office of chemical safety and pollution prevention …€¦ · office of chemical safety and...

UNITED STATES ENVIRONMENTAL PROTECTION AGENCY

WASHINGTON, D.C. 20460

. DEC 28 310

OFFICE OF CHEMICAL SAFETY ANDPOLLUTION PREVENTION

Joseph Burley PhD, Registration ManagerSipcam Agro USA,, INC2520 Meredian Parkway, Suite 525Durham, NC 27713

Dear: Dr.Burley

Subject: Stalwart! XtraRemove; December 31,2010 Expiration Date for Sweet CornEPA Registration Number 60063-23Application Date: December 27, 2010

!

The labeling referred to: above, submitted in connection with registration under the FederalInsecticide, Fungicide, and Rodenticide Act, as amended is acceptable.

A stamped copy of the accepted labeling is enclosed.

Submit one copy of the revised final printed supplemental label for the record before thelabel is released for use'.

incerely,

James TOT/ Product Mana|er 251 /Herbicide Branch

Registration Division (7505P)

r

Due to ground andpersoris'under their i

RESTRICTED USE PESTICIDEwater concerns. For retail sale to and use only by certified applicators or

direct supervision, and'only for'ihose uses covered by the Certified Applicator'sCertification.

surface

CONTROL IN CO&N {ALL TYPES). , ».. .,.._ , ^ -- -. . ... .. ...; _. -y .. /

Active Ingredient:Atrazine (2-ehlonAtrazine RelatedMetolachlor:

acetamideOther Ingredients:

Total:

Cino-6-isSpropy;lariiiho^s^tria^ifie) •. 33.0%

:6mpounds ...'... : 0.7%:)^N^(2^metho?^Tl-methyiethyl)

..;............. '. 26.1%

...:..,.; 40.2%....:. ;: .......„........;.. 10020%

This product containsmetoiachlor active i

|3.1 Ibs. atrazine + related compounds per gallon and 2.4 Ibs. of^re'idilenlpef gallon. -^

KEEP O*J^OF REACH OF OMlsIDREN

See add^tional^precautionary statements and directions for use inside booklet.

Net Contents: 2.5 GaiU>iis (9:46€itefs) EPA Reg: No. 60063-23EPA Est. No. 70989-MO-l

Sipcam Agro USA, Inc.2520 Meridian Parkway, Suite 525

Durham, NC 27713 DEC 28

registered underEPA Reg. No.

Stalwart Xtra

. cPage 2

. . . . . . . . . . . . . . . i . . . " Fil&TAIE) . . . . . . . . . . ! . , .;JFS^ELX)WED j .

I

IF INHALED ji

i

IF ON SKIN OR |CLOTHING !

1

IF IN EYES ' j

i

ii

• Gall a poison control center or doctor immediately for treatmentadvice. j

• Have affected person sip a glass of water if able to swallow.• Do not induce vomiting unless told by a poisoh control center or doctor.• Do not give anytiHingjIp. mouth to an unconscious person.

-if - , .iSSf'-'W-SIT,' • i• Move person to fresh air.• If person is not Brealjung, call 911 or an ambul'ance, then give artificial. fespirationy preferably mouth to mouth>if;possible.• Gall a poison control center of doctor for further treatment advice.• Take off contaminated clothing. i• Rinse skm'immlsdiaMy wiM-plenty of water for 15-20 minutes.• Call a poison; contrgLcenter or doctor for treatment advice.• Hold eye open and rinse slowly and gently with water for 15-20

minutes. ' ^ " ' • - . • - i . ' • i• Remove contact lenses, if present, after the first 5 minutes, then

continue rinsing eye.• Call a poison control center or doctor for treatment jadvice:

HaVe the product container of ilBM'with'yoWwrien calling a poison' control-Center or doctor, or*gbing for treatment, jlEihergencyfl(^-numl$ers '' - ' (8(J6)'l24^60^(SHEKltKE€ (fanspdrtatib^and spills}

•'." (800) 900-4044 Poison Control Center (human health)•i;,.-_^L. j (8PQ). 345-4735 ASPCA (animal heal|h)JNbf&fb Physician: If ingested, induce erriesis or lavage stomach. Administration of an aqueousslurry of activated charcoal can be considered. Treat symptomatically. 1

~ *• • • ' * • * • " • • - ' . • • - - . • . : • - - - > : - • - •

Hazards to Humans and Domestic Animals jCAUTION: Harmful if swallowed, inhaled, or absorbed through skin, j Do not breathe vaporsor spray mist. Avoid contalstl-yvitih" eyes,;skirM of (dotruiig,: Gausgs moderate eye irritation.Prolonged or frequently skin contact may eause allergic reactions in some individuals.

PERSDiSFALTOCif tCTtVE EQCJIPlVifeNTSome materials!that are, chemical-resistant to this product are barrier laminate or butyl rubber or

— ---- . . ' • . • • • ^ ...... '• •" .1 •' ' ' " ' '' . ' ' r ' '•":"-" ' • - ' ; ' ' ' ." . - .1 - ' • , ' " • • 'nitfile rubber of neoprefie rubber or pblyvinyl chloride (PVC) or viton. If you want more options,f ollow the, instruetipfisif of Category H on an EPA chemical- resistance category selfectipn chart.

• ' ' . - ' ' ' ' . • [ • - • 1Mixers, loaders, applicators, flaggers, and other handlers must wear: j

• Coveralls over Lonlg-sleeved shirt and long pants, |• Chemical-resistant! gloves, such as barrier laminate or butyl rubber or nitrile rubber or neoprenerubber of. polyvinyrGrilpride (PVC) or viton i

• • Chemical-resistant'footwear plus socks, j• Ghemical-resistantjhe^dgear (if overhead exposure), and j• A chemicai-resistant apron, when mixing/ loading, cleaning up spills, or! cleaning equipment, or

^ tKe concentrate. ;'

tS-s^&jS?; v^- ,", • >^.:.-Ji;''ti.&' •<• iSee Engitteefing?Cofttr6ls for additional requirements.

Stalwart Xtrac

PageSVuc

User Safety Requirements: Follow manufacturer's instructions for cleaning/ mainlining PPEv'Hnbsuch instructions for washables exist; use detergent and hot water. Keep and wash'PPE^eparatelyfromTother laundry. Discard clothing and other absorbent materials that have been^drenched'orhe_ayilyj contaminated with.this product's concentrate. Do not reuse them.

I ENGINEERING CONTROLSMixers and loaders supporting aerial applications must use a closed system that meets therequirements for dermal1 protection listed in the Worker Protection Standard (WPS) for AgriculturalPesticides [40 CFR 17o'.240(d)(4)] and must: ' '. '"

! i• Wear the long-sleeved shirt arid long>panfe, chemical resistant 'gloves made of waterproofmaterials in eategoryjH, shoes and socks,• Wear protective eyewear if the system operates under pressure, and• Be provided and h!av,e immediately available for use in an emergency, such as a spill or

equipment bre'akdbwn: coveralls, chemical resistant footwear, and chemical resistant apron.

>Pilots must use an enclosed cockpit in -a manner that is consistent with the WPS for AgriculturalPesticides [40 CFR 170J.24Q (d)(6)]. Pilots must wear the PPE required on this labeling for applicators,however, they^need nojt wear chemical-resistant gloves when using an enclosed cockpit.

Flaggers 'supporting aerial applications must use an enclosed cab that meets the definition on theWorker Protection Standard for Agricultural Pesticides [40 CFR 170 240 (d)(5)] for dermal protection.In addition, flaggers

>••*.•. *Wear- the^pPEirequir&d /ontrusylabeling for flaggers.••j Be^fovideld^haye immediately available/ arufcuse in an emergency when they must exit the cab in

the treated area: I i • :Coveralls, chemical resistant gloves made of waterproof materials, chemical resistant footwear,and chemical resis taht headgear (if overhead exposure);

• Take off *any PPE t bat was worn in the treated area before reentenng the cab;t • Store all such PPEs ini a chemical resistant container, such as a plastic bag, to prevent

contamination of t ne cab

I I - ' • • • ' • • 'When applicators use enclosed cabs in a manner that meets the requirements listed in thejWrprkerProtection Standard (WPS) for agricultural pesticides [40 CFR 170 240(d)(5)], the handler PPE ~requirements may be reduced or modified as specified in the WPS

' User Safety RecommendationsUsers should: \• Wash hands before eating, drinking, chewing gum, using tobacco, or using the toilet• Remove clothing/EPE immediately if pesticide gets inside Then wash thoroughly' and~put oh

clean clothing t j• Remove PPE immediately after handling this product. Wash the outside of gloves >before

removmg: AsvSje^njaS^s^^ . . ; ,

HAZARDSThis .pesticide contamsja'trazine, which ijs toxic to aquatic invertebrates. Do not apply:,directly, towater?,pr4o areas-where surfaee. water isrpresentv or to intertidal areas below^ the mean high water

, mark^Do not applv when weather; conditions, favor drift from tieated areas.;Runoff;and drift from- - • — - ' - . , ; . - - . • - • . .- '" f f --J' ': t • j - •• :•- •*-.'-.--«.'- - - . ' • - . - - •-;•• - ••>.. • ' ' "• - • - • , • . . • - - • - . - • . - - . - . . . . . . , . •, ;.,- ., . . - - . . , . . .

treated^^ areas,may,*be hazardp.us; to aquatic of garusms in neighboring areas. Do not contaminate waterwhen disposmg of equipment wash water and rinsate.

