZZJODGVWRQHWUDQVIHUFRPRUSKRQH

RUID[

.LWFKHQ/LQH&RRN

3OHDVHVHQG\RXUUHVXPHWR

&KHI.\OH$QGUHDVHQ

YLDHPDLORUID[

N\OH#HONKRUQUHVRUWPEFD

) XO O WL PHSRVLW LRQ

*UHDWEHQHWVSDFNDJH

([SHULHQFH DQDVVHW

0XVWKDYHRZQYHKLFOH

6WDIIDFFRPRGDWLRQ

DYDLODEOH

7/29/2019 September 13, 2013.pdf

16/20

16 Friday, September 13, 2013 The Minnedosa Tribune

HELP WANTED

7UDQVSRUW/7'6WUDWKFODLU0%

+(/3:$17('

5(7,5('+($9

7/29/2019 September 13, 2013.pdf

17/20

MCNA PROVINCE WIDE CLASSIFIEDS

17The Minnedosa Tribune Friday, September 13, 2013

OBITUARIES

Douglas, Duncan ScottNovember ,

July , .

Scott passed away peaceullyat home ater a very short andcourageously ought battle

with cancer, his wie Debbie,parents Harvey and Joyce, andriend Eric Abel at his side.Many o his amily, riends as

well as people he worked withhad the opportunity to visit Scott,

including some who travelledrom as ar as Honduras.Scott was born in Minnedosa District

Hospital as Duncan Scott Douglas. Early in lie he chose to usehis second name. He moved with amily to the communities oBrandon, Te Pas, Winnipeg, and the Sherris amily arm PrairiePride in 1974.

Scott attended school in Te Pas and Winnipeg, graduating romElton Collegiate in Forrest MB. He was a member o the CordovaCommunity 4-H Club, where he was introduced to the DaleCarnegie Leadership Course, perormed well in public speakingand was presented with a Citizenship Award rom the Governmento Canada in Ottawa.

Scott began his career in mining in Yellowknie, NW in the1980s. His career took him to mines in places like Echo Bay, andColomac, NW, Tunder Bay, Point du Bois, Guyana, S.A., MyraFalls, BC, Honduras, C.A. and Chile, S.A.

Scott took great pride in all various aspects o his work andvolunteering, including his time as a Fire Fighter in Yellowknie,Emergency First Responder at many o the mines he workedat, and his time as an ambulance driver and frst responder inMinnedosa.

Scott leaves to mourn his passing, his loving wie Debbie, parentsHarvey and Joyce, brothers Ian (Barb) Jocelyn, Sheri, and greatniece Isabella; James (Amber) Jasmine and Sherris; in-laws Val andIan Hanson, brothers-in-law Jerey (Kim) and Daryle (Cheryl),

step daughters Ashley (Mitch), Brandi and Carley and the joys ohis lie, grandchildren Madison, Payton and Rhett, as well as manynieces, nephews and cousins. He is also remembered by AuntIrene (Allan) Peden and Uncle Jack (Carole) Douglas.

Scotts amily wishes to thank all the Health Care Providers thatassisted Scott through this di cult journey, with special thanks toPalliative Care Nurses.

Scotts wish, in lieu o owers, a donation be made to CampbellRiver Hospital Foundation Palliative Care Unit; B.C. Cancer

Agency or Healing Hands Ministry at Campbell River UnitedChurch, 415 Pinecrest St., Campbell River, BC.

Te Celebration o Scotts lie will be held in Minnedosa UnitedChurch on September 21, 2013 at 1:30 p.m.

Amy Margaret LumsdenAugust ,

September ,

Our amily is saddened with thepassing o our dear mom, Amy.Her long journey has ended hereon earth and now she is in Godshands and at peace.

Amy was the daughter o Maryand Mervyn Evans o Minnedosa,

MB, and grew up on the Evansamily arm in the Cameron District.

In 1936 Amy married Max Lumsden,arming or 19 years until moving

to Brandon, MB. Amy graduated as a LicensedPractical Nurse in 1968, nursing in Brandon until her retirement in1981. Retirement brought Amy and Max to Lethbridge, AB in 1982

where Amy remained until Maxs death in 2005 when she relocatedto Sparwood, BC. In 2008 Amy became a resident o the RockyMountain Village in Fernie, BC where she resided until her death.

