phylogenetic relationships amongst hev strains participants: agnes zotter lambert motilal maria...
TRANSCRIPT
![Page 1: Phylogenetic relationships amongst HEV strains Participants: Agnes Zotter Lambert Motilal Maria Montalvo Marissa Moses Robin Antoine](https://reader035.vdocuments.us/reader035/viewer/2022062714/56649d025503460f949d572f/html5/thumbnails/1.jpg)
Phylogenetic relationships amongst HEV strains
Participants:•Agnes Zotter•Lambert Motilal•Maria Montalvo•Marissa Moses•Robin Antoine
![Page 2: Phylogenetic relationships amongst HEV strains Participants: Agnes Zotter Lambert Motilal Maria Montalvo Marissa Moses Robin Antoine](https://reader035.vdocuments.us/reader035/viewer/2022062714/56649d025503460f949d572f/html5/thumbnails/2.jpg)
Hepatitis E Virus• Hepeviridae, Hepevirus genus• Unenveloped RNA virus, 27-34nm in diameter• +ve stranded RNA genome, 7.2 kb in size• Very labile and sensitive
UWI, St. Augustine, Trinidad & Tobago, 29.01.2010.
![Page 3: Phylogenetic relationships amongst HEV strains Participants: Agnes Zotter Lambert Motilal Maria Montalvo Marissa Moses Robin Antoine](https://reader035.vdocuments.us/reader035/viewer/2022062714/56649d025503460f949d572f/html5/thumbnails/3.jpg)
Most outbreaks associated with faeceally contaminated drinking water.
Large epidemics have occurred in the Indian subcontinent, USSR, China, Africa and Mexico.
In the United States and other non-endemic areas, where there are no documented outbreaks of hepatitis E, a low prevalence of anti-HEV (<2%) has been found in healthy populations. The source of infection for these persons is unknown.
Minimal person-to-person transmission.
Hepatitis E - Epidemiologic
Features
UWI, St. Augustine, Trinidad & Tobago, 29.01.2010.
![Page 4: Phylogenetic relationships amongst HEV strains Participants: Agnes Zotter Lambert Motilal Maria Montalvo Marissa Moses Robin Antoine](https://reader035.vdocuments.us/reader035/viewer/2022062714/56649d025503460f949d572f/html5/thumbnails/4.jpg)
Incubation period: Average 40 days
Range 15-60 days Case-fatality rate: Overall, 1%-3%
Pregnant women, 15%-25%
Illness severity: Increased with age
Chronic sequelae: None identified
Hepatitis E - Clinical Features
UWI, St. Augustine, Trinidad & Tobago, 29.01.2010.
![Page 5: Phylogenetic relationships amongst HEV strains Participants: Agnes Zotter Lambert Motilal Maria Montalvo Marissa Moses Robin Antoine](https://reader035.vdocuments.us/reader035/viewer/2022062714/56649d025503460f949d572f/html5/thumbnails/5.jpg)
UWI, St. Augustine, Trinidad & Tobago, 29.01.2010.
![Page 6: Phylogenetic relationships amongst HEV strains Participants: Agnes Zotter Lambert Motilal Maria Montalvo Marissa Moses Robin Antoine](https://reader035.vdocuments.us/reader035/viewer/2022062714/56649d025503460f949d572f/html5/thumbnails/6.jpg)
HEV isolates have been grouped into four genotypes (1 to 4)
•Genotype 1 groups isolates found mainly in Asia and Africa
•Genotype 2 contains an isolate from an outbreak in Mexico and Africa
•Genotype 3 groups isolates found in the US & Europe
•Genotype 4 groups isolates found in China, Taiwan and Japan
UWI, St. Augustine, Trinidad & Tobago, 29.01.2010.
Hepatitis E Virus Genome
![Page 7: Phylogenetic relationships amongst HEV strains Participants: Agnes Zotter Lambert Motilal Maria Montalvo Marissa Moses Robin Antoine](https://reader035.vdocuments.us/reader035/viewer/2022062714/56649d025503460f949d572f/html5/thumbnails/7.jpg)
Research question
UWI, St. Augustine, Trinidad & Tobago, 29.01.2010.
To determine the genotype identity of isolates found in Cuba
Possible ways of managing the disease
![Page 8: Phylogenetic relationships amongst HEV strains Participants: Agnes Zotter Lambert Motilal Maria Montalvo Marissa Moses Robin Antoine](https://reader035.vdocuments.us/reader035/viewer/2022062714/56649d025503460f949d572f/html5/thumbnails/8.jpg)
Methods:
UWI, St. Augustine, Trinidad & Tobago, 29.01.2010.
