regulatory phosphorylation of bacterial-type pep ......2017/03/31 · 35 r.t.m., and w.c.p.), as...
TRANSCRIPT
![Page 1: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/1.jpg)
1
1
Short title: RcCDPK1 phosphorylates bacterial-type PEPC 1
2
Corresponding author: William Plaxton, Department of Biology, Queen’s University, 3
Kingston, Ontario, Canada K7L 3N6. 4
Phone: 01-613-533-6150; FAX: 01-613-533-6617; E-mail: [email protected] 5
6
Article title: 7
Regulatory Phosphorylation of Bacterial-type PEP Carboxylase by the Ricinus 8
kinase CDPK1 9
Author names and affiliations: 10
Sheng Ying*, Allyson T. Hill, Michal Pyc, Erin M. Anderson, Wayne A. Snedden, 11
Robert T. Mullen, Yi-Min She, and William C. Plaxton 12
Department of Biology, Queen’s University, Kingston, Ontario, Canada K7L 3N6 (S.Y., 13
A.T.H., W.A.S., W.C.P.); Department of Molecular and Cellular Biology, University of 14
Guelph, Guelph, Ontario, Canada N1G 2W1 (M.P., A.M.A., R.T.M.); Centre for Vaccine 15
Evaluation, Biologics and Genetic Therapies Directorate, Health Canada, 251 Sir Frederick 16
Banting Driveway, Tunney's Pasture, Ottawa, Ontario, Canada K1A 0K9 (Y-M. S.); 17
Department of Biomedical and Molecular Sciences, Queen’s University, Kingston, Ontario, 18
Canada K7L 3N6 (W.C.P.) 19
20
Summary: 21
RcCDPK1 catalyzes in vivo inhibitory phosphorylation of the bacterial-type PEP 22
carboxylase subunits of the novel heteromeric Class-2 PEPC complex of developing castor 23
beans. 24
25
26
Plant Physiology Preview. Published on March 31, 2017, as DOI:10.1104/pp.17.00288
Copyright 2017 by the American Society of Plant Biologists
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 2: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/2.jpg)
2
2
Author contributions: 27
S.Y., W.A.S., R.T.M., and W.C.P. designed and supervised this study. S.Y., A.T.H., M.P., 28
E.M.A., and Y-M.S. performed the experiments. S.Y., W.A.S., R.T.M., Y-M.S., and W.C.P. 29
prepared the article. All authors read, contributed, and approved the article. 30
31
Funding information: 32
This research was supported by Natural Sciences and Engineering Research Council of 33
Canada (NSERC) Discovery, and Research Tool and Infrastructure grants (to W.A.S., 34
R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 35
W.C.P. and R.T.M). 36
37
1Present address: 38
Division of Plant Biology, The Samuel Robert Noble Foundation, Ardmore, Oklahoma, USA 39
73401 40
41
Corresponding author email: 42
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 3: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/3.jpg)
3
3
ABSTRACT 44
Phosphoenolpyruvate carboxylase (PEPC) is a tightly controlled cytosolic enzyme situated 45
at a crucial branch point of central plant metabolism. In developing castor oil seeds (COS) 46
(Ricinus communis) a novel, allosterically-desensitized 910-kD Class-2 PEPC hetero-47
octameric complex arises from a tight interaction between 107-kD plant-type PEPC and 48
118-kD bacterial-type (BTPC) subunits. The native Ca2+-dependent protein kinase (CDPK) 49
responsible for in vivo inhibitory phosphorylation of Class-2 PEPC’s BTPC subunit’s at Ser-50
451 was highly purified from COS and identified as RcCDPK1 (XP_002526815) by mass 51
spectrometry. Heterologously expressed RcCDPK1 catalyzed Ca2+-dependent, inhibitory 52
phosphorylation of BTPC at Ser-451 while exhibiting a: (i) pair of Ca2+ binding sites with 53
identical dissociation constants of 5.03 µM, (ii) Ca2+-dependent electrophoretic mobility 54
shift , and (iii) marked Ca2+-independent hydrophobicity. Pull-down experiments 55
established the Ca2+-dependent interaction of GST-RcCDPK1 with BTPC. RcCDPK1-56
Cherry localized to the cytosol and nucleus of tobacco BY-2 cells, but co-localized with 57
mitochondrial-surface associated BTPC-enhanced yellow fluorescent protein when both 58
fusion proteins were co-expressed. Deletion analyses demonstrated that although its N-59
terminal variable domain plays an essential role in optimizing Ca2+-dependent RcCDPK1 60
autophosphorylation and BTPC transphosphorylation activity, it is not critical for in vitro or 61
in vivo target recognition. Arabidopsis thaliana CPK4 (AtCPK4) and soybean CDPKβ are 62
RcCDPK1 orthologs that effectively phosphorylated castor BTPC at Ser-451. Overall, the 63
results highlight a potential link between cytosolic Ca2+ signaling and the post-translational 64
control of respiratory CO2 refixation and anaplerotic photosynthate partitioning in support of 65
storage oil and protein biosynthesis in developing COS. 66
67
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 4: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/4.jpg)
4
4
INTRODUCTION 68
Calcium plays a central role in eukaryotic signal transduction with various Ca2+-sensor 69
proteins being critical transducers of Ca2+-signatures elicited in response to external stimuli 70
or developmental cues. The activation of protein phosphorylation cascades is often the first 71
and most important signalling event triggered by Ca2+ signals (DeFalco et al., 2010). 72
Among Ca2+ sensors, including calmodulin (CaM) and CaM-like proteins (CMLs), Ca2+-73
dependent protein kinases (CDPKs) are unique because they function as catalytic 74
responders that directly transduce Ca2+ signals into protein phosphorylation events that 75
modulate physiological responses (Harper et al., 2004; DeFalco et al., 2010; Boudsocq and 76
Sheen, 2013; Schulz et al., 2013; Simeunovic et al., 2016). This combination of signalling 77
properties likely arose following the early fusion of a protein kinase gene with a CaM gene, 78
and was followed by CDPK diversification into a relatively large multigene family in vascular 79
plants, thus providing a mechanism to decode different Ca2+ signals in a temporal and 80
spatially-specific manner (Harper et al., 2004). Different CDPK isozymes exhibit distinctive 81
tissue and subcellular locations, substrate specificities, and Ca2+ sensitivities. Thus, diverse 82
developmental programs and stress responses are likely controlled by specific CDPKs 83
including hormone-regulated developmental processes, seed development, pollen tube 84
formation, and abiotic and biotic stress signaling (Harper et al., 2004; Boudsocq and 85
Sheen, 2013; Schulz et al., 2013; Simeunovic et al., 2016). Downstream targets of CDPK 86
action include other protein kinases, transcription factors, ion channels and pumps, 87
cytoskeletal proteins, as well as metabolic enzymes such as sucrose synthase, sucrose 88
phosphate synthase, nitrate reductase, and NADPH oxidase (Bachmann et al., 1996; 89
Douglas et al., 1998; Zhang et al., 1999; Kobayashi et al., 2007; Asai et al., 2013; 90
Simeunovic et al., 2016; Almadanim et al., 2017). While no CDPK appears to be an integral 91
membrane protein, most isoforms contain a myristoylation motif at their N-terminus, which 92
for several CDPKs has been shown to be important for their membrane association (Martin 93
and Busconi, 2000; Ito et al., 2010; Asai et al., 2013). However, a major gap in our 94
understanding of plant Ca2+ signaling and CDPK biology in general is that relatively few in 95
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 5: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/5.jpg)
5
5
vivo CDPK targets have been identified to date (Liese and Romeis, 2013; Schulz et al., 96
2013; Simeunovic et al., 2016). It is evident that some CDPKs, when purified as 97
recombinant enzymes, promiscuously phosphorylate exogenous proteins in vitro at many 98
different Ser and Thr residues, far beyond proposed CDPK phosphorylation motifs (Harper 99
et al., 2004; Boudsocq and Sheen, 2013; Schulz et al., 2013). 100
The aim of the current study was to identify and characterize the putative CDPK that 101
catalyzes in vivo inhibitory phosphorylation of bacterial-type phosphoenolpyruvate (PEP) 102
carboxylase (BTPC) at Ser-451 in developing castor oil seeds (COS) (Dalziel et al., 2012; 103
Hill et al., 2014). PEP carboxylase (PEPC; EC 4.1.1.31) is a tightly regulated enzyme that 104
has been intensively studied owing to its pivotal role in assimilating atmospheric CO2 105
during C4 and Crassulacean acid metabolism (CAM) photosynthesis. Much attention has 106
also been devoted to PEPC’s essential non-photosynthetic functions, particularly the 107
anaplerotic replenishment of tricarboxylic acid cycle intermediates withdrawn during 108
biosynthesis and nitrogen assimilation (O’Leary et al., 2011b). To fulfill its diverse roles and 109
complex regulation, plant PEPC belongs to a small multi-gene family encoding several 110
plant-type PEPCs (PTPCs), along with a distantly-related BTPC (O’Leary et al., 2011b). 111
PTPC genes encode closely related 100-110-kD polypeptides containing conserved seryl-112
phosphorylation (activatory) and lysyl-monoubiquitination (inhibitory) sites and that typically 113
oligomerize as tetrameric Class-1 PEPCs (Supplemental Fig. S1) (Tripodi et al., 2005; 114
Uhrig et al., 2008b; O’Leary et al., 2011b; Ruiz-Ballesta et al., 2014, 2016). By contrast, 115
plant BTPC genes encode distantly related 116-118-kD polypeptides that are more similar 116
to prokaryotic PEPCs. Purification of native PEPCs from unicellular green algae and then 117
developing castor oil seeds (COS) led to the discovery of unusual high-Mr Class-2 PEPC 118
heteromeric complexes composed of tightly associated PTPC and BTPC subunits, and that 119
are largely desensitized to allosteric effectors relative to Class-1 PEPCs (Supplemental Fig. 120
S1) (Rivoal et al., 2001; Blonde and Plaxton, 2003; Gennidakis et al., 2007; Uhrig et al., 121
2008a; O’Leary et al., 2009). Plant BTPC polypeptides and thus Class-2 PEPC complexes 122
have only been documented in biosynthetically active tissues (i.e., developing seeds and 123
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 6: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/6.jpg)
6
6
pollen, immature leaves), as opposed to PTPCs that are constitutively expressed in the 124
cytosol as housekeeping Class-1 PEPCs (Igawa et al., 2010; O’Leary et al., 2011a, 2011b). 125
Although COS Class-1 PEPC localizes diffusely throughout the cytosol, the Class-2 PEPC 126
associates with the outer mitochondrial envelope, an interaction mediated by its BTPC 127
subunits (Park et al., 2012). Class-2 PEPC’s unique kinetic and regulatory properties, and 128
dynamic subcellular targeting to the mitochondrial surface support the hypothesis that it 129
facilitates rapid refixation of respiratory CO2 while sustaining a large anaplerotic flux to 130
replenish tricarboxylic acid cycle C-skeletons withdrawn in support of storage oil and 131
protein biosynthesis in developing COS. 132
Although BTPCs lack the N-terminal seryl phosphorylation motif characteristic of non-133
photosynthetic and C4/CAM photosynthetic PTPCs, BTPC is in vivo phosphorylated at 134
multiple sites during COS development (Uhrig et al., 2008a; O’Leary et al., 2011c; Dalziel 135
et al., 2012). This includes inhibitory phosphorylation at Ser-425 and Ser-451, which both 136
occur within a distinctive ~10-kD intrinsically disordered region not found in PTPCs (Dalziel 137
et al., 2012; O’Leary et al., 2011c). Despite the apparent important role of multisite BTPC 138
phosphorylation in the post-translational control of photosynthate partitioning and 139
anaplerotic C-flux at the PEP branchpoint during COS development, nothing was known 140
about the responsible protein kinases or related signaling pathways. Thus, Hill and 141
coworkers (2014) purified the native BTPC Ser-451 kinase from developing COS by over 142
500-fold and provided kinetic evidence that it belongs to the castor CDPK family. The 143
current study used mass spectrometry (MS) to identify the BTPC Ser-451 kinase as 144
RcCDPK1, one of twenty predicted castor CDPK isozymes (Hill et al., 2014). We also 145
demonstrate the specificity of RcCDPK1 for phosphorylating BTPC at Ser-451, as well as 146
its in vivo interaction with BTPC on the surface of mitochondria. 147
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 7: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/7.jpg)
7
7
RESULTS AND DISCUSSION 148
Identification of Castor Bean BTPC Serine-451 Kinase as RcCDPK1 149
Peptides derived from a total tryptic digest of the final BTPC Ser-451 kinase preparation 150
of Hill and coworkers (2014) were sequenced via nanoHPLC tandem MS (LC-MS/MS). 151
Database searches identified numerous proteins (Supplemental Table S1) including a 152
single protein kinase, RcCDPK1 (protein #36 on the list). Reliable identification was 153
achieved by 9 tryptic peptides whose respective sequences precisely matched 154
corresponding regions of RcCDPK1’s predicted sequence (30.2% sequence coverage) 155
(protein accession number: XP_002526815) (Fig. 1). The predicted size of RcCDPK1 is 56-156
kD, a value similar to the native molecular mass of 63-kD estimated for BTPC Ser-451 157
kinase isolated from developing COS (Hill et al., 2014). 158
The deduced RcCDPK1 protein corresponds to a 497 amino-acid polypeptide having 78 159
- 84% sequence identity with the orthologs aligned in Fig. 1; maximal identity (83-84%) was 160
achieved with CPK4 and CPK11 from Arabidopsis thaliana (AtCPK4 and AtCPK11, 161
respectively) and soybean (Glycine max) CDPKβ (GmCDPKβ). RcCDPK1 and its orthologs 162
possess all five modular domains characteristic of CDPKs: an N-terminal variable domain 163
which differs both in sequence and length, a protein kinase catalytic domain, an auto-164
inhibitory junction, a CaM-like domain containing four EF-hand motifs implicated in Ca2+ 165