Amy leaves to mourn her sons Keith (Linda), Bill (Barb), andRob (Heather) and her daughter Sheila (John) Heide. Mom wasblessed with 10 grandchildren and 8 great-grandchildren. She waspredeceased by her inant son John born in 1938, her husband in2005, and her daughter Mary in 2011.

Internment will take place in the amily plot at the MinnedosaCemetery.

Special thanks to the sta o Lilac errace and Rocky MountainVillage or the years o good care and riendship to Amy.

Messages o condolence may be made to the amily at www.cherishedmemoriess.com Arrangements entrusted to CherishedMemories Funeral Services Ltd.

AUTOMOTIVE

Guaranteed approval driveaway today! We lend moneyto everyone. Fast approvals,best interest rates. Over 500

vehicles sale priced or im-mediate delivery OAC. 1-877-796-0514. www.yourapprove-donline.com.

BUSINESS OPPORTUNITY

GE FREE VENDING MA-CHINES - 100% Lease Financ-ing - All Cash Income - 100%ax Deductible Become Fi-nancially Independent - AllCanadian Company. FullDetails CALL NOW 1-866-668-6629 Website WWW.

CVEND.COM

Grow Marijuana Commer-cially. Canadian CommercialProduction Licensing Con-

vention October 26th & 27th.oronto Airport, Marriot Ho-tel. www.greenlineacademy.com. ickets 1-855-860-8611or 250-870-1882.

Te Disability ax Credit Al-lows or: $1,500 Yearly axCredit $15,000 Lump sum Re-

und Covers: -Hip/Knee Re-placements, -Arthritic knees,hips, hands, or shoulders-COPD, other Disabling Con-ditions. For Help Applying204-453-5372

FOR SALE

BAERIES FOR EVERY-HING Automotive, arm,construction, AV, marine,cycle, gol carts, solar. Phones,tools, radios, computers, etc.Reconditioned, obsolete, andhard-to-fnd batteries. SOLARpanels, inverters, and acces-sories. Te Battery Man Wpg.

1-877-775-8271 www.battery-man.ca

Restless Leg Syndrome & LegCramps? Fast Relie In OneHour. Sleep At Night. ProvenFor Over 32 Years. www.all-calm.com Mon-Fri 8-4 ES1-800-765-8660

11th ANNIVERSARY SALE!

September 13 30. Best Sav-ings o the Year Event! 10%OFF all purchases exceeding

$500 pre-tax. Special Fea-tures: Queen Pillow op Set$395; 12 Drawer Queen Stor-age Bed $499; 5 Piece Solid

Wood able Set $489; 3 PieceLeather Set (black or brown)$1395; 7 Piece Solid Wood84 able Set, sel-storing lea,$1095. Many, many other spe-cials! Store Hours 10 - 8 pmMon Fri, Sat 10 - 6, Sun 12 5.KDL Furniture - 660 Highland

Avenue (south side o No. 1Highway), Brandon, MB Call:204-571-1971.

MOBILE HOMES

New Mobile Home lot devel-opment in Rapid City, MB.Custom order your new SRI16 or 20 x76 mobile homenow or all. Glendale MobileHome Sales 204-724-7907

NOTICES

Jesus ROSE the frst day o theweek; we may RES the frst

day o the week. For more in-ormation www.clda.ca

SERVICES

Notre Dame Used Oil Prov-ince Wide Collection, usedoil over 500 L, used oil fl-ters, containers, antireeze,batteries. Ecocentres, Rms,Businesses, Farms. Phone1-204-248-2110, www.notre-dameusedoil.com

STEEL BUILDINGS

SEEL BUILDING SIZZLINGSUMMER SAVINGS EVEN!20X22 $4,188. 25X24 $4,598.30X36 $6,876. 32X44$8,700.40X52 $12,990. 47X70 $17,100.One end wall included. Pio-

neer Steel 1-800-668-5422.www.pioneersteel.ca

SEEL BUILDINGS/MEALBUILDINGS 60% OFF! 20x28,30x40, 40x62, 45x90, 50x120,60x150, 80x100 sell or bal-ance owed! Call 1-800-457-2206 www.crownsteelbuild-ings.ca

Weve Spotted...

The fastest way to hunt for bargains!

88% o Minnedosa adults read any o the

last 4 issues o The Minnedosa Tribune.

That makes The Minnedosa Tribune

Classifeds the best place to hunt or

bargains.