StalwartXtra j Page 4

Ground^Water; Ajivisîcy . jStalwart Xtta contains pbth the active ingredients atrazine and metblachlor;

Atrazirie can travek(seep or leach) through soil and can enter gfoundwater ^hieh:iriay be used asdrinking water. Atrazirie has been found in grPuhdwater. Users are advisedjnotitoiapply atrazine tosand and loamy sand soils where the water table (groundwater) is close to tljie surface and wherethese soils are very permeable, i.e'., well^dfainedl'Vbur local' agrieultmial agencies can provide furtherinformatipnon .thestype of soil -in your area and*me location of; groundwateri.

s Ihe" potential to leach thrbugh soil into grounel water underjcertaih cbriditipns as aresult of agricultural u?e. Use of this chemical in areas whe're soils are permeable, particularly wherethe water table is> shallow, may : result in gfoimdjwater contamination. i

Surf ace, Water Advisory |-i--\ ;—:•<•,;: '•• . ;iv,r /• * •-'!/ . ; : - '• - ' • - • : • . . , H

Metolaehlor.has .:JSe pp|ential to contaminate surface/water thrpujgh ground spray drift. Under someconditions, metolaehior may also have a high potential for runoff into surface water (primarily viadissblutidh!ihrrunbff walef) for severatmbhths postrappHcatibh^soils' with readily 'visible "slopes i fowardâdjaeeht surface waters, ft equeritiy flbbded areas; areas over-layingextremely-shallbw;grourid''water-fafeasc^ surfacewater, areas-not separated .from adiaGentsurfaee waters with veeretated filter strips, and areas over-1 '. ' '"..•; ' f -'S ,";' •••;'"] '"•''*:, • • • _ - ! • ' • ' . • • ' A' 7 «••. (-,-'. ' •> -^ ,x--' ' - J . '•**-- -j'r--' ; . ! • " • . ' » • • '-••• ' - . ' . * • • ' . • \J' : •«.;•• ? • "" ' •'[ '! "•' ' '-' •*"'''' - ~ • > ' • ' - , . • " ;"•

. laying- tile drainage systems. ;that drain >tp surf ace water. , ._. . | • . . ' . . • •

Mixin^Loading Instnkctioris ICare must be taken when using this product to. prevent back-siphoning into] wells) spills, or-improper

. dispbsalofc excess pestieide,>spray mixtures; or rinsates. Check-valves :or< antisiphoning. devices mustbe used on all mixing and/ or irrigation equipment.

. .• .; i

This product must not be mixed or loaded, or used within 50 ft. of all wells, including abandonedWells, drainage wells, and sink holes. Operations th'at'involve mixing, loading, rinsing, or washing ofthis product into or from pesticide hatidling or application equipment or containers within 50 ft. ofany well are prohibited, unless conducted on an impervious pad constructed to withstand the weightof the heaviest load that may be positioned on or moved across the pad. Sucn a pad-shall 'be designedand maintained to contain any product spills or equipment leaks, container or equipment rinse prwajshwatef/and' -rainwater :l^tmay-'f^b^:t|ieVpyd'/SurJFaee water shall not be allb we'd to. either flowover .or "from the pad*> which'means'the pad must be seif-cphtaifled/ The padishalJ'be 'sloped'1 tofacilitate material removal. An unrbofe'd1 pad snail be of sufficient capacity to cbntaih at a minimum110% of the capacity of the largest p§sêide container or apph'eatibn equipment oil the pad. A padthat is covered by a roof of sufficient size to completely exclude precipitation from contact with:thepad shall have a mmimum containmerit,capaeity of 10p%io£the capaqty.pfitihe largest pesticidecontainer or. applicatiph equipment onitthe pad. Gontainrnent capaeities as .described above shall bemaintained at all times. The above-specified minimum containment capacities do nofeapply. tovehicles when ^ deliyerihg -pesticide shipments to the mixirig/loading sites. !

. . S ' . . . . - . . . . - ' - • - iAdditional Stateim^ bperatibnal areacontainment must be pbserved. !

This product must notibe mixed ^ or loaded within 50 ft. of perennial or intermittent streams andriversiriatural or ^'impbunded- lakes; and; reservoirs. This pfbduet ihust riot >bei applied aerially or bygfoTM'd •within 66 ft;! bfipbirits where' field surface water runoff 'ehters perennial 'of intermittentsWearns 'ahd'rivers'br within 20djft.%rbuhd natural or Mpbunde1iiftlakes'aridteis-appliedtb highly erodible'landV'tRe''i66-ftrbuffer'ofr1setMek%6;m riMbff eritiy-pbirits mustbeplanted to crop, or seeded with grass or other "suitable crop. i

Stalwart Xtrac

Page 5

One of the following restrictions must be used in applying atrazine to tile-outletted fieldscontaining standpipes: '

(1) Do not apply this product within 66 feet of standpipes; in til^-diitlerted fields.

(2) Apply this product to the entire tile-outletted field and immediately incorporate it to adepth of 2-3 inches in the entire field.

' I' ' • " - • •(3) Apply this product tq the entire tile-outletted field under a ncâll-pf actice onlyv-jyheri a high crop

residue management practice is practiced. High crop residueân;agerjaehtis described as a cropmanagement practice where little or no crop residue is removed from the field during and aftercrop harvest

| DIRECTIONS FOR USEIt is a violation of Federal law to use this product in a manner inconsistent with its labeling.

i iANY USE OF THIS PRODUCT IN AN AREA WHERE USE IS PROHIBITED IS A VIOLATION OF2 ~* * y It j^ { -» fl. 5 ' i C -.^.-;;.:: 'V '"-'• ..- :-

FEDERAL LAW Before using this product, you must consult the Atrazine Watershed formationCenter (AWIC) to determine whether the use of this product is prohibited in your watershed. AWICcan be accessed through1 [www atrazine-watershed info], or'[1-866-365-3014] If use of thts-prpduGt isprohibited in your watershed, you may return this product to your point of purchase>'or ebriiactSipcam Agro USA, Inc. for a refund.

» ' ' iDo not apply this product in a way that will contact workers or other persons, either directly orthrqugh drift Only protected handlers may be in the area during application. For any requirementsspecific to your State or Tribe, consult the agency responsible for pesticide regulation.

I AGRICULTURAL USE REQUIREMENTSUse,this product only.in accordance with its labeling and with the Worker Protection Standard;. 40CFR part 170. This Standard contains requirements for the protection of agricultural workers onfarins, forests/ nurseries, jand greenhouses; and handlers of agricultural pesticides. It contains

-'£-^.S-&5^! '&'s~.S-i~<-t.:ft.- &i K-'&ili'iA'.- •^.••WS.iti'.i'iC.-ii'v. .îlrta^Sc? ;•;<•. . .i;."yr, ..~-'$A-:~.- .•t't;i'i'.5. .;.'..: •'';•, ,,'.:^", T. • ^/i': ^..•:.;-.. .requirements for framing, decontamination, notification, and emergency assistance. It also containsspecific instructions and Exceptions pertaining to the statements on this label about personalprotective equipment (PPE) and restfictedêntry.interval. The requirements in this box only apply touses of this product thjat 'are covered by me Worker Protection Standard.

; • i

Uanofeenter-or.allowiwprker entry into treated areas during;the,restricted-entry interval (REI) of 24,•J.-ttS'-S.^fti *p$t ' J!'.-'/";.'. i "\ v"-.y.-'!~.f •>?;-,*. jViV'-.V,-; \'{i1:* :'Y'.';'- *"••'..?/- • , «* "" f ' '-^", ' ' • • ' ' "">? .''-V-* -' -1 •''.','"•' ': ~~;' M ' '- " ••' '^' ~'-~" '. "-.'-.'''.'-. " ','•" A'-"';:..' ' ".*"* •

hours. Exception: If th^ product is soil-injected or soil-incorporated, the Worker Protection Standard,under certain circumstances, allows workers to enter the treated area if there will be no contact withanything mat has e£^ early entry•-to treated areas that is permitted under

Aer^fedcer jPre>JectipnjStjandard and that =invdlves contact with anything .that has: been treated> such asplants, soil, or water is: |• Coveralls• Chemical-resistant gloves, such as barrier laminate or viton

;»jiShpesjplus socks;:

. D 1 C T I N J F)R TLJSE ON THIS LABELMAY RESULT IN POOR WEEE•CONTROL, CROP INJURY, ORTLLEGAL RESIDUES.

i . • - • ' • • * •

Note: Net for, sale/use> or disMbutiori invNassau County or Suffolk County, New York.

i 7! Ac-Stalwart Xtra. | Page 6;

i

! •

USE INFORMATION |Stalwart Xtra is a selective herbicide that may be used before planting, before or after emergence (seedirections) for control 6f mostannual grasses and brpadleaf weeds in corn (all types). .This productmay be tank mixed witjh other herbicides specified on this label for weed control in convehtiohai,rrunmium-tiH> and?