binding, and a C-terminal variable domain (Fig. 1). RcCDPK1, AtCPK4, and AtCPK11 were 166
determined to be soluble rather than membrane bound (Dammann et al., 2003; Boudsocq 167
et al., 2012; Hill et al., 2014). This is consistent with the absence of a membrane-targeting 168
myristoylation sequence (MGXXXS) at their N-terminus (Fig. 1) that is typical of most 169
CDPKs (Schulz et al., 2013). The closest paralog of RcCDPK1 is RcCDPK2 (70% 170
sequence identity) (Hill et al., 2014), the kinase that in vivo phosphorylates castor sucrose 171
synthase-1 (RcSUS1) at Ser-11 in developing COS (Fedosejevs et al., 2016). 172
As with all known eukaryotic protein kinases, the catalytic kinase domain of plant CDPKs 173
contains a conserved activation loop that begins and ends with Asp-Phe-Gly (DFG) and 174
Ala-Pro-Glu (APE) motifs, respectively (e.g., RcCDPK1 residues 175-201; Fig. 1) (Taylor 175
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 8: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/8.jpg)
8
8
and Kornev, 2011; Liese and Romeis, 2013). Stimulus-dependent phosphorylation of a 176
Thr/Ser residue within this activation loop is a prerequisite for activation of most protein 177
kinases (Taylor and Kornev, 2011). It is notable that phosphorylation-dependent regulation 178
within the kinase activation loop does not occur for CDPKs (Liese and Romeis, 2013), as 179
they instead have had the target Thr/Ser substituted with a phosphomimetic Asp or Glu 180
residue; e.g., Asp in the case of RcCDPK1 (i.e. Asp-190) and its orthologs (Fig. 1). 181
182
RcCDPK1 is Highly Expressed During Castor Bean Development 183
Many CDPK genes are transcriptionally responsive to developmental and stress stimuli 184
(Harper et al., 2004; Schulz et al., 2013). RcCDPK1 is also differentially expressed in 185
castor plants, with maximal transcript levels occurring in male flowers and mature leaves, 186
and the endosperm and cotyledons of developing COS (Fig. 2A). RcCDPK1’s expression 187
profile in COS endosperm matched the pattern of in vivo BTPC phosphorylation at Ser-451 188
with both peaking at the maturation stage (stage IX) of seed development (Fig. 2B) (Dalziel 189
et al., 2012). However, extractable BTPC Ser-451 kinase activity showed a somewhat 190
dissimilar developmental profile as it peaked at stage VII, but was followed by a marked 191
decrease at stage IX (Hill et al., 2014). These results are consistent with the post-192
translational control of RcCDPK1 during COS development. By comparison, BTPC 193
transcript levels maximized during the middle phase of COS development and showed a 194
pronounced drop at stage IX, prior to becoming undetectable in fully mature COS (Fig. 2B). 195
BTPC’s expression profile parallels that previously obtained via semi-quantitative RT-PCR, 196
and correlate well with relative levels of the encoded 118-kD BTPC polypeptides (p118) 197
(Gennidakis et al., 2007; O’Leary et al., 2011a). Thus, maximal BTPC expression during 198
COS development occurs in advance of the subsequent peaks in RcCDPK1 expression, 199
BTPC Ser-451 kinase activity, and in vivo BTPC phosphorylation at Ser-451 (Fig. 2B) 200
(Dalziel et al., 2012; Hill et al., 2014). 201
RcCDPK1 transcript abundance in the endosperm and cotyledon of developing COS 202
was reduced by over 50% within 48 h after photosynthate supply was eliminated by 203
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 9: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/9.jpg)
9
9
excision of intact fruit clusters (i.e., depodding) (Fig. 2A). However, this was not paralleled 204
by a decrease in BTPC Ser-451 kinase activity nor a reduction in BTPC phosphorylation at 205
Ser-451 in the developing endosperm (Dalziel et al., 2012; Hill et al., 2014). This provides 206
further evidence in support of post-transcriptional RcCDPK1 control in developing COS. A 207
similar lack of correlation of AtCPK4 and AtCPK11 transcripts with their respective protein 208
levels and kinase activity was noted following abscisic acid treatment of Arabidopsis (Zhu 209
et al., 2007). 210
211
RcCDPK1 Cloning, Heterologous Expression, and Antibody Production 212
Full-length RcCDPK1 as well as its N-terminal variable domain truncation mutant (i.e., 213
∆N-RcCDPK1, lacking the first 29 amino acid residues) were heterologously expressed as 214
N-terminal His6-tagged fusion proteins in Escherichia coli BL21 and purified to apparent 215
homogeneity by Ni2+-affinity chromatography (Fig. 3A). RcCDPK1 and ∆N-RcCDPK1 both 216
demonstrated Ca2+-binding dependent mobility shifts during SDS-PAGE (Fig. 3A), as 217
described previously for several CDPKs including RcCDPK1 orthologs AtCPK4, AtCPK11, 218
and GmCDPKβ (Harmon et al., 1987; Zhu et al., 2007; Boudsocq et al., 2012). 219
For production of RcCDPK1-specific antibodies (anti-RcCDPK1), a 29 amino acid 220
oligopeptide matching RcCDPK1’s N-terminal variable domain was synthesized with an 221
extra N-terminal Cys residue (Supplemental Fig. S2A) in order to enable its conjugation to 222
keyhole limpet hemocyanin prior to rabbit immunization. The affinity-purified anti-RcCDPK1 223
detection limit was 10 ng of the corresponding peptide on dot blots, with the signal being 224
quenched by the blocking parent peptide (Supplemental Fig. S2B). Immunoblots of His6-225
RcCDPK1 cross-reacted with the anti-RcCDPK1, whereas His6-∆N-RcCDPK1 was not 226
detected, as expected (Fig. 3B). The anti-RcCDPK1 appears to be monospecific as it 227
cross-reacted with a single 56-kD immunoreactive polypeptide that co-migrated with the 228
recombinant, full length RcCDPK1 (after cleavage of its His6-tag) on immunoblots of both a 229
phenyl-Sepharose-enriched developing COS extract, as well as the final BTPC Ser-451 230
kinase preparation of Hill and co-workers (2014) that was analyzed by LC-MS/MS in the 231
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 10: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/10.jpg)
10
10
present study (Fig. 3B). 232
233
RcCDPK1 Catalyzes Ca2+-Dependent, Inhibitory Phosphorylation of Castor BTPC at 234
Serine-451 235
Kinetic studies of heterologously expressed RcCDPK1 were conducted by monitoring Pi 236
incorporation from unlabeled ATP or [γ-32P]-ATP into the p118/ BTPC subunits of 237
recombinant Class-2 PEPC consisting of a 1:1 stoichiometric ratio of castor BTPC 238
(RcPPC4) and an Arabidopsis PTPC isozyme (AtPPC3) (O’Leary et al., 2009). RcCDPK1 239
readily catalyzed Ca2+-dependent Ser-451 phosphorylation of the p118 BTPC subunits of 240
Class-2 PEPC (Fig. 4A, Fig. 5, and Fig. 6A). Furthermore, and as reported for native BTPC 241
Ser-451 kinase (Hill et al., 2014): (i) RcCDPK1 exhibited a relatively narrow substrate 242
specificity, as it phosphorylated BTPC in addition to histone III-S, but was unable to 243
phosphorylate a S451D phosphomimetic BTPC mutant, dephosphorylated COS PTPC or 244
RcSUS1 (Fig. 5), or a pair of synthetic dephosphopeptides containing sequences flanking 245
BTPC’s Ser-451 phosphosite (Supplemental Fig. S3). This not only illustrates the selectivity 246
of RcCDPK1 for phosphorylating BTPC at Ser-451, but also the importance of the 247
structural context of the interaction. Furthermore, all PTPCs and sucrose synthases 248
examined to date share an orthologous phosphorylation motif near their N-terminus; i.e., Ф-249
5-X-4-basic-3-X-2-X-1-Ser-X+1-X+2-X+3-Ф+4 (where Ф is a hydrophobic residue, X is any amino 250
acid, and subscripts denote residue positions relative to the seryl phosphorylation site) 251
(Winter and Huber, 2000; O’Leary et al., 2011b; Fedosejevs et al., 2014, 2016). This differs 252
from the unique and highly conserved BTPC recognition motif identified for RcCDPK1, 253
namely: Ф-4-X-3-Basic-2-X-1-Ser-X+1-X+2-Basic+3-Ф+4 (Dalziel et al., 2012; Hill et al., 2014) 254
(Supplemental Fig. S3). Our combined results therefore demonstrate the importance of not 255
only the linear sequence flanking BTPC’s Ser-451 site, but also the overall conformation of 256
BTPC subunits within the Class-2 PEPC complex. This provides additional evidence that 257
RcCDPK1 is a relatively specific Ser/Thr protein kinase. 258
Phosphorylation of the BTPC subunits of a PTPC-inactive (R644A) Class-2 PEPC 259
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 11: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/11.jpg)
11
11
mutant (O’Leary et al., 2009) by RcCDPK1 inhibited its PEPC activity by 55 ±7% (mean 260
±SEM, n = 3 determinations) when assayed under suboptimal conditions (pH 7.3, 1 mM 261
PEP, 10 mM L-malate). This validates our previous studies of a S451D phosphomimetic 262
BTPC mutant, as well as the purified native BTPC Ser-451 kinase of developing COS 263
(Dalziel et al., 2012; Hill et al., 2014). The current results also corroborate our earlier report 264
(Hill et al., 2014) that BTPC Ser-451 kinase activity is subject to additional post-265
translational controls beyond fluctuations in Ca2+ levels, namely inhibition by PEP; i.e., 266
addition of 1-5 mM PEP potently inhibited BTPC phosphorylation at Ser-451 by RcCDPK1 267
(Fig. 4C). PEP appears to directly affect the kinase as similar levels of BTPC Ser-451 268
kinase inhibition occurred when BTPC or histone III-S served as its substrates (Hill et al., 269
2014). By contrast, the Class-1 PEPC (i.e., PTPC) protein kinase of developing COS was 270
activated about 40% by 1 mM PEP (Murmu and Plaxton, 2007). Reciprocal control of COS 271
RcCDPK1 and PTPC protein kinase by PEP provides an intriguing regulatory mechanism 272
whereby a drop in cytosolic PEP levels would diminish overall anaplerotic PEP 273
carboxylation to oxaloacetate; i.e., by simultaneously enhancing inhibitory phosphorylation 274
of Class-2 PEPC’s BTPC subunits at Ser-451, while attenuating phosphorylation-activation 275
of Class-1 PEPC’s PTPC subunits at Ser-11. Reduced cytosolic PEP levels likely occurs 276
following the elimination of photosynthate import that arises during the final stages of COS 277
development or following depodding when vascular connection with the parent plant has 278
been lost; both processes are accompanied by enhanced in vivo BTPC phosphorylation at 279
Ser-451 and complete PTPC dephosphorylation at Ser-11 (Tripodi et al., 2005; Murmu and 280
Plaxton, 2007; Dalziel et al., 2012). 281
RcCDPK1 also exhibited prominent Ca2+-activated autophosphorylation activity (Fig. 282
6B). In vitro autophosphorylation at multiple sites has been widely reported for plant 283
CDPKs and may influence their activity and substrate accessibility (Liese and Romeis, 284
2013). However, the occurrence and functions of in vivo CDPK phosphorylation remain 285
obscure. Autophosphorylation is important for the regulation and/or subcellular localization 286
of eukaryotic protein kinases (Endicott et al., 2012) including at least one plant CDPK, 287
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 12: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/12.jpg)
12
12
tobacco CDPK2 (NtCDPK2) (Witte et al., 2010). Both constitutively-phosphorylated 288
residues and stress-induced in vivo phosphorylation, catalyzed by either NtCDPK2 itself or 289
by upstream protein kinases, were reported (Witte et al., 2010). Therefore, an important 290
objective will be to establish RcCDPK1’s (auto)phosphorylation sites, and the impact of 291
site-specific phosphorylation on kinase function. 292
RcCDPK1 orthologs AtCPK4 and GmCDPKβ were also expressed as His6-fusion 293
proteins in E. coli, along with a distantly related Arabidopsis CDPK, AtCPK34. Anti-pSer451 294
based kinase assays established that both orthologs, but not AtCPK34, effectively 295
catalyzed Ca2+-dependent phosphorylation of castor BTPC at Ser-451 (Fig. 4A). It is 296
notable that castor BTPC’s Ser-451 phosphorylation site and its adjacent basophilic CDPK 297
recognition motif (Supplemental Fig. S3) are conserved amongst vascular plant BTPC 298
orthologs, including the Arabidopsis BTPC, AtPPC4 (Hill et al., 2014). Thus, future studies 299
need to determine if AtCPK4 and/or AtCPK11 participate in the in vivo regulatory 300
phosphorylation of AtPPC4, particularly in developing pollen where AtCPK4, AtCPK11, and 301
AtPPC4 are all highly expressed (Harper et al., 2004; Igawa et al., 2010). Extracts 302
prepared from flowers of Col-0 plants but not from atcpk11 mutants showed Ca2+-303
dependent kinase activity against castor BTPC at Ser-451 suggesting that AtCPK11 is 304
functionally as well as structurally homologous to RcCDPK1 (Fig. 4B). 305
306
RcCDPK1 Exhibits a Pair of High-affinity Ca2+-binding sites and Strong Intrinsic 307
Hydrophobicity 308
We next assessed the in vitro Ca2+-binding and hydrophobic properties of RcCDPK1 as 309
these vary among CDPKs and can offer insights into their in vivo roles. RcCDPK1’s binding 310
stoichiometry and affinity for Ca2+ in the presence of Mg2+ was evaluated by isothermal 311
titration calorimetry (Fig. 7A). The data best fit a model that predicted two sets of high 312
affinity Ca2+ binding sites with identical Kd values of 5.03 μM. RcCDPK1’s Kd(Ca2+) values 313
are within the physiological range and compare favorably with K0.5(Ca2+) values of 2.7 μM 314
reported for the native BTPC Ser-451 kinase purified from developing COS (Hill et al., 315
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 13: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/13.jpg)
13
13
2014), as well as 3.1 and 4.5 μM determined for RcCDPK1 orthologs AtCPK4 and 316
AtCPK11, respectively (Boudsocq et al., 2012). 317
Calcium-binding to EF-hand containing proteins, including CDPKs, initiates 318