Make your great deals easier to spot!

To advertise E-mail: [email protected] drop in and see us at

14 - 3rd Avenue S.W. Minnedosa, MB

STAMPSRubber or

Self-inkingCall

The MinnedosaTribune

867-3816

DONT FORGET!Advertising deadline is

TUESDAYS AT NOON

Call

204-867-3816

or email ads toadsales@

minnedosatribune.com

7/29/2019 September 13, 2013.pdf

18/20

M & MAUTO BODY

All Auto Body Repairs

Ph: 867-20835 Main St.North

Friday, September 13, 2013 The Minnedosa Tribune

ACCOUNTING

Income Tax Filing Farm and Business Accounting Payrolls Government form filing

Phone 867-5550Fax 867-5808

116 Main St. S.

Minnedosa, MB R0J 1E0

Tax Ser v i c e& A c co u n t i n g

Parish BackhoeServices

Septic Systems Weeping tiles

Water Sysyems Basements

All types of excavation

Certifed in waste

water management

Call: Ian874-2134 or 867-0383

BIRBIRCHCHCONSTRUCTION

CommercialResidential

GENERAL

CONTRACTORS

LTD.

867-0400

0r

867-7506

PRAIRIE CONCRETEMinnedosa - 867-3853

Ready Mix ConcreteConcrete orms, Rebar, Wire Mesh,

Weeping Tile, Concrete Sealer, Snap Ties

All at Competitive

prices

Specializing in water & sewerinstallation & repair

All types of excavation Basements, Demolition Snow removal Gravel, Topsoil Sales of septic tanks

Tony 867-7582

Kirk 867-0180

Clint Moffat

& Sons Ltd.OFFICE

867-3356

Sand & Gravel Products

Excavating

Water & Sewer

Installations

Site Preparation

Landscaping

Snow Removal

ALLARD

YAKUBCHAK

WIRCHCERTIFIED GENERAL

ACCOUNTANTS

George Allard, C.G.A.*Gateway Street

Onanole, Mb

848-7413

Howard Wirch, C.G.A*

9-515 4th Ave

Shoal Lake, MB

759-2680

Dauphin Office - 15 1st Ave S.W.

Phone: 638-3005

Fax: 638-5817*Denotes Professional Corporation

PROPERTIES FOR SALE

CONSTRUCTION

ELECTRICAL

BURTON

Enterprises Ltd.

Air Conditioning,Heating & Electrical

30 Years

Ex perience!!

Bus : 867-3950

Fax:

867-2340

Refridgeration

70 Main St, S.Minnedosa, MB.

Personal Tax Returns

Farm Returns

Business Returns

Cash Back

Phone: 867-5124

18

EAVESTROUGH

$1'FRQWLQXRXVSUHQLVKHGHDYHVWURXJK

6LGLQJ5RRQJ6RIW)DVFLD&ORVHGFHOO

3RO\XUHWKDQH6SUD\IRDP%ORZLQ$WWLF:DOO

)LEUH,QVXODWLRQ)LUH5HWDUGHQW&RDWLQJ

PFUHDO#OLYHFD

AUTO

B

BA SSWOO D

A SSWOO D

A

A UTO

UTO B

BO DY

O DY

A ND

A ND G

G LA SS

LA SS

WILD LIFE COLLISION EXPERTS

WEST ST., BASSWOOD

PHONE: 874-2270

E-GLASS REPLACEMENT& REPAIRS

Catharine M Gijsbers.Certified General Accountant.Professional Corporation - 213 2NDStreet NEBox 385, Minnedosa MB R0J 1E0

x Personal & Corporate Income Taxx Accounting and payroll servicesx AgExpert Analyst Certified Advisorx V.I.P. InstallerGroup trainerTel: 867-3884 Cell: 867-0190Email: [email protected]

AC

Rick Taylor 867-7551

[email protected]