Note: Tank mixtures are permitted only in those states where the tank mix partner is registered. Refer; M';an^follbw5thMal!>el directions fcirTise> geographic andSbther restrictions. '"'• - '{

FbHowing many years pf continuous use of aifazine:(6he of the ingredients 'in S&wajft Xtxa), andproducts chemically related to ajrazine, biotypes of some of ..the Breeds listed on this label which arecontrolled by the atrazine component' have beeh'-'fepSf ted :tb develop resistance to this and chemicallyrelated herbicides; \^ere:thls€s'knoWn«6r suspected) and weeds controlledlby this product areexpected to be present along with resistant biotypes, we recommend the use of Stalwart Xtra incombination or in sequence with registered herbicides, which do not contain triazines. Consult withyour State Agricultural Extension Service for specific recommendations.

jWhen tank-mixing or sequentially applying atrazine or products containing! atrazine to corn, the totalpounds of atrazine applied^(lbs ai/A) must not exceed 2.5 pounds active ingredient per year.

Stalwart Xtra alone or in tank mixture With atrazine, isoxaflutole (Balance®)] metblachlbr (Stalwart C),or simazine (Sim-Trol®) may be applied early preplant, preplant surface, preplant incorporated, orpreemergence in water or fluid fertilizer Apply post-emergence treatments pf Stalwart Xtra usingwater only as the earner Stalwart Xtra may be applied in tank mix combination with paraquat(Gramoxone® Xtra), 2,4-D + glyphosate (Landmaster® BWJ, or glyphosate (Eioundup®) wititi or\vithout the above herbicides preplant surface or preemergence

Stalwart Xtra may be applied in water by aircraft Applications in fluid fertilizer should be only byground equipment.' ; - ' !

T;p aypid spray dri|t> 4,6 npt apply .under windy cpnditipns. Avoid spray overlap,, as crop injurymayresult. j . .. . , ; j .

Do-not apply-this product through any type of irrigatibri^system. ;j. _ . , r - . i

Do not apply this product in a greenhouse. j

'D'p not graze'br feed forage 'frbin tf eated areas for 6CMdays f 6 jlowirig applicaltiori for corn (all types) ." " ' "

Eps^emergent applications to, corn must be made before the crop reaches 12 inches, in height;sDo not 'kpply under iconditidns> which favor runoff 6r wind erosion of soil cpntaining this product tonontarget areas. : !

To prevent off-site movement due to runoff or wind erosion: j

1. Avoid treating powdery dry or light sand soils when conditions are favorable for wind erosion.Under these conditions, the soil surface should first be settled by rainfall or irrigation.

2. Do not apply to impervious substrates, suiih as payed . 'or highly, gpmpScted surfaces.

3. Do not use tailw4ter from the first flood or furrow irrigation of treated fields to treat nontargetcrops;' uMessatieaist 1/2 m^ application and the firstirrigation. j ' |

Stalwart Xtfa. | Page?7

i • .Where reference is'tnadjeô weedSipaMally controlled, partial; control can either mean erratic controlfrom good to poor, or consistent control at a level below that generally considered acceptable for

• - ' - I J JijSSF^ - ". ••'•-. '••"'"•' ' : J ".¥commercial weed control;.

Dry weather following, preemergence application of Stalwart Xtra or a tank mixture may reduceeffectiveness. Cultivate if! weeds develop.

riiSprêj^ of 'cteanmg solutioniiri ariner . pJJ3i:not«us,e=a' sprayeriOKapplicator contaminated with other materials;;; or ;erpp

dam^gespr/sprayer clogging^f trie^pp^cati^ • . - . . . - . . •>.-.•' . -. •- : .

I . . . • • .-.- ' • . . • ,Shake 2.5 gal jugs well or thoroughly recirculate larger containers and bulk tanks before usingStalwart Xtra is a liquid that may be mixed with water or fluid fertilizer and applied as a sprayStalwart Xtra'may also Be sprayed onto dry bulk granular fertilizer and applied with the granularfer6hzer i

.Many dry bulk granular fertilizers may be impregnated or coated with Stalwart Xtfa and used to

When applying Stalwart |Xtra;with dry bulk granular fertilizers, follow all directions for use andprecautions on the Stalwart Xtra label regarding target crops/rates per acre, soil texture, applicationmetho'ds (including timing of application), arid rotational crops

All individual state regulations relating to dry bulk granular fertilizer blending, registration, labeling,and application are the responsibility of the individual and/ or company selling the ; r

sprp1lsif deNO:;m^; may siiTipreghateffefîze^'facliiityjim^jbtilk;«fertilizer-thafe . • • • . j r - h - ~ - - ' - • • . • • • • • • • • " • • • • . : ; . ' - . - . . • . • • • • - . •

;fe^plieators=mustêarTiong7sle!eyed;sK^1» nEhesrestricted-entryj interval is : 24 hoursv •• . • • •••• ' . • • •

.-."A , , , . - . . . l . - . . - . ' , ' . ' - . • - (14 : j • . . ' • : - - ... - • • ( . , '. • - - - •

''^^pJ^^€l^^tiA^f^<^^&TTEa3âe& by iising any closed drum, belt, ribbon, or other commoriiyused dry bulk fertilizer blender. Nozzles used to spray Stalwart Xtra onto the fertilizer rnusf beplaeedito :pf6vide"kiniform:spray coverage^Gafe 'should be taken to aim the* spray directly onto the

ând tdâyioid^spf aying tile walls of tike blender.

If 'the: hlf bicide/ fertuiie'r] mucfefe is .too wet,jadd% highly albsprptive. material, such as Ag?or^® or,Celatom MP-79®, or sirriilar granular clay or diatbmaceous earth materials, to obtain a dry, free-flowing mixture. Absorptive materials should beblacMe1$intb"the fertilizerMuxtiire'; 'BSst application results will'be obtained by using a^grahule'of 6/30

'tp^r^lfilsize-dr; of Ja;sizf{siiMlaf5to ^weight of absorptive material will;"be needed. Avoid using more than -5% absorptive" material -by

. weight' -•••t-'-^ .

©ilculale me amount of 'Stalwart X&a to be used by the foUowirig formula:

••'•••-'••. -:-'.4-2t@00xi- •.• • • . - ; • : • ; • • ptsv/'A of liquid '<5r pts. ofh'quidorflowable

Stalwart Xtra | Page 8

lbsx;pf fertilêr-periaere X <flowable:£ro.duet = productper ton of fertilizer

2,000 : Ibs./Abf Ibs. of dry product .Ibs. of fertilizer per acre X dry product = per ton of fertiliser

Pneumatic (Compressed Air) Application I

High'nurmdilyy Mature dustyj fertilizer may causefertilizer ^ nniXtSires toTfeuiidfUp of plug.tne distributor head, air tubes; or nozzle deflector plates; Tominimize buildup, premix Stalwart Xtra with Exxon Aromatic 200 at a rate pf 2.0^2.5 pts./ gal: ofStalwart Xtra. Aromatic 200 is a noncombustible/ nonflammable petroleum! product Aromatic 200may be used in either a fertilizer blender or through direct injection systems. Drying agents shouldnot be used when using Aromatic 200. j

' ^:"'^>- '•• ' i ' ' . ' » j ,Notes: (1). Mixtures of Stalwart Xtra and Aromatic 200 must be used on dry! fertilizer only. Poor

";"-f~s,J " /- c -* *"> -vr- . . - • . - . • • • '•• -.'-:-' ";;-- •"-...'results pr crop injury may result if these mixtures are used in water or liquid fertilizer solutions, forspraying applications.! (2) When impregnating Stalwart Xtra in a blender before application, a .driermixture can be attained by substituting a drying agent for Aromatic 200. Thie use of Agsorb FG ordrying agents of 6/30 particle size is recommended. (3) Drying agents are niotreeorrMiendied'for usewith On-The-Goiimpr|gnation equipment . . . , . . . • [ j , . . • • -

Precautions: To avoid potential for explosion, (1) Do not impregnate Stalwart Xtâ oh ammonium nitrate,potassium nitrate, or sodium nitrate, either alone or in b}ends with other fertilizers (2) Dp not combineSfalwart Xtra with a single superphosphate (0-20-0) or treble superphosphate (0-46-0) (3) Do not useStalwart Xtra on straight limestone, since absorption will not be achieved Fertilizer blends containinglimestone can be impregnated.