conformational changes in their conserved CaM-related domain that typically results in 319
exposure of hydrophobic clefts believed to be critical to target recognition and interaction 320
(DeFalco et al., 2010). These conformational changes are a hallmark of Ca2+ sensors and 321
have been exploited for their efficient purification via Ca2+-dependent hydrophobic 322
interaction chromatography. Although RcCDPK1 exhibited a Ca2+-dependent 323
electrophoretic mobility shift reminiscent of a classic Ca2+ sensor (Fig. 3A and Fig. 6B), its 324
unusual Ca2+-independent hydrophobicity was demonstrated by 8-anilinonaphthalene-1-325
sulfonic acid-based fluorescence spectroscopy and hydrophobic interaction 326
chromatography using phenyl-Sepharose (Fig. 7B and Supplemental Fig. S4). 8-327
Anilinonaphthalene-1-sulfonic acid exhibits a blue shift and increased fluorescence when it 328
interacts with non-polar surfaces on proteins, whereas Ca2+-dependent binding to phenyl-329
Sepharose has been reported for CaM as well as several, but not all, CDPKs and CMLs. 330
Fluorescence spectroscopy revealed that apo-RcCDPK1 (in contrast to petunia CaM81, a 331
positive control) exhibits considerable hydrophobicity that was unaffected by the addition of 332
up to 1 mM Ca2+ (Fig. 7B). Similarly, the native BTPC Ser-451 kinase from developing COS 333
exhibited tight Ca2+-independent binding to phenyl-Sepharose and could only be eluted 334
from this resin using a buffer containing 10% (v/v) ethylene glycol (i.e., a chaotropic 335
solvent) (Supplemental Fig. S4) or a detergent such as 0.5% (v/v) Triton X-100 (results not 336
shown). Similar results were reported for cytosolic CDPKs that respectively phosphorylate 337
sucrose synthase at Ser-11 in developing COS (Fedosejevs et al., 2016) and nitrate 338
reductase in spinach leaves (Bachmann et al., 1996; Douglas et al., 1998). 339
Calcium-mediated conformational changes in RcCDPK1 were further investigated by 340
probing its secondary structure using far-UV circular dichroism spectroscopy. This 341
indicated that apo-RcCDPK1 was folded in solution, and exhibited a large positive band 342
below 200 nm, with maxima at 191 nm and negative bands with local minima at 209 nm 343
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 14: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/14.jpg)
14
14
and 220 nm, typical of proteins having significant α-helical structure (Fig. 7C). The apo- 344
and Ca2+-bound RcCDPK1 spectra were almost identical, indicating little change in 345
secondary structure composition upon Ca2+ binding. Conformational changes associated 346
with Ca2+ binding to RcCDPK1 may trigger a reorientation of helices, as occurs with CaM 347
(Zhang et al., 1995), rather than pronounced changes in helical content. These data 348
demonstrate that high-affinity Ca2+ binding by RcCDPK1 induces predominately tertiary but 349
not secondary structural changes associated with increased surface hydrophobicity as 350
exhibited by canonical Ca2+ sensors such as CaM (Defalco et al., 2010). 351
The strong intrinsic hydrophobicity, and lack of increased hydrophobicity upon exposure 352
to Ca2+ distinguishes RcCDPK1 from CaM and most CMLs examined to date. This 353
indicates that while Ca2+ is clearly important for regulating RcCDPK1 activity (Fig. 4A and 354
Fig. 6B) (Hill et al., 2014), it may do so through structural changes that lead to relief of 355
autoinhibition rather than exposure of hydrophobic target-interacting regions. Given the 356
relatively large number of CDPK isozymes in a given plant, such unique biochemical 357
features may reflect the diversity needed to ensure specificity of activity, especially 358
whenever multiple CDPKs are co-expressed. 359
360
RcCDPK1 is Targeted to the Cytosol and Nucleus of Tobacco BY-2 Cells, but 361
Relocalizes to the Mitochondrial Surface when Co-expressed with BTPC 362
The subcellular location and potential interaction of fluorescent protein fusions of 363
RcCDPK1 and ∆N-RcCDPK1 with castor BTPC were assessed in tobacco bright yellow-2 364
(BY-2) suspension cells, a well-established model system for protein localization and 365
interaction studies (Brandizzi et al., 2003). Cells were transiently transformed using gene 366
constructs encoding a variety of fluorescent protein-tagged RcCDPK1 and BTPC fusion 367
proteins (Fig. 8A), and imaged by confocal laser-scanning microscopy (CLSM). C-terminal 368
Cherry-tagged versions of RcCDPK1 and ΔN-RcCDPK1, similar to Cherry alone, localized 369
to the cytosol and nucleus of individual, representative transformed BY-2 cells (Fig. 8B to 370
Fig. 8D). Likewise, a RcCDPK1-green fluorescent protein (GFP) fusion, as well as N-371
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 15: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/15.jpg)
15
15
terminal Cherry-tagged versions of RcCDPK1 and ΔN-RcCDPK1, localized to the cytosol 372
and nucleus in BY-2 cells (Supplemental Fig. S5A to Fig. S5C), indicating that the position 373
and/or type of appended fluorescent protein does not influence the subcellular localization 374
of RcCDPK1 or ΔN-RcCDPK1. Notably, the partial nuclear targeting of RcCDPK1 may be 375
due to its putative nuclear localization signal, -P58KRK61- (Milla et al., 2006), which is 376
conserved in the orthologs aligned in Fig. 1, including AtCPK4 whose GFP-tagged fusion 377
protein was also localized to the cytosol and nucleus (of transgenic Arabidopsis plants) 378
(Dammann et al., 2003). 379
We next studied whether subcellular targeting of RcCDPK1-Cherry was altered upon its 380
co-expression with a castor BTPC-enhanced yellow fluorescent protein (EYFP) fusion. The 381
in vivo association of castor BTPC with the surface of mitochondria in developing COS, as 382
well as following its expression as a EYFP-fusion protein in tobacco BY-2 cells, has been 383
well documented (Park et al., 2012). Likewise, transiently expressed, EYFP-tagged castor 384
BTPC (i.e., p118-EYFP) co-localized with an endogenous mitochondrial marker enzyme 385
(i.e., cytochrome c oxidase) (Supplemental Fig. S5D). When RcCDPK1-Cherry was co-386
expressed with p118-EYFP it partially co-localized with BTPC at aggregated mitochondria 387
(Fig. 8E), which are considered to have coalesced owing to BTPC expression and 388
association (Park et al., 2012). This supports the hypothesis of an in vivo interaction 389
between RcCDPK1 and BTPC, and is reminiscent of the reported occurrence of an 390
unspecified CDPK isoform and multiple phosphoproteins in the outer envelope of 391
mitochondria purified from potato tubers (Pical et al., 1993). Allied control experiments 392
confirmed that the co-localization of RcCDPK1-Cherry with p118-EYFP at aggregated 393
mitochondria (Fig. 8E), was not due to p118-EYFP fluorescence bleed-through during 394
CLSM imaging (Supplemental Fig. S5E). Furthermore, no protein co-localization occurred 395
when p118-EYFP was co-expressed with Cherry alone (Supplemental Fig. S5F), nor when 396
RcCDPK1-Cherry was co-expressed with mito-EYFP, which consisted of the E1α subunit of 397
the COS mitochondrial pyruvate dehydrogenase complex appended to EYFP 398
(Supplemental Fig. S5G). 399
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 16: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/16.jpg)
16
16
400
BTPC’s Intrinsically Disordered Region is an RcCDPK1 Interaction Domain 401
When PEPC was first isolated from developing COS, 64-kD BTPC polypeptides were 402
identified by LC-MS/MS and determined to be the binding partner of PTPC subunits in the 403
purified Class-2 PEPC complex (Blonde and Plaxton, 2003). Subsequent research 404
revealed that the native BTPC exists as a p118, but that upon COS extraction it is rapidly 405
cleaved by an endogenous thiol endopeptidase into 54- and 64-kD polypeptides (p54 and 406
p64) (Gennidakis et al., 2007). BTPC’s proteolytic cleavage site (Lys-446/Ile-447) as well 407
as its in vivo Ser-425 and Ser-451 phosphorylation sites all occur within an approximate 408
10-kD intrinsically disordered region, a distinctive feature of green algal and vascular plant 409
BTPCs that mediates their tight interaction with co-expressed PTPC subunits to form the 410
Class-2 PEPC heteromeric complex (O’Leary et al., 2011b; Park et al., 2012). 411
To map the RcCDPK1-interaction domain of COS BTPC, we initially focused our 412
attention on p54 and p64. As with full-length p118-EYFP (Fig. 8E), RcCDPK1-Cherry 413
partially co-localized with p54-EYFP, but not with p64-EYFP, at (aggregated) mitochondria 414
in BY-2 cells (Fig. 8G and 8H). Based on these results, we next tested whether the 415
intrinsically disordered region of BTPC is a potential RcCDPK1-interaction domain. 416
Specifically, RcCDPK1-Cherry was co-expressed with an additional BTPC truncation 417
mutant, namely p40-EYFP (consisting of p54, but without the disordered region; 418
corresponding to BTPC residues 1–329). As shown in Fig. 8I, p40-EYFP localized to the 419
mitochondria, as expected (Park et al., 2012), but failed to relocalize co-expressed 420
RcCDPK1-Cherry from the cytosol to mitochondria. 421
Taken together, these results indicate that the interaction of RcCDPK1 and BTPC/p118 422
is mediated, at least in part, by BTPC’s intrinsically disordered region. Similarly, COS 423
PTPC’s p107 subunits localized to the cytosol in the tobacco BY-2 cells, but relocalized to 424
the mitochondrial surface when co-expressed with BTPC/p118 or with various deletion 425
mutants containing portions of BTPC’s disordered region (Park et al., 2012). Intrinsically 426
disordered regions are widespread amongst different proteins, provide a docking site to 427
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 17: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/17.jpg)
17
17
promote protein–protein interactions by recruiting binding partners, and are susceptible to 428
site-specific phosphorylation (Dunker et al., 2005). Castor BTPC is no exception since its 429
Ser-425 and Ser-451 phosphorylation sites occur within its disordered region (O'Leary et 430
al. 2011c; Dalziel et al., 2012). Furthermore, this domain appears to be essential for 431
mediating BTPC’s in vivo interaction with PTPC within a Class-2 PEPC complex (Park et 432
al., 2012), as well as with RcCDPK1 (Fig. 8). 433
434
RcCDPK1 Binding to BTPC is Ca2+-Dependent 435
N-terminal glutathione S-transferase-tagged RcCDPK1 (GST-RcCDPK1) was 436
heterologously expressed and purified, then adsorbed to glutathione beads and incubated 437
with recombinant Class-1 or Class-2 PEPCs followed by affinity chromatography. GST-438
RcCDPK1 bound to the BTPC-containing Class-2 PEPC in a Ca2+-dependent manner (Fig. 439
9). Thus, conformational changes induced by Ca2+ binding not only activate RcCDPK1 (Fig. 440
4A and Fig. 6B) (Hill et al., 2014), but also control the ability of RcCDPK1 to recruit its 441
BTPC substrate. GST-RcCDPK1 specifically associated with the BTPC subunits of Class-2 442
PEPC, since no interaction was detected when it was incubated with purified Class-1 443
PEPC (i.e., a PTPC homotetramer) isolated from AtPPC3-overexpressing E. coli cells (Fig. 444
9). 445
446
The N-terminal Variable Domain is Important for RcCDPK1’s Trans- and 447
Autophosphorylation Activities, but not for its Ca2+-Dependent Binding to BTPC 448
The N-terminal variable domain has been the focus of several CDPK studies examining 449
its role in substrate recognition/binding, subcellular localization, and catalysis. For example, 450
this domain of NtCDPK1 appears to mediate a Ca2+-dependent interaction with its 451
substrate, the transcription factor REPRESSION OF SHOOT GROWTH FACTOR that 452
controls expression of gibberellin biosynthetic genes (Ito et al., 2010). N-terminal variable 453
domain deletion eliminated the in vitro and in vivo interaction of NtCDPK1 with 454
REPRESSION OF SHOOT GROWTH FACTOR, while significantly inhibiting its ability to in 455
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 18: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/18.jpg)
18
18
vitro phosphorylate this substrate at Ser-114 (Ito et al., 2010). Similarly, the N-terminal 456
variable domain of: (i) AtCPK32 is necessary but not solely sufficient for its interaction with 457
a substrate AtABF4 (Choi et al., 2005), and (ii) a potato CDPK, StCDPK5, is essential for 458
ensuring its proper subcellular location and consequent discrimination of its substrate, 459
NADPH oxidase (Asai et al., 2013). We approached this problem by expressing ∆N-460
RcCDPK1 as His6-, Cherry-, and GST-tagged fusion proteins. 461
N-terminal variable domain deletion triggered a marked reduction in the ability of Ca2+-462
activated RcCDPK1 to phosphorylate castor BTPC at Ser-451 (Fig. 4A and Fig. 6A). 463
Similarly, parallel autophosphorylation assays revealed that relative autophosphorylation 464
activity of ∆N-RcCDPK1 was about 90% lower than that of the non-truncated RcCDPK1 465
(Fig. 6B). Ca2+ addition enhanced RcCDPK1 autophosphorylation activity by about 50%, 466
but had no obvious impact on ∆N-RcCDPK autophosphorylation. By contrast, deletion of 467
the N-terminal variable domain did not disrupt the apparent in vivo interaction of ∆N-468
RcCDPK1-Cherry with p118-EYFP in tobacco BY-2 cells (Fig. 8F), nor hinder the ability of 469
GST-∆N-RcCDPK1 to specifically interact with its BTPC substrate in a Ca2+-dependent 470
fashion (Fig. 9). Overall, these results indicate that although the N-terminal variable domain 471
of RcCDPK1 is not critical for target recognition, it clearly contributes to fine-tuning kinase 472
activity for optimal Ca2+-dependent phosphorylation of BTPC at Ser-451. 473