UG6W1:7KLVEHGURRPKRPHKDVEHHQ

FRPSOHWHO\XSGDWHGIURPWRSWRERWWRP7KHKRPHLVLPPDFXODWHDQGLVDPXVWVHH

&RQWDFWOLVWLQJDJHQWIRUFRPSOHWHIHDWXUHVKHHW

2WWHU5G2WWHU/DNH(QMR\WKLVVTIWFRWWDJHDW2WWHU/DNHDWDQDIIRUGDEOHSULFH

7ZREHGURRPZLWKDSLHFHEDWKWKLVIXOO\IXUQLVKHGFRWWDJHVOHHSVQLQH6FUHHQHGVXQURRPFRYHUHGGHFN

DQGDLUFRQGLWLRQHG

/RW3ODQ%XQJDORZKRPHRQDFUHVULJKWRIISDYHPHQWRQO\PLQXWHVQRUWKRI%UDQGRQ9HU\SULYDWH\DUG+RPHKDVXSGDWHGZLQGRZVGRRUVVLGLQJVKLQJOHVIXUQDFHFHQWUDODLUDQG

QLFHO\QLVKHGEDVHPHQW+DUGZRRGRQPDLQRRU2QPXQLFLSDOZDWHUV\VWHP6PDOOKRUVHEDUQVKHG

VW6W1(0LQQHGRVD7KLVVTIWEXQJDORZKRPHLVORFDWHGLQDJUHDWDUHDDQGIHDWXUHVDIDPLO\URRPRIIWKHNLWFKHQODUJHGLQLQJURRPDQGEDVHPHQWUHFURRP0DLQRRUEDWKZLWKMHWWHGWXEDQGSLHFHEDVHPHQWEDWK)RUFHGDLUJDVIXUQDFHFHQWUDODLUDQGZDWHUVRIWHQHU

'RXEOHGHWDFKHGJDUDJH

WK$YH6:9HU\VROLGVTIWEHGURRPEXQJDORZZLWKDIHQFHG\DUGDQGWRZQYLHZ8SGDWHGZLQGRZVVLGLQJLQVXODWLRQQHZVKLQJOHVIHQFHDQGQHZODPLQDWHRRULQJ/RFDWHGRQDTXLHWVWUHHWFORVHWRVFKRRODQGGRZQWRZQ

/LYLQJLQ\RXU

&RPPXQLW\

VW$YH1:*UHDWVWDUWHUKRPHQHDUVFKRRO6KLQJOHVVLGLQJDQGDOOZLQGRZVXSGDWHGVLQFH0DLQRRU

EHGURRPDQGEHGURRPVXSSHURRU/DUJHEULJKWNLWFKHQDQGODUJHOLYLQJ

URRPZLWKKDUGZRRGRRU%LJIHQFHG\DUG

6WUDWKFODLU6SDFLRXVEHGURRPKRPHRQODUJHORWLQ6WUDWKFODLU/DUJHHQWUDQFHOHDGVWRWKH

VSUDZOLQJHDWLQNLWFKHQZLWKDQDEXQGDQFHRIRDNFDELQHWV7KHGLQLQJURRPDQGVXQNHQOLYLQJURRPDUHYHU\QLFHZLWKORYHO\ZRRGZRUNDQGKDUGZRRGRRULQJ7KHQLVKHG

EDVHPHQWKDVDVHFRQGNLWFKHQDQGFRXOGVHUYHDVDPRWKHULQODZVXLWH7KLVKRPHLVLQH[FHOOHQWFRQGLWLRQDQGKDVEHHQ

QLFHO\XSGDWHGWKURXJKRXW

'0LQQHGRVD%HDFK7KLVFR]\FRWWDJHDW0LQQHGRVD/DNHLVDUHDOFKDUPHU.LWFKHQVXQNHQOLYLQJURRPEHGURRPVDQGDSLHFHEDWKURRPDOODGGWRWKHOLYHDELOLW\7KHGHFNRYHUORRNVDVPDOO\DUGZLWKDUHSLW6XPPHUVDWWKHODNHFDQEH

DIIRUGDEOH

50RI0LQWR)DUP9HU\VFHQLFIDUPZLWK/LWWOH

6DVNDWFKHZDQ5LYHUUXQQLQJWKURXJK([FHOOHQWFDWWOHIDFLOLWLHVKHDWHGVKRSTXRQVHWDQGVTIWEHGURRPKRPH7KLVLVDEHDXWLIXOIDUPLQDJUHDWORFDWLRQRQO\PLOHV

RIISDYHPHQW

Gwen UsickAlternate Broker

Ph: 867-4657Fax: 867-2150

[email protected]