.-> •• .- »< ! •• :.:. - • . . ; • • . - • . •• •' jv;;".'". ' '. ' .. • . ' • • • • • ... ••• • . - . ' • . . •

Application < !

Apply 200-700 Ibs. of the herbicide/ fertilizer mixture per acre. For best results, apply the mixtureûniformly to thfeôil with<£rbper^ bleriding; TMifprmr^ applieation'df feesherBieide/ f e^mjury to su'bsequentrptatibnal: croups. Nonuniform application may also resjult-in'unsatisfactoryiweedebhtrol;'Mareasrwhere Gonvehtio^Sal tOthe soil is recommended to obtain satisfactory weed control. On fine- or medium-textured sbi'fein-sareaswhere soil incorporation is'nofplanned>i.e\, reduced tillage situations or in borne conventional tillsituations, make applications approximately 30 days before planting to allow moisture to move theherbicide/ fertilizer mixture.into Ihe soil. On coarse-textured spils, make applications approximately 14clayslprior to pjantingj , . . i

Precautions: (l))-To-falp\av.cfd:mtatipnal cropinjiiry; make applications as early as possible, since. StalwartXtra impregnated onto dry bulk granular fertilizers can lie expected to last longer ifo the soil that whenStalwart Xtra is applied as a spray in water or, fluid fertilizer. (2) To avoid potential crop injury,. do not usethd he^dde/fertilizer mticfure ori crop's where'platiting beds are to be formed: j

Application mât^r pr*Hmd;FerttUzefs: ' . , - . . jStalwrart;X|ra Alone: Fill the sprayftank 1/2^3/4 full with water or fluid-fertilizer; add- the; proper

; ampunt of-Stalw:art?X^ra, then add the; rest of the water-or fluid^fertiMzer. Prpvide sufficient-agitationduring mixing andt:apph'cation to maintain a uniform suspension. , | • , .

• " I i • . . .Tank Mixtures: Fill the spray tank 1/2-3/4 full with water or fluid fertilizer, add the proper amountof Stalwart Xtra, then addratrazine, dieainba;;isoxaflutole (BalaMce)>:liriuron> or simazine; next addmetolaehlor; then addlparaquat, 2,4-D + glyphosate (Landmaster BW), or glyphosate, depending onthe tank mix combination desired; and finally, add theirest of the water or fluid fertilizer. Only water

Stalwart Xtra j. , Page 9.

may be use'd with Stalwart Xtra + Liberty® Herbicide when applied postemergence to corndesignated as tolerant .to'Liberty^glufosinate); and with Roundup Ultima® when appliedpostemergence'to corn designated as tolerant to Roundup (glyphosate). Provide sufficient agitationduring mixing and application to maintain a uniform suspension.

Compatibility Testi

A jar test "is recornmended'before tank mixing to ensure compatibility of Stalwart Xtra with otherpesticides.'The'following test assumes a spray volume of 25 gals./A. For other spray volumes, makeappropriate changes'in'the' ingredients

Note: Nitrogen solutions or complete fluid fertilizers may replace all ,or part of the water in the spray.Since liquid fertilizers vary, even within the same analysis, always check compatibility withpesticide(s) each time before "use.'Incompatibility of tank mixtures is more common withsuspensions of fertilizer and'pesticides.' Commercial application equipment may improvecompatibility in some instances. Check compatibility using this procedure-

1. Add 1.0 pt of carrier-(fertilizer or water) to each of 2 one-qt jars witiVtight lids. Note: Use tife samesource* of'water that will be use'd for the'tank'mix and conduct the test at the temperature the'tankmix will be applied!

i ',2. To one of the jars, add 1 /4 tsp. or 1.2 milliliters of a compatibility agent approved for this use (1 /4

„ tsp. is equivalent to'2.p pts /IpO gals, spray). Shake or stir gently to mix. When an adjuvant is to» be used with thi§,pijoduct, Sipcam Agro USA recommends the use of Compex®, Unite® or a

Chemical Producersjand Distributors Association (CPDA) certified adjuvant

3. To both jars, add the appropriate amount of pesfacide(s) in their relative proportions based onspecified label ratesi. If more than one'pesticide is used, add them separately with dry herbicides'first, flqwablesfnext^ and emulsifiable concentrates last After each addition, shake or, stir'gently tothoroughly mix.-The-appropriate amount of herbicides for this test follows:

Dry'herbicides: For each pound to'be applied per acre, add 1.5 level teaspoons to each jar.

Liquid herbicides: For each pint,to be applied per acre, add 0.5 teaspoon or 2.5 milliliters to eachjar.

4 After adding all ingredients, put lids on and tighten, and invert each jar 10 times to mix Let themixtures stand 15-30 minutes and then look for separation, large flakes, precipitates, gels, heavyoily film on the jar, or; other signs of incompatibility Determine if the compatibility agent is neededin the spray nuxturejby comparing the 2 jars If either mixture separates, but can be remixedreadily, the mixture can be sprayed as long, as good agitation is used If the mixtures areincompatible, test fhe|follpwing methods of improving compatibility (A) slurry the drypesticide(s) in water before addition, or (B) add 1/2 of the compatibility agent to the fertilizer orwater and the othen 1/2 to the emulsifiable concentrate or flowable pesticide before addition to themixture If incompatibility is still observed, do not use the mixture

i5. After compatibility testing is complete, dispose of any pesticide wastes in accordance with the,, Stbrase arid L^isposal section in this label." •'• ' ^ ' ?*>.-,••.-,•;-..?•-"?• py,,.,.,.^ - - . , . ,.,,..;..-, .... . . ,

SOIL TEXTURE INFORMATIONWithin rate ranges in all {tables on this label, use the lower rate on soils felatiyelycd^se-fextured-brlo^ in .organic matter;

Coarse

us'e the higher rate on soils relatively fine-tgxtiired or high«in organic:matter.

•n^ri^s^tei<^0^^&-;'gen&a^y^c^^&Bzedf as follows:

Medium Fine

rStalwart Xtra Page 10

Sand T. ... . ,. . . - . , . .. j. .Loamy sand . . . . .. ; .

y V • -• • • j- ..

Jsandy^lojjimj,,,, ....,., :,-....^.f..

: Loam, £>iit loam ,''M|t_.,>,, 1: , . . , '[,., ,;,i,'^

Sandy .clay loam ;Silty clay loam

.'<-.i': -•'•:-.• '.J.1 -:•;... - • '.

Clay loam ,

. Sajidy^lay.Silty clay

.....Clay, ^~ • . ,'. .

APPLICATIONGround Application: Use sprayers that provide accurate and uniform application Screens in nozzlesand in suction and in-line strainers should be no finer than 50-mesh Use a pump with capacity to. (1)maintain 35-40 psi at the nozzles, and (2) provide sufficient agitation in tank' to keep mixture insuspension. Unless otherwise specified, use a minimum of 10 gals of spray mixture per acre Rinsesprayer thoroughly with clean water immediately after use i

For band applications, calculate amount to be applied per acre as followsband width in inches X broadcast rate = amount needed 'row -width in m'ches per acre per acre of field jI • . • • , • - . . . •• j

Low_Carrier Application (Broadcast Ground Application Only): Use sprayers, such as Ag-ChemRoGatpr®, Hagie, Jofm Deere ffi-Cycle™, John Deere 4700 Sprayer, Melroe Spra-Coupe, Tyler Patriot™,or Willmar Air Ride®, that provide accurate and uniform application Only-water may be used as acarrier. Screens in suction and in-line strainers should be 50-mesh Manufacturers may require that tipscreens as fine as 'lOO-mesh be used with some nozzles Use a pump-with capacity to (1) maintain upto 35-40 psi"at the nozzles, and (2) provide sufficient agitation in tank to keep mixture in suspension.Use a minimum of 5 0 gals of spray mixture per acre Maximum recommended sprayer speed is 15mph Maintain uniform travel speetl while' spraying Rinse sprayer thoroughly with clean -waterimmediately.aftereaehiuse., . . . . . - . , , . , ! . . . . . .