474
CONCLUSIONS 475
In summary, we have identified BTPC as a novel target for a specific CDPK isozyme in 476
developing COS, and likely across plant taxa. This suggests an intriguing potential link 477
between cytosolic Ca2+ signaling and the control of carbon partitioning at the critical PEP 478
branchpoint in a biosynthetically active, heterotrophic plant tissue. These results have 479
implications not only for PEPC’s broader role in the control of cytosolic carbohydrate 480
partitioning and anaplerosis, but also for the regulation of the enigmatic BTPC by reversible 481
phosphorylation. It is notable that the developmental pattern of in vivo BTPC 482
phosphorylation at Ser-451 in COS (Dalziel et al., 2012; Hill et al., 2014), as well as the 483
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 19: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/19.jpg)
19
19
basophilic phosphorylation motif flanking its Ser-451 residue (Supplemental Fig. S3) are 484
distinct from those of COS PTPC and RcSUS1 (Tripodi et al., 2005; Fedosejevs et al., 485
2016). These differences imply specific protein kinase-phosphatase pairings in controlling 486
the phosphorylation status of BTPC, PTPC, versus RcSUS1 in developing COS. Indeed, a 487
low molecular mass (−30 kD), Ca2+-independent, and highly specific PTPC kinase 488
mediates Ser-11 phosphorylation/activation of the PTPC subunits of Class-1 PEPC during 489
COS development (Tripodi et al., 2005; Murmu and Plaxton, 2007). Furthermore, 490
RcCDPK2 phosphorylates RcSUS1 at Ser-11 in developing COS and shows many 491
additional and prominent differences compared to RcCDPK1 including: (i) a relatively non-492
specific in vitro substrate selectivity, including abundant peptide kinase activity, (ii) a 493
significantly lower K0.5(Ca2+) value of about 200 nM, (iii) insensitivity to metabolite effectors 494
including PEP, (iv) partial association with microsomal membranes, and (iv) a completely 495
opposite developmental profile in COS (i.e. RcCDPK2 expression, RcSUS1 Ser-11 kinase 496
activity, and in vivo RcSUS1 phosphorylation at Ser-11 progressively decrease during COS 497
development) (Fedosejevs et al., 2014, 2016). 498
Several attempts at metabolic engineering of PEPC have failed due to a lack of in-depth 499
knowledge of the enzyme’s multifaceted post-translational controls (O’Leary et al., 2011b). 500
Owing to the commercial interest in modifying photosynthate partitioning to agronomically 501
important end-products such as oil or storage proteins during seed development, and the 502
key position of PEPC in controlling this process, our castor bean PEPC research should 503
prove informative for developing innovative strategies for engineering PEPC activity. Given 504
PEPC’s critical position in central plant metabolism, it is perhaps not surprising that the 505
emerging model for regulation of non-photosynthetic PEPCs involves a complex and 506
unique set of post-translational control mechanisms that work hand-in-hand with the well-507
documented regulation of PTPC-containing Class-1 PEPCs (including C4 and CAM 508
photosynthetic PEPCs) by allosteric effectors and reversible phosphorylation 509
(Supplemental Fig. S1) (O’Leary et al., 2011b). These control mechanisms include BTPC’s 510
remarkable role as a catalytic and regulatory subunit of the allosterically-desensitized 511
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 20: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/20.jpg)
20
20
Class-2 PEPC heteromeric complex (O’Leary et al., 2009), and RcCDPK1’s Ca2+-512
dependent, inhibitory phosphorylation of the BTPC subunits at Ser-451. A major challenge 513
will be to link diverse post-translational PEPC controls with the in vivo regulation of PEP 514
partitioning to specific metabolic pathways. This now includes consideration of how 515
transient alterations in cytosolic Ca2+ signatures and PEP levels may serve to modulate 516
RcCDPK1 phosphorylation of BTPC at Ser-451 and thereby contributing to the control of 517
anaplerotic PEP flux and respiratory CO2 recycling by Class-2 PEPCs. Given the central 518
importance of protein phosphorylation as a post-translational regulatory mechanism, the 519
diversity of CDPKs in plants, and the lack of in vivo CDPK targets that have been 520
pinpointed to date, our RcCDPK1 and RcCDPK2 studies represent a significant advance 521
that helps to set the stage for future research aimed at exploring the interplay between 522
Ca2+ signaling and the integration and control of plant carbon metabolism. 523
524
MATERIALS AND METHODS 525
Plant Material, Protein Extraction, PEPC Activity Assays, and Protein Concentration 526
Determination 527
Castor (Ricinus communis L.; cv. Baker 296) plants were cultivated in a greenhouse as 528
previously described (O’Leary et al., 2011a). Tissues were rapidly harvested, frozen in 529
liquid N2 and stored at -80 °C until used. Tobacco (Nicotiana tabacum L.) BY-2 suspension-530
cultured cells were maintained as described by Park et al. (2012). 531
A homozygous Arabidopsis mutant line (atcpk11, SALK_054495) was kindly provided by 532
Prof. Jeffrey Harper (University of Nevada). Col-0 and atcpk11 seeds were sown in a 533
standard soil mixture (Sunshine Aggregate Plus Mix 1; SunGro, Vancouver, Canada) and 534
stratified at 4 oC for 3-d. Plants were cultivated in growth chambers at 23 °C (16/8 h 535
photoperiod at 100 µmol m-2 s-1 PAR) and fertilized biweekly by subirrigation with 0.25x 536
Hoagland’s media. Flowers (1 g) from 28-d-old plants were ground to a powder under liquid 537
N2 and homogenized (1:2; w/v) in 50 mM HEPES-KOH (pH 7.3) containing 1 mM EDTA, 1 538
mM EGTA, 10 mM MgCl2, 20% (v/v) glycerol, 5 mM thiourea, 1 mM DTT, 1% (w/v) 539
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 21: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/21.jpg)
21
21
polyvinyl(polypyrrolidone), 1 mM 2,2’-dipyridyl disulfide, 1 mM phenylmethylsulfonyl 540
fluoride, 25 mM NaF, 1 mM Na3VO4, and 1 mM Na2MoO4. After centrifugation, the 541
supernatant fluid was subjected to non-radioactive BTPC Ser-451 kinase assays as 542
described below and in the legend for Fig. 4A. 543
PEPC activity was assayed at 25 °C by following NADH oxidation at 340 nm using a 544
Molecular Devices microplate spectrophotometer as previously described (O’Leary et al., 545
2009; Hill et al., 2014). Protein concentrations were routinely determined by Coomassie 546
Blue G-250 dye binding using bovine γ–globulin (Pierce) as the protein standard. 547
548
LC-MS/MS and Protein Identification 549
Proteins in the final BTPC Ser-451 kinase preparation of Hill and co-workers (2014) 550
were reduced with 10 mM DTT, alkylated with 55 mM iodoacetamide, dialyzed against 10 551
mM ammonium bicarbonate, and dried using a CentriVap centrifugal concentrator 552
(Labconco Corp.). Protein digestion was performed using sequencing-grade trypsin 553
(Promega) in 25 mM ammonium bicarbonate at 1:100 ratio of trypsin to protein substrates. 554
Tryptic peptides were dried and reconstituted with 4-µL of 0.1% formic acid, and identified 555
using on-line nanoAcquity UPLC (Waters) coupled with an Orbitrap Fusion Tribrid mass 556
spectrometer (Thermo Fisher Scientific Inc.). The peptides were trapped by a 2G-V/MT 557
Trap symmetry C18 column (5 µm particles, 180 µm i.d. x 20 mm length) for 3 min at a flow 558
rate of 5 µL/min, and separated on a BEH130 C18 analytical column (1.7 µm particles, 100 559
µm i.d. × 100 mm length) at 300 nL/min for 1 h. The mobile phase was set up to a linear 560
gradient from 5-30% solvent B (0.1% formic acid in acetonitrile) over 40 min for peptide 561
elution, followed by flushing with 85% solvent B for 15 min and re-equilibrating the column 562
with solvent A (0.1% formic acid) for 10 min. MS survey scan was acquired with a high 563
resolution of 60,000 at the mass region of m/z 350 – 1800, and MS/MS measurements 564
were performed by collision-induced dissociation (CID) at data-dependent acquisition mode 565
for scanning the top twenty most intense ions at multiply charged states of 2+ to 7+, 566
respectively. Dynamic exclusion was set to 60 s. MS/MS data were searched against the R. 567
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 22: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/22.jpg)
22
22
communis protein sequence in the NCBI database using Mascot Server (version 2.5.1, 568
Matrix Science). The search parameters were restricted to tryptic peptides at a maximum of 569
2 missed cleavages. Cysteine carbamidomethylation was designated as a fixed 570
modification, and N-terminal protein acetylation, deamidation of asparagine and glutamine, 571
oxidation of methionine, and phosphorylation of Ser, Thr, and Tyr were considered as 572
variable modifications. Mass tolerances were set up to 10 ppm for Orbitrap MS ions and 573
0.8 Da for ion-trap MS/MS fragment ions. Peptide assignments were filtered by an ion 574
score cut off at 20, and the identified MS/MS spectra were verified manually. 575
576
qRT-PCR 577
Total RNA was extracted using an RNeasy® kit (QIAGEN) following the manufacturer’s 578
protocols. The DNase-treated RNA was used for cDNA synthesis with a QuantiTect reverse 579
transcription kit (QIAGEN). Quantitative PCR was performed using an Applied Biosystems 580
7500 Real-Time PCR system and GoTaq® qPCR Master Mix (Promega). The reaction 581
procedures were as follows: denature at 95 oC for 5 min, followed by 40 cycles of 95 oC for 582
15 s, 60 oC for 15 s, and 72 oC for 34 s. The castor Actin (AY360221) gene (RcActin) was 583
used as an internal control. Primers (Supplemental Table S3) were designed using 584
DNAMAN software (Version 5.0), and results were analyzed with Applied Biosystems 7500 585
Software Version 2.0.1. Relative gene expression was calculated using the relative 2–ΔΔCt 586
method (Livak and Schmittgen, 2001). All the experiments were repeated at least three 587
times using cDNAs prepared from two biological replicates. 588
589
RcCDPK1 Cloning and Heterologous Expression 590
Standard PCR amplification was used to introduce restriction sites for all sub-cloning 591
procedures, and all constructs were confirmed by DNA sequencing. Cloning of a cDNA 592
encoding RcCDPK1 was initiated by designing gene-specific primers (Supplemental Table 593
S2). A full-length cDNA library from stage V developing COS endosperm (Gennidakis et al., 594
2007) was used as the template to amplify a PCR product that was amplified and cloned 595
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 23: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/23.jpg)
23
23
into pGEM®-T vector (Promega) for sequencing. Sequence assembling was performed 596
using DNAMAN (Version 5.0). Alignment of RcCDPK1’s deduced amino acid sequence 597
with several of its orthologs was performed using Vector NTI® software (Life Technologies) 598
with default parameters. 599
For heterologous expression of RcCDPK1, its full-length cDNA was subcloned into a 600
pET30a(+) expression vector (Novagen) carrying an N-terminal His6-tag. A second 601
construct encoding the His6-tagged N-terminally truncated RcCDPK1 (residues 30-497; 602
∆N-RcCDPK1) was also produced. For recombinant protein production, both constructs 603
were separately transformed into E. coli (BL21-CondonPlus (DE3)-RIL) (Stratagene), and 604
cultured overnight at 37 oC in 500 mL of LB broth containing 50 µg/mL kanamycin to an 605
A600 of ~0.6. Protein production was induced using 0.4 mM isopropyl-β-D-thiogalactoside 606
for 3 h at 37 oC. Cells (~5 gFW) were harvested by centrifugation, resuspended in 40-mL of 607
ice-cold buffer A (50 mM NaH2PO4, pH 8.0, containing 300 mM NaCl), and lysed at 4 oC by 608
passage through a French Pressure Cell at 18,000 p.s.i. After centrifugation the 609
supernatant fluid was loaded at 1 mL/min onto a column (1.6 x 10 cm) of PrepEase® His-610
tagged High Yield Purification Ni2+-affinity resin (Affymetrix) equilibrated in buffer A. The 611
column was washed with buffer A until the A280 approached baseline and then eluted with 612
buffer A containing 250 mM imidazole. Pooled peak fractions were concentrated to 1 mL 613
with an Amicon Ultra-15 centrifugal filter unit (30-kD cutoff), divided into 25-μL aliquots, 614
frozen in liquid N2 and stored in -80 oC. For cleaving the His6-tag, purified RcCDPK1 was 615
incubated with enterokinase (New England Biolabs) according to the manufacturer’s 616
recommendations. For the generation of GST-RcCDPK1 and GST-∆N-RcCDPK1 the 617
respective constructs were ligated into a pGEX-4T-3 vector (GE Healthcare). The proteins 618
were heterologously expressed in E. coli as described above and purified using PrepEase® 619
Protein Purification Glutathione Agarose 4B (Affymetrix) according to the manufacturer’s 620
instructions. Purified GST-RcCDPK1 and GST-∆N-RcCDPK1 were concentrated and 621
stored as described above. 622
623
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 24: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/24.jpg)
24
24
RcCDPK1 Antibody Production and Immunoblotting 624
Rabbit antiserum against RcCDPK1 was produced using a synthetic peptide 625
(SynPeptide Co., Ltd.) designed to match amino acids 1-29 (i.e., the N-terminal variable 626
domain) (Supplemental Fig. S2A), with an additional Cys residue introduced at the N-627
terminus. Purified peptide was coupled to maleimide-activated keyhole limpet hemocyanin 628
(Life Technologies), dialyzed against Pi buffered saline (pH 7.4), filter-sterilized, and 629
emulsified with Titermax Gold (CytRx). Following collection of pre-immune serum, desalted 630