PRAIRIEMOUNTAINIndependently Owned

and Operated

0LQQHGRVD6WRQHKHULWDJHEGPEDWKKRPHIHDWXUHV

RULJLQDOGHWDLOHGKDUGZRRGXQLTXH[WXUHVLQVXODWHGEDVHPHQWLVVROG

ZLWKWRZQORWV7KHUHLVDVLQJOHJDUDJH

GRXEOHLQVXODWHGJDUDJHZLWKLQRRUKHDWHLQIRUFHGFHLOLQJVKHGVFLUFXODU

GULYHZD\0/6

Take a tour on realtor.ca or our websitewww.remax-prairie mountain-npwa.mb.com

(ULFNVRQ+REE\)DUPRQDFUHV

UHFHQWO\UHQR

VTIWVWRUH\FKDUDFWHU%GP%DWKKRPHUHSODFHVQXPHURXVRXWEXLOGLQJVD

%GPJXHVWKRXVHYHJHWDEOHJDUGHQDQGPXFKPRUH0/6

50RI2GDQDKVTIWKRPHZLWKPXQLFLSDOZDWHU

EGPEDWKWULSOH

FDUJDUDJHQHZHUZLQGRZV7KHUHDUHIHQFHGSDVWXUHV[VKHGEDUQVKD\ODQGJURRPHGZDONLQJSDWK

YHJHWDEOHIUXLWJDUGHQVDOOORFDWHGRQ

DFUHV0/6

0LQQHGRVD&OHDQEGP

EXQJDORZIHDWXUHVPDLQRRUEDWK

HOHJDQWQDWXUDOZRRGZRUNWULSOHSDQHZLQGRZV5HFHQWUHQRV

LQFOXGHVKLQJOHVEDWKURRPFDUSHWSDLQWLQVXODWHGEDVHPHQW

0/6

0LQQHGRVD&RPSOHWHO\

UHPRGHOOHGWRSWRERWWRPEGP

EDWKIHDWXUHVDOO1(:NLWFKHQDSSOLDQFHV

EDWKURRPVVKLQJOHVVLGLQJZLQGRZV

YLQ\OFDUSHWEDPERRKDUGZRRGLQVXODWLRQSOXPELQJHOHFWULFDOPXFKPRUH0/6

6KRDO/DNH%GP%DWK

EXQJDORZRQFRUQHUORW0RGHUQNLWFKHQ

QXPHURXVUHFHQWXSJUDGHVLQFOXGLQJLQVXODWLRQVLGLQJIDVLDVRIWHDYHVVKLQJOHV[GHFNPXFKPRUH0/6

Ryan Marnock

204-868-5980 or 204-867-5544

RoofngDecks

Fencing

Exterior Finishing

RenovationsRepairs

Jeremy Betteridge1-204-868-02601-204-848-7663

[email protected]

TAGConstructionAll Jobs, Roofing,

PaintingGeneral Repairs and

MaintenanceContact

Terry or Mattat 867-2729or 210-0225240 Main St. N

Box 325Minnedosa, MB

BookThisSpotforonly

$13.74perweek!

Book this spot$5.52/week

Call 204-867 3816

Have a house for sale or rent?Increase your exposure by advertising in The Minnedosa Tribune

and online at discoverminnedosa.com.

$30.00 for three consecutive weeks in The Tribune and three

months on the community website.Maximum 25 words.

Add a photo with your Tribune ad for

only $5.00 more!

To purchase your newspaper/online real

estate ad visit discoverminnedosa.com

or call Sandra or Val at Minnedosa CDC

867-3885

7/29/2019 September 13, 2013.pdf

19/20

Book

ThisSpotforonly$13.74per

week!

PRINTING

More than just a

Newspaper!

We offer a full line of

Custom Printing.

Posters, Brochures, Invoices,

Envelopes, Business Cards,

Letterhead, Tickets, Invitations

and MORE! We also provide

Colour Photocopying, Photo

Reproductions and Faxing.

Visit us at:

14 3rd Avenue S.W.

Minnedosa, MB

Monday - Friday

9 a.m. to 12 noon &

1 p.m. to 4 p.m.

Phone 867-3816

LEGAL

Alexander

Jackson

Law Office

B-116 Main St S

Minnedosa, MB

867-39

81ht

t

p

:

//www.

aja

x

l

aw.ca

SIMS & COMPANYLaw Ofce

Norman H. Sims, Q.C.

76 Main Street South

MIN

september 13, 2013.pdf

Documents