, -*«! ^;-v-i-^>!-:.< 'J-,>?-; • > • > ? , ^.;;> ,::•-,-.•'-, -•$ .•;; -?.-•.••.. -• ' . • . • • ' \- .:'.'„. - . - . . • ' . ~. . ' i • '

. ' _ , . . . CareT^613MgMevice^»'SprayMhe material withlbx-me'rated

working pressure and^w^aitgWof ute nozz^recommended by the manufacturer. All nozzles should be placed on 20-inch centers, except floodingtypes -which should be placed on 40-inch centers. When Flat Fan-type nozzles are used, angles of 80°

?or-110° are recommended Always read and follow the manufacturer's directions for optimum setupand performance of their nozzles Or tips. '

Aerial Application" (for Stalwart Xtra alone): Use aerial application only where broadcastapplications are specified. A'pply a minimum of 1 0 gal. of water for each 1 0 gal of this product

%pplied per acre, but for rates below 1.0 gal./A, use in sufficient water to equal 2.0 gals./A of totalspray. Avoid applications under conditions where uniform coverage cannot be obtainecl or whereexcessive spray Tdrift may occur In order to assure that spray will be controllable within the targetarea when used according to label directions, make applications at a maximum height of 10 ft., usinglow-drift nozzles at a maximum pressure of 40 psi, and restrict application to periods when windspeed' does not exceed 'lO mph. To assure that spray will not adversely laffect adjacent sensitivenontarget plants, apply Stalwart Xtra by aircraft at a minimum upwind dist&nce of 400 ft from

Avoid application to humans or animals. Flagmen and loaders should avoi'd inhalation of spray mistand prolonged contact with skin. j

- • ' - ' " " ' ' ' • "

Avoiding" spray ;/d^cu^af 'm 'ap'pliclatiorii siie is the responsibility of the applicator. The interaction ofmany equipment and ! weathersreMed^faGand rfhe grower are responsible for'considering all these factors when m

Stalwart Xtf a

from aerial applications,applications, public

r

2. *':Nl?zz

r 'Page 11

st be followed to'avoid off-target drift movement; tp agricultural field crops. These requiremerife do riot apply tbfbfestry

health uses or to applications using dry formulations.

svpBinWiad^afd'parallel wth> the air stream arid never be^bmtSd downward' • ' • ' ' ' • " • ' • ' ' - • • " " ' " - '

Where states have more stringent regulations, they must be observed.

The applicator should be (familiar with and take into account the information covered in the AerialDrift Reduction Advisory Information section below

Aerial Drift Reduction Advisory Information

Information on Droplet SizeI i ; ••-

The most effective way to reduce drift potential is to apply large droplets. The best drift managementstrategy is to apply the largest droplets that provide sufficient coverage and control. Applying largerdroplets reduces drift potential, but will not prevent drift if applications are made improperly, orunder unfavorable environmental conditions (see Wind, Temperature and Humidity, andTemperature Inversions)

Controlling Droplet Size

• Volume - Use high flow rate nozzles to apply the highi^t/practiGal'sjpf ay volume^ Nozzles withhigher rated flows* pjroduce larger droplets •

• Pressure - Do not exceed the nozzle manufacturer's recommended pressures. For many nozzletypes, lower pressure produces larger droplets When higher flow rates are needed, use higherflow rate nozzles instead of increasing pressure

• Number of nozzles - Use the minimum number of nozzles that provide uniform coverage.

• Nozzle Orientation,- Orienting nozzles so that the spray is released parallel to the airstreamproduces larger droplets than other orientations and is the recommended practice; Significantdeflection from horizontal will reduce droplet size and increase drift potential,

• Nozzle Type - Use a nozzle type that is designed for the intended application: With most nozzletypes, narrower spray angles produce larger droplets Consider using low-drift<nozzles: Solidstream nozzles oriented straight back produce the largest droplets and:the lowest : drift

Boom Length i

Fbrs'dme use; patterns,^length may further redjiieb drift without rMucirig swam widlii. '

Application Height 'i . • .

Applications must not belmade at a height greater than 10 feet above the top of the largest plantsunless a greater heightjis required for aircraft safety/^al^g^p;pUeatibns-attheldwesthelghtvti^tKsafe reduces exposure of droplets to evaporation arid \vind.

Swath Adiustment h i:y r-r -•,-, ,. :.f-:-l-i • • - • - • „ ' . . . '\( \ " ' '

When?applicatiorte are rnade wrth a erosswMd> the swath will '.be displaced downwindrThefef ore, onthe up arid downwind Sedgesjof the field, the applicator must compensate for this displacement by

Stalwart Xtra Page 12

adjusting' the pathipfBthe^ attcraft, upwind. , Swath .adjustment distance, should increase, with increasingdnftpojential (Mgher. \viiid> smaller; drops, etc.). . . . . . .

Wind

speeds of 2-10= mph: However/ many! factors, incltiding?dropletsize and equipment type determine drift potential at any given speed. Application should?15e%voided

!,b,elQW,2 mphjdue, to.yariable wind direction and,high inversion potential; N;ote:tLoGalterrainjean,~, ii.« v.~--tfj • : .:. " v . ."**,:' * i"-* .•' -.' ..' ' : '.- '- ' t "-v-'v" ',''/•<' '•.'.'.•' f .'. * ;•!• • ' t""' - *• ':• '; '£SM'.."* sWVijj'v-. "'Â* '* V.J- i-' ~ V ••'• • _< J -j • ,i... i\^: • _ • • • •._"?, t,..-! ... • i : »,' • •- - • , / , . »_ . - , ;. -•,,;>,.-,>.; ; ,• --7. . ;!'." •;-;« 'c-"-^

influence wind patterns. Every applicator should be fainiliar wiih local wind patterns .and howr theyaffect spray drift ; j

Temperature, and Humidity jWnMtmiynf applic'afiOTisîn low relative'Kumidi^>''s1et'Uip'^tup"mimt''t6 p'TOducel^ger 'droplet tocompensate for evaporation. Droplet evaporation is mbst 'severe when coriditi'ons afebou^^t arol

Temperature Inversions ji ^'l ' 'Applications should not occur during a temperature inversion because drift potential is high

Temperature inversions restrict vertical air mixing, which causes small suspended droplets to remainin a concentrated cloud This cloud can move in unpredictable directions due to the light variablewinds common during inversions Temperature inversions are characterized by increasingtemperatures with altitude and are common on nights with limited cloud cover and light to no wind.They begin to form as the sun sets and often continue into the morning. The'ir presence!ean beindicated by ground fog; however, if fog is not present, inversions can also; pe identifi'ed'by<themovement of smoke from a ground source or an aircraft smoke generator Smoke that layers andmoves laterally in a concentrated cloud (under low wind conditions) indicates an inversion, whilesmoke that moves upward and rapidly dissipates indicates good vertical air mixing

Sensitive Areas j . . . • J

The pesticide should only be applied when the potentialjfor drift tos adjacent sensitive areas (e.g.,residentid areas, bodies of w,ater, knpwri habitat for foreatened or endangered species, nontergetcrops)' is minimal (e. g4 when wind is blowing- away from the sensitive areas) .

• - . [ • . . • ' • ' . - • • - • • • • ' \ \ - • • .Rate liimitatibhs 1 ' I

• ' • • . ' , iWhere there are staie/ilbcal requirements regarding atrazine use (including jlower maximum ratesarid'/:or greater •setbaGks)>wHch are different from therlabelrvme more; restrictive/ protectiverequêirients-mustbe 'followed. (Sertam states may h^^^geographical areas; Consult ^youjr^stateleadpestidde control' agency -for additional information: It is aviolation of this label tb deviate from state use regulations. |

' ; j

Note: For purposes ofjealculating total atrazine active ingredient .applied, Stalw.art Xtra contains 3.1> -i-\-- v-f- - .' . ,,?i-."X7'1- ; Vr*'-"*"' *' ;'-si"? "' \~~ •'• "-•"'"•" " -Vj-'ig. '• \O 5- •*;'!;• -. .. '?• • ••-,/ v -i't'' '•=?'. • ' - ; • " ' ' ••'• '- ' " •" *-i '•'"-- "*"- - ' . '*•"'' "•" ' - \ ' ' - "'•"." :'" "•' "Vl-3'- ' ' " "•"'"•' ' "" '

ibs. a.i. atrazine + related cornpounds^pergM.. (0.775 lb.ai/q;t.). • .. . . j. . ' ! > . ' , . - •

For All Soil Applications |Applyâ maximum, of J2-9,<lbs, %i./A (2.6 qts, of product/A) as a single, preerhergent broadcast .

? agpliea.tipn.pn:s;oilS'that are not^gMy; Credible qrsdn highly erodible soils , (as defined.by-JheiNaturalResources Goriservation Service) if practicing conservation ;tillage, and .atleast, 30% of the soil.surfaceis covered with plant residues at planting; or apply a maximum of 1.6 Ibs. ali./ A (2.1 qts. ofproduct/ A) as a single preemergent broadcast application on highly erodible sous (as^defihe'd by theNaipral^Resdiirces CZons'ewatipfi; Service) if- less tflan-30%. ofthe soil surfacejis covered' with. plantresidues at planting; Or 2.0?lbs: ad./ A (2:6 qts. bfeprpduet/ A) if! only applied: postemergehfc


FOR POSTEMERGEMCE APPLICATION TO CORNIf no atrazine was applied prior to corn emergence, apply a maximum'of 2 Ib ai/A (2.6 qts./A)broadcast If a pbstemergence treatment is required foHowiri^an; earlier herbicide appKeatibn, thetotal atrazine applied may not exceed 2.5 lb'ai/A (3.2 qts. of'Sialwalt Xtra) per calenia¥ year!