conjugate (750 μg) was injected subcutaneously into a rabbit, and a booster injection (250 631
μg) administered at 28 d. Two weeks after the final injection, blood was collected in 632
Vacutainer tubes (Becton Dickinson) by cardiac puncture. Clotted cells were removed by 633
centrifugation at 1,000 g, and the immune serum frozen in liquid N2 and stored at -80 oC in 634
0.04% (w/v) NaN3. For immunoblotting, anti-RcCDPK1 was affinity-purified against 500 μg 635
of nitrocellulose-bound recombinant RcCDPK1, as described previously (Dalziel et al., 636
2012). Production of anti-PTPC, anti-BTPC and anti-pSer451, SDS-PAGE, immunoblotting, 637
and chromogenic detection of immunoreactive polypeptides were carried out as previously 638
described (Gennidakis et al., 2007; O’Leary et al., 2009; Dalziel et al., 2012). All 639
immunoblots were replicated at least three times with representative results shown in the 640
figures. 641
642
In Vitro Kinase Assays 643
Kinase activity was assayed by monitoring P incorporation from non-radioactive or [γ-644
32P]-labelled ATP into the p118 BTPC subunits of purified, heterologously expressed Class-645
2 PEPC as previously described (Hill et al., 2014). Recombinant CDPKs (250 ng) were 646
routinely incubated with 10 μg of the Class-2 PEPC substrate (corresponding to 5 μg 647
p118/BTPC subunits) in a 25 μL reaction mix containing 50 mM HEPES-KOH (pH 7.3), 10 648
mM MgCl2, 1 mM DTT, 0.1 mM Na3VO4, 0.1 mM Na2MoO4, 10% (v/v) glycerol, and 0.2 mM 649
CaCl2. Reactions were initiated by the addition of 0.2 mM ATP or [γ-32P]ATP (1000 650
cpm/pmol), incubated at 30 °C for up to 20 min, and terminated by addition of SDS-PAGE 651
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 25: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/25.jpg)
25
25
sample buffer followed by heating at 100 oC for 3 min. For non-radioactive kinase assays, P 652
incorporation from ATP into p118 was determined by subjecting 10-μL aliquots of kinase 653
assays to SDS-PAGE and immunoblotting with anti-pSer451 and anti-BTPC. 654
For radiometric assays, the level of 32P incorporation from [γ-32P]ATP into p118 was 655
visualized by subjecting 10-μL aliquots of kinase assays to SDS-PAGE and developing 656
Coomassie Blue R-250 stained gels overnight in a phosphorimager cassette (Molecular 657
Dynamics, Piscataway NJ, USA) followed by scanning of the cassette using a Typhoon 658
6000 (GE Healthcare). 32P incorporation was quantified by liquid scintillation counting 659
following H2O2 digestion of excised SDS gel slices containing Coomassie blue R-250 660
stained p118 as previously described (Hill et al., 2014). 661
662
Autophosphorylation Assays 663
RcCDPK1 and ∆N-RcCDPK1 (2 µg each) were separately incubated at 30 oC for 30 min 664
with 0.2 mM [γ-32P]ATP (1000 cpm/pmol) in the following autophosphorylation assay buffer: 665
25 mM HEPES-KOH, pH 7.3, containing 10 mM MgCl2 and 0.2 mM CaCl2 or 5 mM EGTA 666
in a final volume of 10 μL. Reactions were terminated by addition of SDS-PAGE sample 667
buffer and heating at 100 oC for 3 min. The samples were subjected to SDS-PAGE and 668
phosphorimaging as described above. 669
670
Biophysical Studies 671
Isothermal scanning calorimetry was performed at 30 oC on a VP-ITC Microcalorimeter 672
(MicroCal). RcCDPK1 (10 mg in 1.5 mL) was further purified by gel filtration at 0.3 mL/min 673
on a Superdex 200 HiLoad 16/60 column (GE Healthcare) equilibrated with 25 mM 674
HEPES-KOH (pH 7.5) containing 100 mM NaCl, 2 mM EDTA, and 2 mM EGTA. Pooled 675
peak fractions were concentrated to 1 mL using an Amicon Ultra-15 concentrator (30-kD 676
cutoff) and dialyzed against 25 mM HEPES-KOH (pH 7.5) containing 100 mM NaCl and 10 677
mM MgCl2. RcCDPK1 (20 µM) and 10-μL injections (29 injections at 360 s intervals) of 500 678
μM CaCl2 were used in each experiment (with appropriate buffer blanks). Origin 7.0 679
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 26: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/26.jpg)
26
26
software (MicroCal) was used to obtain values for stoichiometry (N) and dissociation 680
constants (Kd) and binding-type input parameters were adjusted to obtain the best fitting 681
model for each experiment. 682
Fluorescence spectroscopy was performed using 25 µM RcCDPK1 and 250 μM 8-683
anilinonaphthalene-1-sulfonic acid in 10 mM Tris-HCl (pH 7.5) containing 100 mM KCl and 684
1 mM DTT (with various additions described in Fig. 7B). RcCDPK1’s fluorescence emission 685
spectra were recorded at 23 oC using black Fluotrac-200 96-well microplates on a 686
Spectramax Gemini XS Spectrofluorometer. Petunia CaM81 (15 µM) (Bender et al., 2014) 687
was monitored alongside RcCDPK1 as a positive control for Ca2+-dependent hydrophobic 688
exposure. 689
Far-UV circular dichroism spectra from 182-260 nm were acquired at 23 oC on a 690
Chirascan CD spectrometer using a cylindrical quartz cuvette with a pathlength of 0.1 mm. 691
Samples of 15 μM RcCDPK1 were used for data acquisition as described in Fig. 7C. 692
Spectra from a minimum of 10 replicate scans were averaged and corrected for 693
background. 694
695
Transient Transformation and Imaging of Tobacco BY-2 Suspension Cells 696
Full-length and a 5’-truncated version (corresponding to ΔN-RcCDPK1) of the RcCDPK1 697
cDNA sequence (with or without a stop codon) were amplified via PCR with the appropriate 698
primers (Supplemental Table S2) from pET30a-RcCDPK1 (see above). Resulting DNA 699
fragments were gel-purified and subcloned into pRTL2-Cherry using XmaI and NheI to 700
yield RcCDPK1-Cherry and ΔN-RcCDPK1-Cherry. To generate Cherry-RcCDPK1 and 701
Cherry-ΔN-RcCDPK1, purified fragments were subcloned into pRTL2-Cherry (a transient 702
expression vector containing the 35S cauliflower mosaic virus promoter and the open 703
reading frame of the red fluorescent protein Cherry; Gidda et al., 2011) using BamHI. To 704
construct RcCDPK1-GFP, pGreen35S C-GFP and an RcCDPK1 PCR fragment were 705
digested with BamHI and EcoRV, gel purified, and then ligated. Mito-EYFP was 706
constructed by amplifying the full-length open reading frame encoding the mitochondrial 707
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 27: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/27.jpg)
27
27
pyruvate dehydrogenase complex E1-α subunit from a developing COS cDNA library 708
(Gennidakis et al., 2007) using the appropriate oligonucleotide primers (Supplemental 709
Table S2). Amplified products were digested with NcoI and EcoRI and ligated into the 710
corresponding sites in pSAT6-EYFP-C1 (Tzfira et al., 2005). Construction of the BTPC-711
EYFP plasmid was previously reported (Park et al., 2012). All constructs were confirmed by 712
DNA sequencing. 713
Transient (co)transformations of tobacco BY-2 suspension-cultured cells was performed 714
with 2-5 μg of plasmid DNA using a biolistic particle delivery system (Bio-Rad) as described 715
previously (Park et al., 2012). Bombarded cells were incubated for ~6 h to allow for gene 716
expression and protein sorting, fixed in 4% (w/v) formaldehyde, and then either processed 717
for immunostaining or imaged directly using a Leica SP2 CLSM at the Molecular and 718
Cellular Imaging Facility (University of Guelph) as previously described (Park et al., 2012). 719
Primary and secondary antibodies used were rabbit anti-Arabidopsis cytochrome oxidase c 720
subunit II (CoxII) affinity-peptide purified IgGs (Cedarlane Labs) and goat anti-rabbit 721
rhodamine red-X conjugated IgGs (Jackson Immunoresearch Laboratories), respectively. 722
Fluorophore emissions were collected sequentially in all fluorescent protein fusion co-723
expression experiments; single-labeling experiments shown no detectable crossover (i.e., 724
bleed through) at the settings used for data collection. False colorizations of images (i.e., 725
EYFP to green and Cherry to magenta) and merges were generated using ImageJ 726
(http://imagej.nih.gov/ij/), and figure compositions were generated using Adobe Photoshop 727
CS6 and/or Illustrator CS6 (Adobe Systems). All micrographs shown are representative 728
images obtained from at least three independent experiments. 729
730
GST Pull-Down Assays 731
Purified GST-RcCDPK1 or GST-∆N-RcCDPK1 (2 μg each) was incubated with bait 732
proteins (3 μg each) and glutathione agarose beads (40-µL) (Affymetrix) in a binding buffer 733
(25 mM HEPES-KOH (pH 7.0), 100 mM NaCl, 0.05% (v/v) β-mercaptoethanol, 0.1% (v/v) 734
Triton X-100, and 0.1 mM CaCl2 or 2 mM EGTA) for 2 h at 4 °C with end-over-end mixing. 735
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 28: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/28.jpg)
28
28
The beads were washed three times with binding buffer, and bound proteins eluted using 736
40-µL of 50 mM Tris-HCl (pH 8.0) containing 20 mM reduced glutathione, and analyzed by 737
SDS-PAGE and immunoblotting as described above. 738
739
Accession Numbers 740
Sequence data from this article can be found in the GenBank/EMBL databases under 741
the following accession numbers: NM_117025 (AtCPK4), NM_103271 (AtCPK11), 742
NM_001248700 (GmCDPKβ), NM_001072396 (OsCPK24), XM_002526769 (RcCDPK1), 743
NM_001112282 (ZmCPK11). 744
745
Supplemental Data 746
The following materials are available in the online version of this article. 747
Supplemental Figure S1. Model illustrating the biochemical complexity of castor bean 748
PEPC. 749
Supplemental Figure S2. Dot-blot assessment of affinity-purified antibodies raised 750
against a synthetic peptide matching RcCDPK1’s N-terminal variable domain. 751
Supplemental Figure S3. RcCDPK1 or ∆N-RcCDPK1 cannot phosphorylate a pair of 752
synthetic peptides containing residues flanking BTPC’s Ser-451 phosphorylation 753
site. 754
Supplemental Figure S4. Phenyl-Sepharose elution profile for native BTPC Ser-451 755
kinase activity from developing COS. 756
Supplemental Figure S5. Various fluorescent protein-tagged versions of RcCDPK1 757
and ∆N-RcCDPK1 localize to the cytosol and nucleus in tobacco BY-2 cells. 758
Supplemental Table S1. Proteins reliably identified by nanoHPLC-MS/MS analysis of 759
a tryptic digest of the final preparation of partially-purified native BTPC Ser-451 760
kinase from developing COS (Hill et al., 2014). 761
Supplemental Table S2. Primers used for cloning and PCR. 762
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 29: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/29.jpg)
29
29
763
ACKNOWLEDGMENTS 764
We are grateful to Prof. Steven Huber (Univ. of Illinois) for helpful discussions as well as 765
the gift of heterologous expression plasmids for AtCPK4, AtCPK34, and GmCDPKβ. We 766
are also indebted to Prof. Joonho Park (Seoul National Univ. of Science and Technology) 767
for preparation of the Mito-EYFP construct, Mr. Kim Munro (Queen’s Protein Function 768
Discovery Facility) for assisting with isothermal titration calorimetry and circular dichroism 769
spectroscopy, Ms. Deni Ogunrinde (Dept. of Biomedical and Molecular Sciences, Queen’s 770
Univ.) for assisting with fluorescence spectroscopy, Prof. Jeffrey Harper (Univ. of Nevada) 771
for the gift of atcpk11 knockout seeds, and Prof. Greg Moorhead (Univ. of Calgary) for 772
helpful discussions and encouragement. 773
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 30: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/30.jpg)
30
30
FIGURE LEGENDS 774
Figure 1. Alignment of tryptic peptides derived from purified castor bean BTPC Ser-451 775
kinase with the deduced sequence of RcCDPK1 and several orthologs from other plants. 776
LC-MS/MS analysis of the final BTPC Ser-451 kinase preparation of Hill and co-workers 777
(2014) resulted in 9 peptide sequences unique to RcCDPK1 that are underlined with a solid 778
gray line. The protein kinase catalytic domain and 4 EF hand (Ca2+-binding) motifs are 779
overlined with dashed and solid black lines, respectively. The conserved phosphomimetic 780
Asp (D) residue that occurs within the activation loop of RcCDPK1 and its orthologs is 781
highlighted with a bold font (i.e. Asp-190 in the case of RcCDPK1). Black shading indicates 782
identical residues, whereas gray shading denotes residues conserved amongst the six 783
proteins. Gaps, indicated by dashes, were introduced to maximize alignment. Inset: 784
schematic diagram of RcCDPK1 functional domains (NTVD, N-terminal variable domain; 785
AIJ, auto-inhibitory junction; CTVD, C-terminal variable domain). 786
787
Figure 2. Analysis of RcCDPK1 expression. Levels of mRNA were analyzed by qRT-PCR 788
using gene-specific primers. Castor Actin (AY360221) was used as the internal control for 789
normalization. A, Tissue-specific expression of RcCDPK1. Developing and germinating 790
seed tissues were respectively harvested from stage VII and 5 d post-imbibition COS, male 791
flowers were harvested at maturity, whereas female flowers were harvested at 5 d post-792
anthesis (corresponding to proembryo or stage I COS). Abbreviations are: E, endosperm; 793
C, cotyledon; MF, male flower; Int. and P, integument and pericarp of female flowers, 794
respectively; H, hypocotyl; RM, root middle; RT, root tip; Bud, leaf bud; Exp, expanding leaf; 795
Mat, mature leaf; dC and dE, cotyledon and endosperm, respectively, from stage VII 796
developing COS that had been depodded for 48 h. B, The profile of RcCDPK1 transcripts 797
was compared with that of BTPC (RcPPC4; EF634318) in endosperm of developing COS. 798
Stages III, V, VII, IX correspond to heart-shaped embryo, mid-cotyledon, full cotyledon, and 799
maturation stages of endosperm development, respectively; the lane labelled ‘Dry’ 800