Sequences from RNA polymerase in GenBanK (NCBI)
13 hits
CUB9-1999 isolate chosen (241 bp linear RNA)Blastn: 30 entries chosen/E-value
Length +/- 10 nucleotides alignment
![Page 9: Phylogenetic relationships amongst HEV strains Participants: Agnes Zotter Lambert Motilal Maria Montalvo Marissa Moses Robin Antoine](https://reader035.vdocuments.us/reader035/viewer/2022062714/56649d025503460f949d572f/html5/thumbnails/9.jpg)
![Page 10: Phylogenetic relationships amongst HEV strains Participants: Agnes Zotter Lambert Motilal Maria Montalvo Marissa Moses Robin Antoine](https://reader035.vdocuments.us/reader035/viewer/2022062714/56649d025503460f949d572f/html5/thumbnails/10.jpg)
![Page 11: Phylogenetic relationships amongst HEV strains Participants: Agnes Zotter Lambert Motilal Maria Montalvo Marissa Moses Robin Antoine](https://reader035.vdocuments.us/reader035/viewer/2022062714/56649d025503460f949d572f/html5/thumbnails/11.jpg)
UWI, St. Augustine, Trinidad & Tobago, 29.01.2010.
Blastp Protein ID from initial selected isolate
ClustalX2 multiple alignmentAnalysis in Phylogenetic software
>gb|ACD39863.1| RNA-dependent RNA polymerase [Hepatitis E virus] Length=116
Score = 133 bits (334), Expect = 6e-37, Method: Compositional matrix adjust. Identities = 61/79 (77%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
Query 1 CALFGPWFRAIEKAILALLPQGVFYGDAFDDTVFSATVAAAKASMVFENDFSEFDSTQNN 60 CALFGPWFRAIEK ILALLP +FYGDA++++VFSA ++ A +SMVFENDFSE ST NN Sbjct 9 CALFGPWFRAIEKE ILALLPPN IFYGDAYEES VFSAAISGAGSSMVFENDFSEDXSTLNN 68
Query 61 FSLGLECAIMEECGMPQWL 79 FSLGLEC IMEECGMPQWL Sbjct 69 FSLGLECVIMEECGMPQWL 87
![Page 12: Phylogenetic relationships amongst HEV strains Participants: Agnes Zotter Lambert Motilal Maria Montalvo Marissa Moses Robin Antoine](https://reader035.vdocuments.us/reader035/viewer/2022062714/56649d025503460f949d572f/html5/thumbnails/12.jpg)
Protein alignment (MSA):
UWI, St. Augustine, Trinidad & Tobago, 29.01.2010.
![Page 13: Phylogenetic relationships amongst HEV strains Participants: Agnes Zotter Lambert Motilal Maria Montalvo Marissa Moses Robin Antoine](https://reader035.vdocuments.us/reader035/viewer/2022062714/56649d025503460f949d572f/html5/thumbnails/13.jpg)
Results:
UWI, St. Augustine, Trinidad & Tobago, 29.01.2010.
R
Nucleic Acids Research 2005 33(Web Server Issue):W553-W556; doi:10.1093/nar/gki494 . C-Y Lin*, F-K Lin, CH Lin, L-W Lai, H-J Hsu, S-H Chen and CA Hsiung
http://power.nhri.org.tw/
![Page 14: Phylogenetic relationships amongst HEV strains Participants: Agnes Zotter Lambert Motilal Maria Montalvo Marissa Moses Robin Antoine](https://reader035.vdocuments.us/reader035/viewer/2022062714/56649d025503460f949d572f/html5/thumbnails/14.jpg)
UWI, St. Augustine, Trinidad & Tobago, 29.01.2010.
Genotype 1
Genotype 3
Genotype 4
Genotype 2
DNA data
NJ analysis
Phylogenetic tree:
![Page 15: Phylogenetic relationships amongst HEV strains Participants: Agnes Zotter Lambert Motilal Maria Montalvo Marissa Moses Robin Antoine](https://reader035.vdocuments.us/reader035/viewer/2022062714/56649d025503460f949d572f/html5/thumbnails/15.jpg)
Protein Seq.data
NJ analysis
UWI, St. Augustine, Trinidad & Tobago, 29.01.2010.