ROTATIONAL CROPSi

Do not rotate to food or feed crops other than those listed below:

(1) If treated crop is lost due to poor germination, hail, flood, insects, etc., corn may be replantedimmediately. Do not mak'e a second broadcast application If the original application was banded andthe second crop is planted in the untreated row middles, a'second banded treatment may be applied.(2) Corn, sorghum, soybeans, cotton, or peanuts may be planted the spring following treatment Donot graze or feed forage or fodder from cotton to livestock, or illegal residues may result (3) Injurymay occur to soybeans1 pljanted the year following application on soils having a calcareous surfacelayer. (4) In eastern parts of the Dakotas, KS; western MN, and ME, do not rotate to soybeans for 18months following application if the rate applied*to "corn or sorghum was more than 2.0 Ibs. a.i. ofatrazine'of equivalent band application rate/or soybean injury may occur. (5) If applied after June 10,do not rotate •with crops other thari cornier sorghunVthe next year, or crop injury may occur. (6) In the

'High'Plains and Inter-mountain areas'of the West, where rainfall is sparse and erratic or whereirrigation is required, use only when com or sorghum'is to follow corn or sorghum, or a crop ofuntreated'corri or sorghum is-to precede other rotational crops (7) Do not plant sugar beets, tobacco,vegetables (including'dry beans), spring-seeded^ small grains, or small-seeded legumes the yearfollowing application, br injury may occur

Stalwart Xtra is effective for the control of grassy and broadleaf weed plants that cari infestagricultural fields. The spectrum of effective weed control may differ depending upon theapplication pattern and' timing of application(s) of this product. The following table is a partialillustration of the potential usefulness of this product to mitigate the growth of weeds.

Weeds Cjontrplled -^replant;barriyardgrass ! jv..!-?*v'"*<i£i'i a • V - • ' '' (watergrass) •'browntbp panicumcrabgrass •crowf botgrassJaE^lmciim ;fo^ii milletgiant? foxtail:goqsjegrass

and Preeinergencegreen foxtail carpetweed

•prairie eupgfasS chickweed;red rice cocklebur*signalgrass (Brachiaria)* common ragweedsouthwestern eupgrass Florida pusley•vvitciigr,ass galirisoga

i yellow' foxtail giant ragweed* •yellow nutsedge* heftbit

Applicationsjimsoriweedlambsquartefsmornirigglbrymustardsnightshadespigweedsmartweedvelvetieaf*waterhemp

Weieids (Soiitrppecl :- Pdstemerjgeiiee Applications ,

1

Stalwart Xtra ,

barnyardgrass(\yafergrass)

.cocMebjir . ,cOmrnon ragweedcrabgrasscrowfootgrass

sandburseedling johnsongras!

fairparucurhfHxweedgiant foxtailgreen foxtailyellow foxtail

Weeds

sicklepod

jinisdnweed ..'• .koChiajairtbsquarters " ,morniriggiorymustardpigweed

Partially Controlled**

woolly, cupgrass

Page 14

prickly sidapurslaneragweedsmartweedvelvetleafwaterhemp

yellow nutsedgecommon-purslane

* Control of these weeds can be erratic, especially under dry weather conditions. ControLescaped•weeds with cultivation or application of an appropriate EPA-registered p'ostemergence herbicide.On finertextured soils, only partial control can be expected. I

** Control may be improved by following these suggested procedures: '

1. Apply up to the maximum single application rate in Table 1 for your given soil texture and ratelimitation based, on your soil conservation practices. J

2. ThoroughlyttilLmoist soil to>destroy germinating andxemerged>weeds. If Stalwart Xtra is to beapplied preplant (incorporated, this tillage may be used to incorporate Stalwart Xtra if uniform2-inch incorporation is achieved as recommended under Application1 Procedures.

3. Plant crop into moist soil immediately after tillage: If Stalwart Xtra is) to be used preemergence,apply at plantingôr immediately after planting. \

4. If available, sprinkler irrigate within 2«days after, application. Apply 1/2-1 inch of water. Uselower water yolume, (1/2 inch) on coarse-textured soils and higher volume (1 inch) on fine-textured soils. , ; 1

5. If irrigation is not possible and rain does not occur within 2 days after jplanting and application,weed control may be decreased. Under these conditions, a uniform, shallow cultivation isfecorrunended'aW'Sooifafêediêifterge. .?; f 2 - ' ' - • - - .• '-.:• ' • '" /" .- . '" . I

i , I

i APPLICATION PROCEDURESEarly Preplant iIf you apply this product early preplant, use the appropriate rate from Table 1

Table 1: Stalwart Xtra - Early Preplant Rates of Application j1

Soil Texture 'COARSE |Sand, loamy sand> sandy

^lOam . . .... ,-f:,Jr,. .;..;«, ;r !

MEDIUM . _ . : „..,:.. !•Loam, silt loam, silt i

.' • i

-FINE. Sandy clay loam,:siity'clayloam, clay loam, sandy-clay, silty clay, clay

Single Application

,...,... 2lqts./A

A. 2.1,qts./A

B. 2.1-2.6,qts,/A

. Ai. 2.1qts./A

B. 2.6qts./A

Split Application* . [ . .30-45 Days Pre-planting AtMaijting^

. ,. , DO NOT APPLY

l,4jqts>/A, 1.4,qts,/A

. . . . . . . . to':.. . '1.75qts.yA

v -.,;• liqts./A

1.75 qts./A

0.7 qt/A0.7 qt./A

to0.9 qt/A0.7 qt/A

0.9 qt/A

* Split applications can be made less than 30 days before planting if desired.

Stalwart Xtra

c cPage 15

ffig^^ than 30% pliant residue cover: Control of>6 notfexeeed tiWcertain weeds may fee 'reduced arid a tank mix partner or an application of a postemergenee

r Bi Do not exceed this rate on soils 1&a1;ale1 soils if at least30% of the soil is covered •with plant 'residue.

! j

Applications made less1, than 30 days prior" to planting may be as either a split or single treatment.Use the lower rate for light expected weed infestations and the higher rate for heavy expected weedinfestations. On coarse-textured soils, apply 2.1 qts./A not more than 2 weeks prior to planting. Theabove procedure may be followed if atrazine or metolachlor or simazine is used m tank mixtures withStalwart Xtra Substitute a fluid fertilizer for some or all of the water carrier for burndown of existingannual weeds lisjted oni this label up to the 2-leaf stage of development. The addition of crop oilconcentrate to the spray mixture will Enhance the burndown activity. If larger weeds are" present atthe* time of treatment; supply in a" tank mixture combination with a contact* herbicide (for example,paraquat "dr'glyphosate')' Observe directions for use, precautions, and restrictions on the label of thecontact herbicide j

Usepn medium- and fink-textured soils with minimum-tillage or no-tillage systems in CO, LA, IL, IN,KS* KY, MN, MO, MT, ND, NE, SD, TN, WI, and WY =•' - / • / • . - - . : • • ? . • .

On medium- and fine-textured soils with minimum- or no-tillage systems in DE, MD, MI, NY, OH, PA,VA, and WV, early prejplant applicatipns»may be applied following the directions for use above. If theamount of rainfall results 'in unsatisfactory length of weed control following the earlier treatment, apostemergenee application*pf an appropriately labeled broadleaf and/ or grass weed herbicide may beused, i e , atrazine, pruiusulfufon-êthyl (Beacon®), dicamba (Banvel®), bentazone (Basagran®),broinoxynil (Brdrrunal^ or.Buctnl®), pnmisulfuron-methyl + prbsulfuron (Exceed®), atrazine +dicamba (Marksman®)] or 2,4-D If 'the' postemergenee treatment includes the herbicide used earlypreplant, do not exceed the labeled rate for corn on a given soil texture. Observe all directions for use,precautions, and Irautajtio'ns on the label of the postemergent herbicide:

Stalwart Xtra may be used according to fte- above directions to control winter "wheat- planted as acover crop in IN, KY, and' OH, in addiWon to providing residual weed control. The wheat must be lessthan 6 inches tall (preferably still in a dormant or semi-dormant state coming out of winter) at thetime of application. Depending on rainfall, 10r20 days may be required tq completely kill the wheatIn the event that adequiate rainfall does not occur, control of the winter wheat may be unsatisfactoryand the application of a' contact herbicide (i.e., paraquat or glyphosate) may be required beforeplanting the crop. i .

On medium- 'andfineêlctufed ''soils f bU6vdhg:final seedbed prepatatipn inr the 'Blaeklands 'andûlfCoast areas of TX, an early preplant application of Stalwart' Xira-at H&& qtst/A may'bê'1made;30-45days^ before planting. Grass suppression of 2-3 weeks after, planting, can be expeeteciLas.,a result of thisapplication. Do not incorporate or disturb the soil before planting,: .and .avoid mo vmgj.the soil .duringthe planting operation.i A( follow-up application of metolaehlor may be needed in fields with a historyof heavy grass pressurel .pply after planting, but before corn and grass weeds emerge.;o:.4 •-.: : ; : - : ' . ' • • --;:rf.- • ' I 1 • ! - ' " • = • ' • ' " - '•"'*'' •->••'.' :f'' • ' • : i - ' . : - - • ; ' • •-'' -^ -'--.'• - • • ' ' • • '

Notes: (1) If a follow-up application of metolachlor is needed> dp no,t exceed a total of 1.6 Ibs. a.i. ofmetolachlor per acre, including the preplant Stalwart Xtra application on medium- or fine-textured soils.On fine-textured soils withimore than 3% organic matter, do noifexceed.vi'.9 Ibs. a.i. of metolachlor.