designates fully mature COS; n.d., not detected. All values in panels A and B represent 801
means ±SEM of n = 4 determinations using cDNAs prepared from two biological replicates. 802
803
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 31: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/31.jpg)
31
31
Figure 3. SDS-PAGE and immunoblot analysis of RcCDPK1 and ∆N-RcCDPK1. 804
A, SDS-PAGE of 2.5 μg each of the final His6-tagged RcCDPK1 and ∆N-RcCDPK1 805
preparations was performed following the addition of 2 mM CaCl2 or 2 mM EGTA to the 806
samples as indicated. The gel was stained with Coomassie Brilliant Blue R-250. 807
B, Immunoblotting following SDS-PAGE was performed with a 1:50 dilution of affinity-808
purified anti-RcCDPK1 peptide antibodies. Protein loading was: His6-RcCDPK1 and His6-809
∆N-RcCDPK1 (50 ng each); ‘RcCDPK1’ represents 75 ng of recombinant RcCDPK1 after 810
incubation with enterokinase to remove its His6-tag; ‘COS Phenyl Sepharose Eluate’ 811
represents 20 µg of BTPC Ser-451 kinase enriched extract from Stage V-VII developing 812
COS (prepared as described in legend for Supplemental Fig. S4); whereas ‘COS BTPC-K’ 813
represents 2 µg of the final preparation of BTPC Ser-451 kinase purified by Hill et al. 814
(2014). CaCl2 (0.2 mM) was added to all samples prior to SDS-PAGE and immunoblotting. 815
‘M’ denotes various protein molecular mass standards in panels A and B. 816
817
Figure 4. Calcium-dependent phosphorylation of castor BTPC at Ser-451. A and B, 818
Recombinant Class-2 PEPC (10 µg) containing an equivalent ratio of castor BTPC 819
(RcPPC4) and Arabidopsis PTPC (AtPPC3) subunits (O’Leary et al., 2009) was incubated 820
for 20 min at 30 oC in 25-μL of the standard phosphorylation assay mix containing 0.1 mM 821
ATP, 10 mM MgCl2, and 0.2 mM CaCl2 (+) or 2 mM EGTA (-) and (A) various CDPKs (250 822
ng each), or (B) soluble protein extracts (25 µg each) from flowers of 28-d old Arabidopsis 823
Col-0 or mutant atcpk11 knockout plants. (C) RcCDPK1 was assayed as above in the 824
presence of 0.2 mM CaCl2 and the indicated PEP concentrations. Following SDS-PAGE, 825
the gels were subjected to immunoblotting with anti-pSer451 or anti-BTPC as indicated. 826
Results of panels A-C are representative of three independent experiments. 827
828
Figure 5. Substrate specificity of RcCDPK1. Purified recombinant Class-2 PEPC 829
containing S451D mutant or wild-type BTPC subunits (O’Leary et al., 2009; Dalziel et al., 830
2012), in vitro dephosphorylated COS Class-1 PEPC or RcSUS1 (Tripodi et al., 2005; 831
Fedosejevs et al., 2014), or histone III-S from calf thymus (10 μg) were incubated for 10 832
min at 30 °C in 25-μL of the standard [γ-32P]ATP phosphorylation assay mix containing 0.2 833
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 32: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/32.jpg)
32
32
mM CaCl2 and 250 ng of RcCDPK1. Following SDS-PAGE (2 μg protein per lane), the gel 834
was subjected to (A) phosphorimaging and (B) stained with Coomassie Blue R-250 (CBB-835
250). Results are representative of three independent experiments. 836
837
Figure 6. The N-terminal variable domain is required for optimal RcCDPK1 activity. 838
A, The indicated amounts of RcCDPK1 and ∆N-RcCDPK1 were incubated with 20 μg of 839
recombinant Class-2 PEPC for 10 min at 30 °C in the standard [γ-32P]ATP phosphorylation 840
assay mix containing 0.2 mM CaCl2. Following SDS-PAGE and phosphorimaging, 32P 841
incorporation into BTPC subunits was quantified by digestion of excised Coomassie blue 842
R-250 stained p118 bands from SDS gels with H2O2, and liquid scintillation counting. 843
B, RcCDPK1 and ∆N-RcCDPK1 (2 µg each) were incubated for 30 min at 30 °C in 10 µL of 844
the standard [γ-32P]ATP phosphorylation assay mix containing 0.2 mM CaCl2 (+) or 2 mM 845
EGTA (-), but lacking an exogenous substrate. Following SDS-PAGE, autophosphorylation 846
activity was visualized by phosphorimaging. 32P incorporation was quantified by digestion 847
of excised protein-stained RcCDPK1 and ∆N-RcCDPK1 polypeptides from SDS gels with 848
H2O2, and liquid scintillation counting. Results of panels A and B are representative of three 849
independent experiments. 850
851
Figure 7. Biophysical studies of RcCDPK1. A, Analysis of Ca2+ binding to RcCDPK1 by 852
isothermal titration calorimetry. A representative data curve of the RcCDPK1-Ca2+ 853
interaction at 30 oC in 25 mM HEPES-KOH (pH 7.5), 100 mM NaCl, and 10 mM MgCl2 is 854
presented. The top panel shows the calorimetric titration of 2.0 mL of 20 μM RcCDPK1 with 855
500 μM CaCl2 using 29 injections of 10-μL each. The lower panel presents the 856
corresponding integrated binding isotherm modelled to two sets of binding sites. B, 8-857
Anilinonaphthalene-1-sulfonic acid fluorescence emission spectra from 430 - 600 nm were 858
collected to examine the exposed hydrophobicity of 25 μM RcCDPK1 versus petunia 859
CaM81 in 25 mM HEPES-KOH (pH 7.5) containing 100 mM KCl and 1 mM DTT, with 860
various additions as shown. Background fluorescence in the absence of RcCDPK1 or 861
CaM81 is also shown. C, Far-UV circular dichroism spectroscopy was used to study the 862
impact of Ca2+ addition on the secondary structure characteristics of RcCDPK1 in 5 mM 863
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 33: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/33.jpg)
33
33
Tris-HCl or HEPES-KOH (pH 7.5). Each spectrum is representative of at least 10 averaged 864
scans. 865
866
Figure 8. Relocalization of RcCDPK1 and ΔN-RcCPDK1 by castor BTPC to the 867
mitochondria of tobacco BY-2 cells. A, Schematic illustration of fluorescent protein fusion 868
constructs of wild-type and mutant versions of RcCDPK1 and castor BTPC that were 869
transiently expressed in tobacco BY-2 cells. BTPC’s intrinsically disordered region is 870
highlighted in blue. The numbers above each construct indicate amino acid residue 871
positions. B-I, Representative CLSM micrographs of individual tobacco BY-2 cells 872
(co)expressing (as indicated by panel labels) the following: (B) RcCDPK1-Cherry, (C) ∆N-873
RcCDPK1-Cherry, (D) Cherry, (E) RcCDPK1-Cherry and p118-EYFP, (F) ∆N-RcCDPK1-874
Cherry and p118-EYFP, (G) RcCDPK1-Cherry and p54-EYFP, (H) RcCDPK1-Cherry and 875
p64-EYFP, and (I) RcCDPK1-Cherry and p40-EYFP. Note that the fluorescence 876
attributable to RcCDPK1 and p118 (and mutant versions thereof) was false colourized 877
magenta and green, respectively. Shown in (B-D) are the corresponding differential 878
interference contrast (DIC) images. Corresponding merged images are presented in (E) 879
and (F); white colour represents protein co-localization. Arrowheads and boxes 880
representing portions of the cells shown at higher magnification in the insets in (E) and (F) 881
indicate obvious examples of co-localization of RcCDPK1-Cherry or ΔN-RcCDPK1-Cherry 882
with p118-EYFP at (aggregated) mitochondria. Scale bar = 10 μm. 883
884
Figure 9. In vitro interaction of GST-RcCDPK1 or GST-∆N-RcCDPK1 with BTPC subunits 885
of recombinant Class-2 PEPC is Ca2+-dependent. GST, GST-RcCDPK1, and GST-∆N-886
RcCDPK1 (2 μg each) were respectively immobilized on glutathione beads and incubated 887
with pure recombinant Class-1 and/or Class-2 PEPCs (5 μg each) (O’Leary et al., 2009) in 888
the presence of 0.5 mM CaCl2 (+) or 2 mM EGTA (-) as indicated. Bound proteins were 889
eluted with a buffer containing GSH and analyzed via SDS-PAGE (2.5 µg protein/lane) and: 890
(A) protein staining with Coomassie Brilliant Blue R-250, or (B) immunoblotting with anti-891
PTPC or anti-BTPC. 892
893
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 34: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/34.jpg)
34
34
LITERATURE CITED 894
Almadanim MC, Alexandre BM, Rosa MTG, Sapeta H, Leitão AE, Ramalho JC, Lam 895
TT, Negrão S, Abreu IA, Oliveira MM (2017) Rice calcium-dependent protein 896
kinase OsCPK17 targets plasma membrane intrinsic protein and sucrose phosphate 897
synthase and is required for a proper cold stress response. Plant Cell Environ. doi: 898
10.1111/pce.12916 899
Asai S, Ichikawa T, Nomura H, Kobayashi M, Kamiyoshihara Y, Mori H, Kadota Y, 900
Zipfel C, Jones JDG, Yoshioka H (2013) The variable domain of a plant calcium-901
dependent protein kinase (CDPK) confers subcellular localization and substrate 902
recognition for NADPH oxidase. J Biol Chem 288: 14332–14340 903
Bachmann M, Shiraishi N, Campbell WH, Yoo BC, Harmon AC, Huber SC (1996) 904
Identification of Ser-543 as the major regulatory phosphorylation site in spinach leaf 905
nitrate reductase. Plant Cell 8: 505–517 906
Bender KW, Dobney S, Ogunrinde A, Chiasson D, Mullen RT, Teresinski HJ, Singh P, 907
Munro K, Smith SP, Snedden WA (2014) The calmodulin-like protein CML43 908
functions as a salicylic-acid-inducible root-specific Ca2+ sensor in Arabidopsis. 909
Biochem J 457: 127–136 910
Blonde JD, Plaxton WC (2003) Structural and kinetic properties of high and low molecular 911
mass phosphoenolpyruvate carboxylase isoforms from the endosperm of developing 912
castor oilseeds. J Biol Chem 278: 11867–11873 913
Boudsocq M, Droillard M-J, Regad L, Lauriere C (2012) Characterization of Arabidopsis 914
calcium-dependent protein kinases: activated or not by calcium? Biochem J 447: 915
291–299 916
Boudsocq M, Sheen J (2013) CDPKs in immune and stress signaling. Trends Plant Sci 917
18: 30–40 918
Brandizzi F, Irons S, Kearns A, Hawes C (2003) BY-2 cells: culture and transformation for 919
live cell imaging. Curr Protoc Cell Biol 1–7 920
Choi HI, Park HJ, Park JH, Kim S, Im MY, Seo HH, Kim YW, Hwang I, Kim SY (2005) 921
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 35: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/35.jpg)
35
35
Arabidopsis calcium-dependent protein kinase AtCPK32 interacts with ABF4, a 922
transcriptional regulator of abscisic acid-responsive gene expression, and modulates 923
its activity. Plant Physiol 139: 1750–1761 924
Dalziel KJ, O’Leary B, Brikis C, Rao SK, She Y-M, Cyr T, Plaxton WC (2012) The 925
bacterial-type phosphoenolpyruvate carboxylase isozyme from developing castor oil 926
seeds is subject to in vivo regulatory phosphorylation at serine-451. FEBS Lett 586: 927
1049–1054 928
Dammann C, Ichida A, Hong BM, Romanowsky SM, Hrabak EM, Harmon AC, Pickard 929
BG, Harper JF (2003) Subcellular targeting of nine calcium-dependent protein 930
kinase isoforms from Arabidopsis. Plant Physiol 132: 1840–1848 931
DeFalco TA, Bender KW, Snedden WA (2010) Breaking the code: Ca2+ sensors in plant 932
signalling. Biochem J 425: 27–40 933
Douglas P, Moorhead G, Hong Y, Morrice N, MacKintosh C (1998) Purification of a 934
nitrate reductase kinase from Spinacea oleracea leaves, and its identification as a 935
calmodulin-domain protein kinase. Planta 206: 435–442 936
Dunker AK, Cortese MS, Romero P, Iakoucheva LM, Uversky VN (2005) Flexible nets - 937
the roles of intrinsic disorder in protein interaction networks. FEBS J 272: 5129–938
5148 939
Endicott JA, Noble MEM, Johnson LN (2012) The structural basis for control of 940
eukaryotic protein kinases. Annu Rev Biochem 81: 587–613 941
Fedosejevs ET, Gerdis SA, Ying S, Pyc M, Anderson EM, Snedden WA, Mullen RT, 942
She Y-M, Plaxton WC (2016) The calcium-dependent protein kinase RcCDPK2 943
phosphorylates sucrose synthase at Ser11 in developing castor oil seeds. Biochem 944
J 473: 3667–3682 945
Fedosejevs ET, Ying S, Park J, Anderson EM, Mullen RT, She Y-M, Plaxton WC (2014) 946
Biochemical and molecular characterization of RcSUS1, a cytosolic sucrose 947
synthase phosphorylated in vivo at serine 11 in developing castor oil seeds. J Biol 948
Chem 289: 33412–33424 949
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 36: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/36.jpg)
36
36
Gennidakis S, Rao S, Greenham K, Uhrig RG, O’Leary B, Snedden WA, Lu C, Plaxton 950
WC (2007) Bacterial- and plant-type phosphoenolpyruvate carboxylase polypeptides 951
interact in the hetero-oligomeric Class-2 PEPC complex of developing castor oil 952
seeds. Plant J 52: 839–849 953
Harmon A, Putnam-Evans C, Cormier M (1987) A calcium-dependent but calmodulin-954
independent protein kinase from soybean. Plant Physiol 83: 830–837 955
Harper JE, Breton G, Harmon A (2004) Decoding Ca2+ signals through plant protein 956
kinases. Annu Rev Plant Biol 55: 263–288 957
Hill AT, Ying S, Plaxton WC (2014) Phosphorylation of bacterial-type 958
phosphoenolpyruvate carboxylase by a Ca2+-dependent protein kinase suggests a 959
link between Ca2+ signalling and anaplerotic pathway control in developing castor 960
oil seeds. Biochem J 458: 109–118 961
Igawa T, Fujiwara M, Tanaka I, Fukao Y, Yanagawa Y (2010) Characterization of 962
bacterial-type phosphoenolpyruvate carboxylase expressed in male gametophyte of 963
higher plants. BMC Plant Biol 10: 200–200 964
Ito T, Nakata M, Fukazawa J, Ishida S, Takahashi Y (2010) Alteration of substrate 965
specificity: the variable N-terminal domain of tobacco Ca2+-dependent protein 966
kinase is important for substrate recognition. Plant Cell 22: 1592–1604 967
Kobayashi M, Ohura I, Kawakita K, Yokota N, Fujiwara M, Shimamoto K, Doke N, 968
Yoshioka H (2007) Calcium-dependent protein kinases regulate the production of 969
reactive oxygen species by potato NADPH oxidase. Plant Cell 19: 1065–1080 970
Liese A, Romeis T (2013) Biochemical regulation of in vivo function of plant calcium-971
dependent protein kinases (CDPK). Biochim Biophys Acta 1833: 1582–1589 972
Livak KJ, Schmittgen TD (2001) Analysis of relative gene expression data using real-time 973