Phylogenetic tree
![Page 16: Phylogenetic relationships amongst HEV strains Participants: Agnes Zotter Lambert Motilal Maria Montalvo Marissa Moses Robin Antoine](https://reader035.vdocuments.us/reader035/viewer/2022062714/56649d025503460f949d572f/html5/thumbnails/16.jpg)
UWI, St. Augustine, Trinidad & Tobago, 29.01.2010.
Phylogenetic tree: Phylip with DNA data JAP291
Cub25_08 Mex017
Fin969Fin973
Ind LonInd097
Mor494 Chn001
Chn363
Ind103
Chn457Hyder Cub19_99
Cub9_99NindCub2_05
Cub27_99Cub10_99
Fin971Fin967
US2SKor476
US1SKor466Fr757
Fr719Fr767
Fr787Fr785
![Page 17: Phylogenetic relationships amongst HEV strains Participants: Agnes Zotter Lambert Motilal Maria Montalvo Marissa Moses Robin Antoine](https://reader035.vdocuments.us/reader035/viewer/2022062714/56649d025503460f949d572f/html5/thumbnails/17.jpg)
Phylogenetic tree: Phylip/protein data
UWI, St. Augustine, Trinidad & Tobago, 29.01.2010.
![Page 18: Phylogenetic relationships amongst HEV strains Participants: Agnes Zotter Lambert Motilal Maria Montalvo Marissa Moses Robin Antoine](https://reader035.vdocuments.us/reader035/viewer/2022062714/56649d025503460f949d572f/html5/thumbnails/18.jpg)
UWI, St. Augustine, Trinidad & Tobago, 29.01.2010.
DNA Alignment without Cub25-2008
![Page 19: Phylogenetic relationships amongst HEV strains Participants: Agnes Zotter Lambert Motilal Maria Montalvo Marissa Moses Robin Antoine](https://reader035.vdocuments.us/reader035/viewer/2022062714/56649d025503460f949d572f/html5/thumbnails/19.jpg)
UWI, St. Augustine, Trinidad & Tobago, 29.01.2010.
Phylogenetic tree:
MEGA4/DNA data
Genotype 1
Genotype 2
Genotype 3
Genotype 4
![Page 20: Phylogenetic relationships amongst HEV strains Participants: Agnes Zotter Lambert Motilal Maria Montalvo Marissa Moses Robin Antoine](https://reader035.vdocuments.us/reader035/viewer/2022062714/56649d025503460f949d572f/html5/thumbnails/20.jpg)
Phylogenetic tree: MEGA/protein data
UWI, St. Augustine, Trinidad & Tobago, 29.01.2010.
Genotype 1
Genotype 2
Genotype 3
Genotype 4
![Page 21: Phylogenetic relationships amongst HEV strains Participants: Agnes Zotter Lambert Motilal Maria Montalvo Marissa Moses Robin Antoine](https://reader035.vdocuments.us/reader035/viewer/2022062714/56649d025503460f949d572f/html5/thumbnails/21.jpg)
HEV from human in Cuba were clustered in at least two genotypes.
Conclusion
UWI, St. Augustine, Trinidad & Tobago, 29.01.2010.
Genotype 1 with Asian and African isolates
Genotype 3 with American and European isolates from swine and human
![Page 22: Phylogenetic relationships amongst HEV strains Participants: Agnes Zotter Lambert Motilal Maria Montalvo Marissa Moses Robin Antoine](https://reader035.vdocuments.us/reader035/viewer/2022062714/56649d025503460f949d572f/html5/thumbnails/22.jpg)
A take-home message…
Avoid drinking water (and beverages with ice) of unknown purity, uncooked shellfish, and uncooked fruit/vegetables not peeled or prepared by traveler.
IG prepared from donors in Western countries does not prevent infection.
Unknown efficacy of IG prepared from donors in endemic areas.
Vaccine?
UWI, St. Augustine, Trinidad & Tobago, 29.01.2010.
![Page 23: Phylogenetic relationships amongst HEV strains Participants: Agnes Zotter Lambert Motilal Maria Montalvo Marissa Moses Robin Antoine](https://reader035.vdocuments.us/reader035/viewer/2022062714/56649d025503460f949d572f/html5/thumbnails/23.jpg)
Thank you for your attention!
UWI, St. Augustine, Trinidad & Tobago, 29.01.2010.
Special thanks for the great teachers, who were very patient and helpful, who helped us to make this presentation better…
Dr. Urmila Kulkarni-Kale Dr. Jessica Kissinger Dr. Dinesh Gupta Dr. Arnab Pain
Dr. Vrijesh Tripathi