! ' • , . - : • " • • • - . • • - ' -[To determine the total Ibs. ai. of metolachlor per acre, use the following 2-step method:

A Determine the Ibs. 'of metolachlor applied as Stalwart Xtra (1 qt. = 0:6 Ibiai. of metolaehlor);


B.-If metplacMgrisjtohe used, add the Ibs. ai. to be .applied in these products to the Ibs.. in Step A.above.]... . , . . . . , . . - . . . . , ' , \

(2) To the extent pqssible, do not move treated soil out of the row or mojve untreated-soil to thesurface during planting, or weed control will be diminished. j

iPreplant Surface, Preplant Incorporated, or Preemergence

If you^applyjhis product preplant surface, preplant incorporated, or preemergence, use theappropriate rate from Table 2 *

'Preplant Surface: Apply uniformly to the soil surface within 14 days before planting. Whereapplications are made 'to coarse soils more than 7 days before planting, use the rates in Table 1.

Preplant,Incorporated: Apply to the sbil-and incorporate into the top 2 inches of the soil within 14days before planting, using a finishing disk, finishing harrow, rolling cultivator, or similar implementcapable of providing uniform 2-inch incorporation. Use the preplant incorpprated method if furrowirrigation is used or when a period of dry weather after application is expecfted. If crop is to beplanted on beds, apply and incorporate after bed formation. .

Preeihergence: Apply jib the soil surface at pl^MingJbeh^d^fhe-planier). or fter planting,: but beforeweeds or crop emerge; j

'Table '2: Stalwart Xtra - Preplant Surface, Preplant Incorporated, or'Application '

!

I

Soil TextureCOARSESand, loamy sand, sandy loamMEDIUMLoam>'silt loam, silt • tFINESandy clay loam, silty'clay loam/ clayloam, sandy clay,' silty, clay, clay .Muck or peat soils '(more than 20% organic matter)

Preemergence Rates of

Broadcast Rate jPer AcreLess Than 3%

Organic Matter

13 qts

,: . > l-6qts,. .:.

2.1 qts.

j 3% Organic Matteror Greater

16 qts

. ij .. ,.. =^^-., ; . x - , - '; A. ;2.iqts. , ,

B: 2jl-2.6,qts:?

. . DONOTUSE : . .. •. • I

*Fqr cocklebur, yellow; nutsedge, and velvetieaf control on fine-textured soils above 3% organicmatter: Apply 2.6 qts! of Stalwart Xtra per acre. I

'A. Do hot exceed this rate on highly erodible land with less than 30% plant residue-cover.Cdntrol'ofcertain weeds may be reduced and a tank mix partner or an application of a1 pos1:emergencefherbieide

B. Do not exceed mis rate on soils that are not highly erodible or on highly erodible soils if at least30%'bf^thesoilis cpvered;mthplant'residue; ' ;| 1;

ISfotes: (1*) In the event of escape,of annual weeds following,an early preplant, preplant surface,? • • - -:,*.; i" >/.": A, }J ' ••' ' ' .. • • ! • ' , - ; ' • • . • ' . -A -r . "*- '^"'\?:^'' > i " . • • " ' • • ~ - " ' • - ' • ' .-'' '' "., '• <-'.it"1' ".,- '••^•-^" J '•*•."».' ':'"r^ '.• '• , '<••• "'• - •*-.' ~ ,•*•". ' - " . "• '~-". • - • • - * '

preplant incorporated, or preemergence treatment of Stalwart Xtra applied] alone or in combination,follow with-a post-e*mlergfrteeappSeatibn of-ah'appropriate^herbMde, i.e;, atraz%e;*psriinisul^behtazone (Basagran)j brombxynil (Brominal or Buctril), primisulfuron-metiiyl + prosulfuron

Stalwart Xtra-; ' Page 17

(Exceed), atrazine + dicamba (MarKsman); or 2,4-D If the postemergence treatment includes theherbicide used in the earlier treatment, do not exceed the labeled rate for corn on a given soil texture(2)JBromoxynil may bej applied postemergence alone or in tank mix combination with atrazine Donot exceed 12 Ibs a i /!A of atrazine in tank mix combination with bromoxyml postemergence Referto the atrazine, and bromoxyml labels for specific rates and precautions (3) If atrazine or anotherproduct containing atrazine is^used. postemergence following application of Stalwart Xtra, do notexceed%total/>f 2.5Tlbsj. a i / A of atrazine^per year (4) Substitute a fluid fertilizer for some of all of thewater carrier for bumdown of existing annual weeds listed on this label up to the 2-leaf stage ofdevelopment The addition of crop oil concentrate to the spray mixture will enhance the burndownactivity If larger weeds are present, add a contact herbicide as noted in the Stalwart XtraCombinations section 'of this label*.« i i

Postemergence Broadcastk < •> ** |,i }

If you apply this product early postemergence, use the appropriate rate from Table 3 Apply post-emergence treatments of Stalwart Xtra using water only as the earner Apply this treatment beforegrass'and'broadleaf weeds'pass the 2-leaf stage and before corn exceeds 5 inches in heightApplication'to weeds'-larger-than the 2-leaf stage will generally result in unsatisfactory controLOccasional corn leaf btirn< may result, but%is sho'uld not affect later growtfrdr yield? EJo-nWapplypostemergence in fluid* fertilizer, or severe crop injury may occur -:

J *j Nojte: To avoid possible illegal residues, do not graze or feed forage from treated argias;JdTr;|>Q .daysfollowing application '

Table 3: Postemergence Broadcast Rates of Application - i ; ,i i ,,; ;_ uSjofl Texture \COARSE ' 1

Sand, Iqamy sand, sandy floamMEDIUM i i ,Loam, silt loam, silt i '

Sandy day loam, silty day loam, day loam, sandy day, silty day, day

' BiiaaMipi '•SW^Sre

1.6 qts.

2:1 qts;

.::;;2^qts/.v_

*For better residual control^ of cocklebur, velvetieaf, and yellow nutsedge oh/me-fei^re$ 'soils, above3% organic matter, apply] 2.6 qts of Stalwart Xtra per acre

Notes: (1) If no atrazine was applied, prior to corn emergence, apply a maximum of 2 Ibs ai/Abroadcast If a postemergence treatment is'required following *an earlier herbicide application, thetotal atrazine applied may not exceed 2 5 Ibs ai/A per calendar year (2) If atrazine or atrazine plusmetolachlor tank mixture's have been applied early preplant, preplant surface, preplant incorporated,or pre-emergence, limijt'the Stalwart Xtra early post application not to exceed a total of 2.5 Ibs. ofactive ingredient in atrazine or 3 75 Ibs of the active ingredient metolachlor per acre, or illegalresidues may result

I i . , . , . . • .

Postemergence-Prrectedi

Stalwart Xtra may be applied at 1 3-2 6 qts /A in a minimum of 15 gals of water as; a. postemergence-directed treatment to corn to extend control of weeds Apply using the appropriate rate from Table 4.

For best results, apply Stalwart Xtra to weed-free soil following use of a preplant surface, preplantincorporated, or preem^rgence herbicide, or following a lay-by cultivation. If weeds have emerged atthe time of Stalwart Xtica application, apply before grass and bfoadleaf weeds exceed the 2-leaf stage.Application to weeds larger than the 2-leaf stage will generally give unsatisfactory control. Apply to

cStalwart Xtra

corn not exceeding 12 inches in height Minimize contact with .corn leaves. Do not applypostemergence m fluid fertilizer, or severe crop injury may occur. .

Note To avoid possible illegal residues, do not graze or feed fofage'from--treated'areas for 60; daysfollowing application

/Page 18

Tablejl: .Postemergence-Directed Rates of Application ^ , , ^ , t ^. : ; ; r ; ,j4, ,Soil Texture i r-.i. :>,- . . . ,COARSESand, loamy sand, sandy loamMEDIUMLoam, silt loam, silt iFTNE - ;Sandy clay loam, silty clay loam, clay

-- .'

loam, sandy clay, silty clay, clay ,

- ; Brbadcast;Rateil?er: Acre

'.-" •, \ \ • - - • - ' '• .•• >'->"', ''*,•" -'•'-•• -~ '! i ' .. '•'•'.•; ;' i. -*-'- '. "i? * fc* 0. f •-j,"1*:..'.".,': . - -\.