quantitative PCR and the 2(T)(-Delta Delta C) method. Methods 25: 402–408 974
Martin ML, Busconi L (2000) Membrane localization of a rice calcium-dependent protein 975
kinase (CDPK) is mediated by myristoylation and palmitoylation. Plant J 24: 429–976
435 977
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 37: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/37.jpg)
37
37
Milla MAR, Uno Y, Chang IF, Townsend J, Maher EA, Quilici D, Cushman JC (2006) A 978
novel yeast two-hybrid approach to identify CDPK substrates: Characterization of 979
the interaction between AtCPK11 and AtDi19, a nuclear zinc finger protein. FEBS 980
Lett 580: 904–911 981
O’Leary B, Fedosejevs ET, Hill AT, Bettridge J, Park J, Rao SK, Leach CA, Plaxton WC 982
(2011a) Tissue-specific expression and post-translational modifications of plant- and 983
bacterial-type phosphoenolpyruvate carboxylase isozymes of the castor oil plant, 984
Ricinus communis L. J Exp Bot 62: 5485–5495 985
O’Leary B, Park J, Plaxton WC (2011b) The remarkable diversity of plant PEPC 986
(phosphoenolpyruvate carboxylase): recent insights into the physiological functions 987
and post-translational controls of non-photosynthetic PEPCs. Biochem J 436: 15–988
34 989
O’Leary B, Rao SK, Kim J, Plaxton WC (2009) Bacterial-type phosphoenolpyruvate 990
carboxylase (PEPC) functions as a catalytic and regulatory subunit of the novel 991
Class-2 PEPC complex of vascular plants. J Biol Chem 284: 24797–24805 992
O’Leary B, Rao SK, Plaxton WC (2011c) Phosphorylation of bacterial-type 993
phosphoenolpyruvate carboxylase at Ser(425) provides a further tier of enzyme 994
control in developing castor oil seeds. Biochem J 433: 65–74 995
Park J, Khuu N, Howard ASM, Mullen RT, Plaxton WC (2012) Bacterial- and plant-type 996
phosphoenolpyruvate carboxylase isozymes from developing castor oil seeds 997
interact in vivo and associate with the surface of mitochondria. Plant J 71: 251–262 998
Pical C, Fredlund K, Petit P, Sommarin M, Moller I (1993) The outer-membrane of plant 999
mitochondria contains a calcium-dependent protein-kinase and multiple 1000
phosphoproteins. FEBS Letts 336: 347–351 1001
Rivoal J, Trzos S, Gage DA, Plaxton WC, Turpin DH (2001) Two unrelated 1002
phosphoenolpyruvate carboxylase polypeptides physically interact in the high 1003
molecular mass isoforms of this enzyme in the unicellular green alga Selenastrum 1004
minutum. J Biol Chem 276: 12588–12597 1005
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 38: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/38.jpg)
38
38
Ruiz-Ballesta I, Baena G, Gandullo J, Wang L, She Y-M, Plaxton WC, Echevarría C 1006
(2016) New insights into the post-translational modification of multiple 1007
phosphoenolpyruvate carboxylase isoenzymes by phosphorylation and 1008
monoubiquitination during sorghum seed development and germination. J Exp Bot 1009
67: 3523–3536 1010
Ruiz-Ballesta I, Feria A-B, Ni H, She Y-M, Plaxton WC, Echevarra C (2014) In vivo 1011
monoubiquitination of anaplerotic phosphoenolpyruvate carboxylase occurs at 1012
Lys624 in germinating sorghum seeds. J Exp Bot 65: 443–451 1013
Schulz P, Herde M, Romeis T (2013) Calcium-dependent protein kinases: hubs in plant 1014
stress signaling and development. Plant Physiol 163: 523–530 1015
Simeunovic A, Mair A, Wurzinger B, Teige M (2016) Know where your clients are: 1016
subcellular localization and targets of calcium-dependent protein kinases. J Exp Bot 1017
67: 3855–3872 1018
Taylor SS, Kornev AP (2011) Protein kinases: evolution of dynamic regulatory proteins. 1019
Trends Biochem Sci 36: 65–77 1020
Tripodi KE, Turner WL, Gennidakis S, Plaxton WC (2005) In vivo regulatory 1021
phosphorylation of novel phosphoenolpyruvate carboxylase isoforms in endosperm 1022
of developing castor oil seeds. Plant Physiol 139: 969–978 1023
Tzfira T, Tian G-W, Lacroix B, Vyas S, Li J, Leitner-Dagan Y, Krichevsky A, Taylor T, 1024
Vainstein A, Citovsky V (2005) pSAT vectors: a modular series of plasmids for 1025
autofluorescent protein tagging and expression of multiple genes in plants. Plant Mol 1026
Biol 57: 503–516 1027
Uhrig RG, O’Leary B, Spang HE, MacDonald JA, She YM, Plaxton WC (2008a) 1028
Coimmunopurification of phosphorylated bacterial- and plant-type 1029
phosphoenolpyruvate carboxylases with the plastidial pyruvate dehydrogenase 1030
complex from developing castor oil seeds. Plant Physiol 146: 1346–1357 1031
Uhrig RG, She YM, Leach CA, Plaxton WC (2008b) Regulatory monoubiquitination of 1032
phosphoenolpyruvate carboxylase in germinating castor oil seeds. J Biol Chem 283: 1033
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 39: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/39.jpg)
39
39
29650–29657 1034
Winter H, Huber SC (2000) Regulation of sucrose metabolism in higher plants: localization 1035
and regulation of activity of key enzymes. Crit Rev Plant Sci 19: 31–67 1036
Witte C-P, Keinath N, Dubiella U, Demouliere R, Seal A, Romeis T (2010) Tobacco 1037
calcium-dependent protein kinases are differentially phosphorylated in vivo as part 1038
of a kinase cascade that regulates stress response. J Biol Chem 285: 9740–9748 1039
Zhang M, Tanaka T, Ikura M (1995) Calcium-induced conformational transition revealed by 1040
the solution structure of apo calmodulin. Nat Struct Biol 2: 758–767 1041
Zhang XQ, Lund AA, Sarath G, Cerny RL, Roberts DM, Chollet R (1999) Soybean 1042
nodule sucrose synthase (Nodulin-100): Further analysis of its phosphorylation 1043
using recombinant and authentic root-nodule enzymes. Arch Biochem Biophys 371: 1044
70–82 1045
Zhu S-Y, Yu X-C, Wang X-J, Zhao R, Li Y, Fan R-C, Shang Y, Du S-Y, Wang X-F, Wu F-1046
Q, et al (2007) Two calcium-dependent protein kinases, CPK4 and CPK11, regulate 1047
abscisic acid signal transduction in Arabidopsis. Plant Cell 19: 3019–3036 1048
1049
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 40: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/40.jpg)
AtCPK11 (1) ------------------METKPNPRRPS-----NTVLPYQTPRLRDHYLLGKKLGQGQFGTTYLCTEKSTSANYACKSIPKRKLVCREDYEDVWREIQI AtCPK4 (1) -------------------MEKPNPRRPS-----NSVLPYETPRLRDHYLLGKKLGQGQFGTTYLCTEKSSSANYACKSIPKRKLVCREDYEDVWREIQI
OsCPK24 (1) MQPDPSGSGGDGNANAKAKLAPPPVTAAG--GRPVSVLPHKTANVRDHYRIGKKLGQGQFGTTYLCVDKASGGEFACKSIPKRKLLCREDYEDVWREIQI ZmCPK11 (1) MQPDPSG-----NANAKTKLPQLVTAPAPSSGRPASVLPYKTANVRDHYRIGKKLGQGQFGTTYQCVGKADGAEYACKSIPKRKLLCREDYEDVYREIQI GmCDPKβ (1) -------------------MQKHGFASK------RNVLPYQTARLRDHYVLGKKLGQGQFGTTYLCTHKVTGKLYACKSIPKRKLMCQEDYDDVWREIQI RcCDPK1 (1) -------------------MKKQSAGGSSTTKPAHTVLPYQTSRLRDHYLIGKKLGQGQFGTTYLCTNKATNAQYACKSIPKRKLLCKEDYEDVWREIQI
AtCPK11 (78) MHHLSEHPNVVRIKGTYEDSVFVHIVMEVCEGGELFDRIVSKGHFSEREAVKLIKTILGVVEACHSLGVMHRDLKPENFLFDSPKDDAKLKATDFGLSVF AtCPK4 (77) MHHLSEHPNVVRIKGTYEDSVFVHIVMEVCEGGELFDRIVSKGCFSEREAAKLIKTILGVVEACHSLGVMHRDLKPENFLFDSPSDDAKLKATDFGLSVF
OsCPK24 (99) MHHLSEHPNVVRIRGAYEDALFVHIVMELCAGGELFDRIVAKGHYTERAAAQLIRTIVAVVEGCHSLGVMHRDLKPENFLFASAAEDAPLKATDFGLSMF ZmCPK11 (96) MHHLSEHPNVVRIRGAYEDALFVHIVMELCAGGELFDRIVAKGHYSERAAAKLIKTIVGVVEGCHSLGVMHRDLKPENFLFASTAEEAPLKATDFGLSMF GmCDPKβ (76) MHHLSEHPNVVQIQGTYEDSVFVHLVMELCAGGELFDRIIQKGHYSEREA LIKTIVGVVEACHSLGVMHRDLKPENFLFDTPGEDAQMKATDFGLSVI RcCDPK1 (82) MHHLSEHPNVVQIKGTYEDSMFVHLVMELCAGGELFDRIVAKGQYSEKEAAKLIKTIVGVVEACHSLGVMHRDLKPENFLFDTPGDDAKLKATDFGLSVF
AtCPK11 (178) YKPGQYLYDVVGSPYYVAPEVLKKCYGPEIDVWSAGVILYILLSGVPPFWAETESGIFRQILQGKLDFKSDPWPTISEAAKDLIYKMLERSPKKRISAHE AtCPK4 (177) YKPGQYLYDVVGSPYYVAPEVLKKCYGPEIDVWSAGVILYILLSGVPPFWAETESGIFRQILQGKIDFKSDPWPTISEGAKDLIYKMLDRSPKKRISAHE
OsCPK24 (199) YKPGDKFSDVVGSPYYVAPEVLQKCYGPESDVWSAGVILYILLCGVPPFWAETEAGIFRQILRGKLDFESEPWPSISDSAKDLVRNMLCRDPTKRLTAHE ZmCPK11 (196) YKPGDKFSDVVGSPYYVAPEVLQKCYGPEADVWSAGVILYILLCGVPPFWAETEAGIFRQILRGKLDFESEPWPSISDSAKDLVCNMLTRDPKKRFSAHE GmCDPKβ (176) LQARQAFHDVVGSPYYVAPEVLCKQYGPEVDVWSAGVILYILLSGVPPFWAETEAGIFRQILNGDLDFVSEPWPSISENAKELVKQMLDRDPKKRISAHE RcCDPK1 (182) YKPGQYFSDVVGSPYYVAPEVLLKRYGPEVDVWSAGVILYILLSGVPPFWAETESGIFRHILQGKIDFESEPWPKISDSAKDLIKKMLERDPRQRISAHE
AtCPK11 (278) ALCHPWIVDEQAAPDKPLDPAVLSRLKQFSQMNKIKKMALRVIAERLSEEEIGGLKELFKMIDTDNSGTITFEELKAGLKRVGSELMESEIKSLMDAADI AtCPK4 (277) ALCHPWIVDEHAAPDKPLDPAVLSRLKQFSQMNKIKKMALRVIAERLSEEEIGGLKELFKMIDTDNSGTITFEELKAGLKRVGSELMESEIKSLMDAADI
OsCPK24 (299) VLCHPWIVDDAVAPDKPIDSAVLSRLKHFSAMNKLKKMALRVIAESLSEEEIGGLKELFKMIDTDDSGTITFDELKEGLKRVGSELTEHEIQALMEAADI ZmCPK11 (296) VLCHAWIVDDAVAPDKPIDSAVLSRLKHFSAMNKLKKMALRVIAESLSEEEIGGLKELFKMIDTDSSGTITFDELKDGLKRVGSELTENEIQALMEAADI GmCDPKβ (276) VLCNPWVVDD-IAPDKPLDSAVLTRLKHFSAMNKLKKMALRVIAERLSEEEIGGLKELFKMIDTDNSGTITFEELKEGLKSVGSNLMESEIKSLMEAADI RcCDPK1 (282) VLCHPWIVDDTVAPDKPLDSAVLSRLKKFSAMHKLKKMALRVIAERLSEEEIGGLKELFKMLDTDSSGTITFEELKEGLLRVGSELMECEIKALMEAADI
AtCPK11 (378) DNSGTIDYGEFLAATLHMNKMEREENLVAAFSYFDKDGSGYITIDELQSACTEFGLCDTPLDDMIKEIDLDNDGKIDFSEFTAMMRKGDG-VGRSRTMMK AtCPK4 (377) DNSGTIDYGEFLAATLHINKMEREENLVVAFSYFDKDGSGYITIDELQQACTEFGLCDTPLDDMIKEIDLDNDGKIDFSEFTAMMKKGDG-VGRSRTMRN
OsCPK24 (399) DNSGTIDYGEFIAATLHMNKLEREENLVSAFSFFDKDGSGFITIDELSQACREFGLDDLHLEDMIKDVDQNNDGQIDYSEFTAMMRKGNAGGAGRRTMRN ZmCPK11 (396) DNSGTIDYGEFIAATLHMNKLEREENLVSAFSFFDKDGSGFITIDELSQACREFGLDDLHLEDMIKDVDQNNDGQIDYSEFTAMMRKGNAGATGRRTMRN GmCDPKβ (375) DNNGSIDYGEFLAATLHLNKMEREENLVAAFAYFDKDGSGYITIDELQQACKDFSLGDVHLDEMIKEIDQDNDGRIDYAEFAAMMKKGDPNMGRSRTMKG RcCDPK1 (382) DNSGTIDYGEFLAATLHLNKMEREENLLAAFSYFDKDGSGYITVDELQQACKDFGLDDVHLDEMIKEIDEDNDGRIDYAEFTSMMRKGDEDIGRSRTMRS
AtCPK11 (477) NLNFNIADAFGVDGE----KSDD--- AtCPK4 (476) NLNFNIAEAFGVEDTSSTAKSDDSPK OsCPK24 (499) SLQLNLGEILNPSNS----------- ZmCPK11 (496) SLHLNLGELLNPSKT----------- GmCDPKβ (475) NLNFNIADAFGMKDSS---------- RcCDPK1 (482) HLNFNLADALGVKDLN----------
Mr (kD) Identity (%)55.9 8456.4 83 56.6 7956.6 7855.2 84 56.0 100
NH2 COOH1 30 288 331 472 495
Kinase Domain AIJ
NTVD
Ca2+-binding (EF hand)
Domain CTVD
RcCDPK1
∆
EF Hand
EF Hand
EF Hand EF Hand
AUTO-INHIBITORY JUNCTION CALMODULIN-LIKE DOMAIN
KINASE DOMAIN
N-TERMINAL VARIABLE DOMAIN
C-TERMINAL VARIABLE DOMAIN
FIGURE 1
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 41: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/41.jpg)
0
1
2
3
4
5
6
7
8
9
Rela
tive
Tran
scrip
t Lev
el
E dE C dC BudExp Mat E C H RM RT MF Int PDeveloping
SeedLeaf Germinating
SeedlingFlower
A
B
0
1
2
3
Ⅲ Ⅴ Ⅶ Ⅸ
RcCDPK1 BTPC
Castor Bean Developmental StageDry
n.d. n.d.Rela
tive
Tran
scrip
t Lev
el
FIGURE 2
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 42: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/42.jpg)
250150
100
75
25
37
50
A BHis6-RcCDPK1 His6-∆N-RcCDPK1+Ca2+ M +Ca2+-Ca2+ -Ca2+
60
M
25015010075
25
37
5060
20
His 6-RcCDPK1
His 6-∆N
-RcCDPK1
RcCDPK1
COS BTPC-K
(final p
rep)
COS Phenyl
Sepharose Eluate
kD kD
FIGURE 3
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 43: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/43.jpg)
Ca2+: + − + − + − + − + −RcCDPK1 AtCPK4 GmCDPK-βAtCPK34ΔN-RcCDPK1
Anti-pSer451p118
Anti-BTPCp118
[PEP] (mM) 0 1.0 2.5 5.0
p118
p118
Anti-pSer451
Anti-BTPC
A
B
Anti-pSer451
Anti-BTPC
Col-0 atcpk11
p118
p118
Ca2+: + − +
C
FIGURE 4
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 44: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/44.jpg)
150
100
50
75
37
25
Class-2
PEPC (W
T)
Class-2
PEPC (S
451D
)Hist
one Ⅲ
-SCOS C
lass-1
PEPC
RcSUS1
SDS/PAGECBB-250
SDS/PAGEPhosphorimager
B
A
p118 (BTPC)p107 (PTPC)
p118 (BTPC) 150
100
50
75
37
25
p93 (RcSUS1)
kD
FIGURE 5
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 45: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/45.jpg)
p118
RcCDPK1 ΔN-RcCDPK1
Incorporationof 32P (cpm): 720 1188 2392 4771 6950 - - - 122 333
Amount of kinase (ng): 62.5 125 250 500 1000 62.5 125 250 500 1000
A
Ca2+: + − + − RcCDPK1 ΔN-RcCDPK1
60kD
Incorporationof 32P (cpm): 1170 658 175 213
B
FIGURE 6
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 46: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/46.jpg)
0
500
1000
1500
2000
2500
3000
3500
Fluo
resc
ence
(IAU
)
CaM81
1 µM CaCl2
10 µM CaCl2
0
100
200
300
400
500
600
700
Fluo
resc
ence
(IAU
)
RcCDPK11 mM EDTA + 1mM EGTA
1 mM MgCl2
1 mM CaCl2
10 mM MgCl2 + 1 mM CaCl2
CaCl2added to EGTA wells
Wavelength (nm)430 455 480 505 530 555 580
50 µM CaCl2
ANS alone
1 mM CaCl2
B
-15
-10
-5
0
5
10
15
180 190 200 210 220 230 240 250 260
Mill
ideg
rees
(deg
10-3
cm
2 dm
ol-1)
Wavelength (nm)
C
Tris, 1 mM CaCl2
Tris, 2.5 mM CaCl2
Tris, 0.5 mM EGTA
Hepes, 1 mM CaCl2
AFIGURE 7
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 47: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/47.jpg)
A
EYFP
EYFPp40
p541 325 446
1EYFPp64
447 467 1052
329
RcCDPK11 495
mCherry
∆N-RcCDPK130 495
mCherry
p1181 1052325 467
EYFP
B C DRcCDPK1-Cherry DIC DN-RcCDPK1-Cherry DIC Cherry DIC
ERcCDPK1-Cherry p118-EYFP merge
FDN-RcCDPK1-Cherry p118-EYFP merge
GRcCDPK1-Cherry p54-EYFP
HRcCDPK1-Cherry p64-EYFP
IRcCDPK1-Cherry p40-EYFP
FIGURE 8
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 48: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/48.jpg)
Anti-PTPC
GST
GST-RcC
DPK1 GST-R
cCDPK1
GST-ΔN-R
cCDPK1
GST-RcC
DPK1
GST-ΔN-R
cCDPK1
+ + − + − +
Anti-BTPC p118 (BTPC)
p107 (PTPC)
A
B
Class-2 PEPC
Class-1PEPC
kD
p118 (BTPC)p107 (PTPC)
250-150-100-75-
50-
37-
25-
20-
MCa2+:
FIGURE 9
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 49: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/49.jpg)
Parsed CitationsAlmadanim MC, Alexandre BM, Rosa MTG, Sapeta H, Leitão AE, Ramalho JC, Lam TT, Negrão S, Abreu IA, Oliveira MM (2017) Ricecalcium-dependent protein kinase OsCPK17 targets plasma membrane intrinsic protein and sucrose phosphate synthase and isrequired for a proper cold stress response. Plant Cell Environ. doi: 10.1111/pce.12916
Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
Asai S, Ichikawa T, Nomura H, Kobayashi M, Kamiyoshihara Y, Mori H, Kadota Y, Zipfel C, Jones JDG, Yoshioka H (2013) Thevariable domain of a plant calcium-dependent protein kinase (CDPK) confers subcellular localization and substrate recognition forNADPH oxidase. J Biol Chem 288: 14332-14340
Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
Bachmann M, Shiraishi N, Campbell WH, Yoo BC, Harmon AC, Huber SC (1996) Identification of Ser-543 as the major regulatoryphosphorylation site in spinach leaf nitrate reductase. Plant Cell 8: 505-517
Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
Bender KW, Dobney S, Ogunrinde A, Chiasson D, Mullen RT, Teresinski HJ, Singh P, Munro K, Smith SP, Snedden WA (2014) Thecalmodulin-like protein CML43 functions as a salicylic-acid-inducible root-specific Ca2+ sensor in Arabidopsis. Biochem J 457: 127-136
Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
Blonde JD, Plaxton WC (2003) Structural and kinetic properties of high and low molecular mass phosphoenolpyruvate carboxylaseisoforms from the endosperm of developing castor oilseeds. J Biol Chem 278: 11867-11873
Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
Boudsocq M, Droillard M-J, Regad L, Lauriere C (2012) Characterization of Arabidopsis calcium-dependent protein kinases:activated or not by calcium? Biochem J 447: 291-299
Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
Boudsocq M, Sheen J (2013) CDPKs in immune and stress signaling. Trends Plant Sci 18: 30-40Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
Brandizzi F, Irons S, Kearns A, Hawes C (2003) BY-2 cells: culture and transformation for live cell imaging. Curr Protoc Cell Biol 1-7Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
Choi HI, Park HJ, Park JH, Kim S, Im MY, Seo HH, Kim YW, Hwang I, Kim SY (2005) Arabidopsis calcium-dependent protein kinaseAtCPK32 interacts with ABF4, a transcriptional regulator of abscisic acid-responsive gene expression, and modulates its activity.Plant Physiol 139: 1750-1761
Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
Dalziel KJ, O'Leary B, Brikis C, Rao SK, She Y-M, Cyr T, Plaxton WC (2012) The bacterial-type phosphoenolpyruvate carboxylaseisozyme from developing castor oil seeds is subject to in vivo regulatory phosphorylation at serine-451. FEBS Lett 586: 1049-1054
Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
Dammann C, Ichida A, Hong BM, Romanowsky SM, Hrabak EM, Harmon AC, Pickard BG, Harper JF (2003) Subcellular targeting ofnine calcium-dependent protein kinase isoforms from Arabidopsis. Plant Physiol 132: 1840-1848
Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
DeFalco TA, Bender KW, Snedden WA (2010) Breaking the code: Ca2+ sensors in plant signalling. Biochem J 425: 27-40Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
Douglas P, Moorhead G, Hong Y, Morrice N, MacKintosh C (1998) Purification of a nitrate reductase kinase from Spinaceaoleracea leaves, and its identification as a calmodulin-domain protein kinase. Planta 206: 435-442
Pubmed: Author and TitleCrossRef: Author and Title
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 50: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/50.jpg)
Google Scholar: Author Only Title Only Author and Title
Dunker AK, Cortese MS, Romero P, Iakoucheva LM, Uversky VN (2005) Flexible nets - the roles of intrinsic disorder in proteininteraction networks. FEBS J 272: 5129-5148
Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
Endicott JA, Noble MEM, Johnson LN (2012) The structural basis for control of eukaryotic protein kinases. Annu Rev Biochem 81:587-613
Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
Fedosejevs ET, Gerdis SA, Ying S, Pyc M, Anderson EM, Snedden WA, Mullen RT, She Y-M, Plaxton WC (2016) The calcium-dependent protein kinase RcCDPK2 phosphorylates sucrose synthase at Ser11 in developing castor oil seeds. Biochem J 473:3667-3682
Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
Fedosejevs ET, Ying S, Park J, Anderson EM, Mullen RT, She Y-M, Plaxton WC (2014) Biochemical and molecular characterizationof RcSUS1, a cytosolic sucrose synthase phosphorylated in vivo at serine 11 in developing castor oil seeds. J Biol Chem 289:33412-33424
Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
Gennidakis S, Rao S, Greenham K, Uhrig RG, O'Leary B, Snedden WA, Lu C, Plaxton WC (2007) Bacterial- and plant-typephosphoenolpyruvate carboxylase polypeptides interact in the hetero-oligomeric Class-2 PEPC complex of developing castor oilseeds. Plant J 52: 839-849
Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
Harmon A, Putnam-Evans C, Cormier M (1987) A calcium-dependent but calmodulin-independent protein kinase from soybean.Plant Physiol 83: 830-837
Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
Harper JE, Breton G, Harmon A (2004) Decoding Ca2+ signals through plant protein kinases. Annu Rev Plant Biol 55: 263-288Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
Hill AT, Ying S, Plaxton WC (2014) Phosphorylation of bacterial-type phosphoenolpyruvate carboxylase by a Ca2+-dependentprotein kinase suggests a link between Ca2+ signalling and anaplerotic pathway control in developing castor oil seeds. Biochem J458: 109-118
Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
Igawa T, Fujiwara M, Tanaka I, Fukao Y, Yanagawa Y (2010) Characterization of bacterial-type phosphoenolpyruvate carboxylaseexpressed in male gametophyte of higher plants. BMC Plant Biol 10: 200-200
Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
Ito T, Nakata M, Fukazawa J, Ishida S, Takahashi Y (2010) Alteration of substrate specificity: the variable N-terminal domain oftobacco Ca2+-dependent protein kinase is important for substrate recognition. Plant Cell 22: 1592-1604
Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
Kobayashi M, Ohura I, Kawakita K, Yokota N, Fujiwara M, Shimamoto K, Doke N, Yoshioka H (2007) Calcium-dependent proteinkinases regulate the production of reactive oxygen species by potato NADPH oxidase. Plant Cell 19: 1065-1080
Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
Liese A, Romeis T (2013) Biochemical regulation of in vivo function of plant calcium-dependent protein kinases (CDPK). BiochimBiophys Acta 1833: 1582-1589
Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
Livak KJ, Schmittgen TD (2001) Analysis of relative gene expression data using real-time quantitative PCR and the 2(T)(-DeltaDelta C) method. Methods 25: 402-408
Pubmed: Author and Title www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from
Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 51: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/51.jpg)
CrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
Martin ML, Busconi L (2000) Membrane localization of a rice calcium-dependent protein kinase (CDPK) is mediated bymyristoylation and palmitoylation. Plant J 24: 429-435
Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
Milla MAR, Uno Y, Chang IF, Townsend J, Maher EA, Quilici D, Cushman JC (2006) A novel yeast two-hybrid approach to identifyCDPK substrates: Characterization of the interaction between AtCPK11 and AtDi19, a nuclear zinc finger protein. FEBS Lett 580:904-911
Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
O'Leary B, Fedosejevs ET, Hill AT, Bettridge J, Park J, Rao SK, Leach CA, Plaxton WC (2011a) Tissue-specific expression andpost-translational modifications of plant- and bacterial-type phosphoenolpyruvate carboxylase isozymes of the castor oil plant,Ricinus communis L. J Exp Bot 62: 5485-5495
Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
O'Leary B, Park J, Plaxton WC (2011b) The remarkable diversity of plant PEPC (phosphoenolpyruvate carboxylase): recentinsights into the physiological functions and post-translational controls of non-photosynthetic PEPCs. Biochem J 436: 15-34
Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
O'Leary B, Rao SK, Kim J, Plaxton WC (2009) Bacterial-type phosphoenolpyruvate carboxylase (PEPC) functions as a catalytic andregulatory subunit of the novel Class-2 PEPC complex of vascular plants. J Biol Chem 284: 24797-24805
Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
O'Leary B, Rao SK, Plaxton WC (2011c) Phosphorylation of bacterial-type phosphoenolpyruvate carboxylase at Ser(425) provides afurther tier of enzyme control in developing castor oil seeds. Biochem J 433: 65-74
Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
Park J, Khuu N, Howard ASM, Mullen RT, Plaxton WC (2012) Bacterial- and plant-type phosphoenolpyruvate carboxylase isozymesfrom developing castor oil seeds interact in vivo and associate with the surface of mitochondria. Plant J 71: 251-262
Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
Pical C, Fredlund K, Petit P, Sommarin M, Moller I (1993) The outer-membrane of plant mitochondria contains a calcium-dependentprotein-kinase and multiple phosphoproteins. FEBS Letts 336: 347-351
Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
Rivoal J, Trzos S, Gage DA, Plaxton WC, Turpin DH (2001) Two unrelated phosphoenolpyruvate carboxylase polypeptidesphysically interact in the high molecular mass isoforms of this enzyme in the unicellular green alga Selenastrum minutum. J BiolChem 276: 12588-12597
Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
Ruiz-Ballesta I, Baena G, Gandullo J, Wang L, She Y-M, Plaxton WC, Echevarría C (2016) New insights into the post-translationalmodification of multiple phosphoenolpyruvate carboxylase isoenzymes by phosphorylation and monoubiquitination duringsorghum seed development and germination. J Exp Bot 67: 3523-3536
Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
Ruiz-Ballesta I, Feria A-B, Ni H, She Y-M, Plaxton WC, Echevarra C (2014) In vivo monoubiquitination of anapleroticphosphoenolpyruvate carboxylase occurs at Lys624 in germinating sorghum seeds. J Exp Bot 65: 443-451
Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
Schulz P, Herde M, Romeis T (2013) Calcium-dependent protein kinases: hubs in plant stress signaling and development. PlantPhysiol 163: 523-530
Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
Simeunovic A, Mair A, Wurzinger B, Teige M (2016) Know where your clients are: subcellular localization and targets of calcium- www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from
Copyright © 2017 American Society of Plant Biologists. All rights reserved.
![Page 52: Regulatory Phosphorylation of Bacterial-type PEP ......2017/03/31 · 35 R.T.M., and W.C.P.), as well as the Queen’s and Guelph Research Chair programs (to 36 W.C.P. and R.T.M)](https://reader034.vdocuments.us/reader034/viewer/2022042305/5ed08f6619a79473140ad810/html5/thumbnails/52.jpg)
dependent protein kinases. J Exp Bot 67: 3855-3872Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
Taylor SS, Kornev AP (2011) Protein kinases: evolution of dynamic regulatory proteins. Trends Biochem Sci 36: 65-77Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
Tripodi KE, Turner WL, Gennidakis S, Plaxton WC (2005) In vivo regulatory phosphorylation of novel phosphoenolpyruvatecarboxylase isoforms in endosperm of developing castor oil seeds. Plant Physiol 139: 969-978
Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
Tzfira T, Tian G-W, Lacroix B, Vyas S, Li J, Leitner-Dagan Y, Krichevsky A, Taylor T, Vainstein A, Citovsky V (2005) pSAT vectors: amodular series of plasmids for autofluorescent protein tagging and expression of multiple genes in plants. Plant Mol Biol 57: 503-516
Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
Uhrig RG, O'Leary B, Spang HE, MacDonald JA, She YM, Plaxton WC (2008a) Coimmunopurification of phosphorylated bacterial-and plant-type phosphoenolpyruvate carboxylases with the plastidial pyruvate dehydrogenase complex from developing castor oilseeds. Plant Physiol 146: 1346-1357
Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
Uhrig RG, She YM, Leach CA, Plaxton WC (2008b) Regulatory monoubiquitination of phosphoenolpyruvate carboxylase ingerminating castor oil seeds. J Biol Chem 283: 29650-29657
Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
Winter H, Huber SC (2000) Regulation of sucrose metabolism in higher plants: localization and regulation of activity of keyenzymes. Crit Rev Plant Sci 19: 31-67
Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
Witte C-P, Keinath N, Dubiella U, Demouliere R, Seal A, Romeis T (2010) Tobacco calcium-dependent protein kinases aredifferentially phosphorylated in vivo as part of a kinase cascade that regulates stress response. J Biol Chem 285: 9740-9748
Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
Zhang M, Tanaka T, Ikura M (1995) Calcium-induced conformational transition revealed by the solution structure of apo calmodulin.Nat Struct Biol 2: 758-767
Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
Zhang XQ, Lund AA, Sarath G, Cerny RL, Roberts DM, Chollet R (1999) Soybean nodule sucrose synthase (Nodulin-100): Furtheranalysis of its phosphorylation using recombinant and authentic root-nodule enzymes. Arch Biochem Biophys 371: 70-82
Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
Zhu S-Y, Yu X-C, Wang X-J, Zhao R, Li Y, Fan R-C, Shang Y, Du S-Y, Wang X-F, Wu F-Q, et al (2007) Two calcium-dependent proteinkinases, CPK4 and CPK11, regulate abscisic acid signal transduction in Arabidopsis. Plant Cell 19: 3019-3036
Pubmed: Author and TitleCrossRef: Author and TitleGoogle Scholar: Author Only Title Only Author and Title
www.plantphysiol.orgon May 28, 2020 - Published by Downloaded from Copyright © 2017 American Society of Plant Biologists. All rights reserved.