,:.!.:, ,/^^,,'J;„ | 2.1-2.6 qts.*

For better residual control of cocklebur, velvetieaf, and yellow nutsedge on fine-textured soils above3% organic matter, apply 2 6 qts of Stalwart Xtra per acre

Notes (1) If no atrazine was applied prior to corn emergence, apply a maximum of 2 Ibs ai/Abroadcast If a postemergence treatment is required following an earlier herbicide application, thetotal atrazine applied may not exceed 2 5 Ibs ai/A per calendar year (2) If atrazine plus metolachlortank mixtures have been applied preplant surface, preplant incorporated, or preemergence, limit theStalwart Xtra post-directed application not to exceed a total of 2 5 Ibs of the active ingredient atrazineor 3 75 Ibs of the active ingredient metolachlor per acre on a corn crop, or illegal residues may result.

STALWART

Always follow label instructions for tank mix products when mixing with Stalwart Xtra.

* When tai\k mixing Stahyart Xtra with atrazine formulations,Limitatipns section of this label. Do not exceed the following:

On highly erodible land with less than 30% plant residue cdvefprior to crop emergence . . . . . .On" other land'prior to 'crop emergencePostemer erice*appli cations only v- any landPreemergence + postemergence applications

1.6 Ibs

2.0 Ibs2.0 Ibs2.5 Ib's

. a.i. of atirazihe

. a.i. of atrazine: a.i. of atrazine. a.i. of atrazine

1. Tank Mixture with Atrazine, Metolachlor (Sjaljva^t gC), Sunazine! (Sim-Tr01)>, orIsoxaflutole (Balance) - Conventional Tillage ,

Note: Check the compatibility of Stalwart Xtra tank fruxtees ^tank by using the procedure described under AppUirafitfri^in4Vat

Atrazine (4L or 90DF): Add up to 1 0 qt of Sipcam Atrazine 4L (1.1 Ibs. of 90DF) pelr'acreip fhe^rafe ofStalwart Xtra specified in Table 3 in the southeastern U.S. where high rainfall can shorten theduration of control of broadleaf weeds, and in all areas where heavy infestations of cpcklebur,, ^morningglory, velvetieaf, or other broadleaf w^eeds claimed are expected; 'i

Metolachlor Products: Add up to 0.33 pt. of Stalwart C per acre (0.32 Ib. ai metolachlor) to the rate ofStalwart Xtra specified in Table1 3 when heavy infestations of yellow nutsedge, sandbur, or seedlingjohnsongrassiare expected. , ' :j -

Stalwart Xtra?; j ; Page 19

Simazine (4L or 90DF):lA'dd up to 1 0 qt of Sim-Trol 4L (1 libs of Sim-Trol 90DF) per acre to the rateof Stalwart Xtra specified, in Table 3 where heavy infestations of crabgrass or fall parucum areexpected or additional control of certain broadleafs is desired

IsoxafLutole (Balance) ^Field Corn Only): The tank mixture of Stalwart Xtra + isoxaflutole providescontrol of weeds listed on the Stalwart Xtra label, certain weed biotypes resistant to ALS-mhibitorherbMdes'and'to tnazmejherbicides; velvetieaf, and^others on the respective product labels•IsoxMLutole will contfibute!to the control of problem grass and other broadleaf species'on its labelApplication may be preplant^stirfaceiappliedkip to 14" days before planting), preplant incorporated,or.pTeeinergence in convenuonartillage/iconservation tillage, and^no-tiUhsystems Referto Table 1:Stalwart Xtra - Early Preplant for the early preplant application rate (8-14 days before planting) orrefer to Table 2 for; the (appropriate rate for preplant (surface-applied 0-7 days before planting),preplant incorporated,'oripreemergence application Refer to the Applicatiojn Procedures and TankMix Directions on the isoxaflutole label/Hutfo reduce the potential for injury from isoxaflutole

£ AV **"»• ! #%* 1 -t'1 /%» "* 4T " 4^V"^" "~ ^ ~ ^ *. ~ ~* ^"*~ ** ^ f

contact with corn, use 1 0|oz /A of isoxaflutole on coarsed-textured soils and 1 0-1 5 oz /A on medium-and fine-textured soils in conventional, conservation, and no-tillage systems For early preplantapplicatioris'8i14 days before planting, acid 0 5 oz / A of isoxaflutole to the rates of isoxaflutoledescribed above. j

Observe all applicable directions, precautions, and limitations on the Stalwart Xtra arid isoxaflutolelabels when applying mese prdducts'in tank mix combination in states where isoxaflutole isregistered Where difficult spe"cies and/ or s'evere weed populations are expected, use the maximumrates of Stalwart Xtra and isoxaflutole where rate ranges are listed for the tank mixtureo! v ; It' <

2. Tank Mixture of Sjtalwart Xtra Alone or Stalwart Xtra + Atrazine, Isoxaflutole (Balance),

•ft-

or No-Tillage Systems

In mmimum-tillage or ho,-tillagetsysterrtS5 where corn is planted directly into a cover crop, stale, seedbedyestabhshed sod,[ or. previous ,crop residues, the contact herbicides paraquat, 2,4-D +glyphosate, or glyphoS|te should be tank mixed with Stalwart Xtra alone or with Stalwart Xtra +atrazine, isoxaflutole, metolachlor, or simazme When used as directed, the paraquat portion of thetank mixture controls most emerged annual weeds and suppresses many perennial weeds 2,4-D +glyphosate or glyphosate combinations will control emerged annual and perennial weeds whenapplied as directed on itsi label The Stalwart Xtra portion of the tank mixture provides preemergencecontrol of the weeds listecl on this label in the Stalwart Xtra Alone section for com The addition ofatrazine, isoxaflutole, metolachlor, or simazine offers the advantage^mdicated for each under TankMixture with Atrazine, Metolachlor (Stalwart C), Simazine (Sim-Trol), or Isoxaflutole (Balance) -QjnwHtitip:|il Tillage section.

Application: Apply before, during^ or after planting, but before corn emerges, at the appropriate ratein Table 7 Up'to 1 0 qtj of Sipcam Atrazine 4L (11 Ibs of 90DF), or 1 0-2 0 oz of isoxaflutole (refer toTank Mixture with Balance for specific rate), or 0 33 pt of metolachlor (Stalwart C), or 1 0 qt of Sim-Trol 4L (11 Ibs of Sim-Trol 90DF) per acre may be added to the rate of Stalwart Xtra specified inTable 7 Add paraquat] 2,4-D + glyphosate, or glyphosate at labeled rates Tank mixtures withisoxaflutole (Balance) can only be used on field corn.

^^ -

cStalwart Xtra, Page 20

3. Tank Mixture of Stalwart Xtra Alone or Stalwart Xtra + Atrazine, 'or Isoxaflutole(Balance), with 2,4-D or 2,4-D + Dicamba (Banvel) for Minimum-Tillage or No-TillageSystems |

iIn rtunimum-tdlage or no-tillage systems "where corn is planted directly into a cover crop, staleseedbed, established sod, or previous<crop residues, Stalwart Xtra may be applied in combinationwith atrazine or isoxaftutole rWhen used as directed, thevStalwart Xtra portion of the tank-mixtureprovides preemergence control of the weeds listed on this label* in the Stalwjart Xtra Alone section forcorn The addition of atrazineTor;isoxaflutole offers the advantage indicated (for each under TankMixture witrrAtrazine, MetolacKlor, Simazine, or Isoxaflutole (Balance) -section.

Conventional Tillage

Application: Apply Stalwart Xtra before, during, or after planting, but before corn emerges, at theappropriate rate'in Tatjle 5 Up,to 1^0 qt of Sipcarri Atrazine 4L (1 1 Ibs of 90DF) or 1 0-2 0 oz ofIsoxaflutole (refer to Tank Mixturewith Isoxaflutole (Balance) for specific rate), per acre may bea'd'decl to the rate of Stalwart Xtra specified'in Table 5 ' '

Where heavy crop residues exist, add an appropriately labeled 2,4-D arrune or low volatile ester.to thespray tank last and apply in a minimum of 25 gals, of carrier per acre. |

As earners, nitrogen solutions $nd complete liquid fertilizers, applied before corn emergence,enhance* burndown of existing weeds, and therefore are recommended instead of> water Add X-77®surfactant at 1 0-2 0 qts /100 gals of diluted spray, or another surfactant cleared for use on growingcrops at its recommended rate Apply before weeds, exceed 3 inches in height If alfalfa isjpresent, adddicamba (Banvel) to the spray mixture at 0 33-0.5 pt /A and apply before alfalfa exceeds 6 inches inheight- I j '

1 -" 1 * * !

t IJor- fields with existing sod-grasses (e^ g , bromegrass, orchardgrass, rye, or timothy), when existingweeds exceed 3 inches iin Keight or when very dry conditions exist, add paraquat (Gramoxone Inteon)at the rate of 2 5 pis./ A in place of, or in addition to, 2,4-D, as indicated above Do not apply paraquatin suspension-type liquid fertilizer (using clay suspending agents), as the activity of paraquat will bereduced. Observe all directions for use, precautions, and limitations on the respective product labelswhen applying-these products in tank mix combination ,

Table 5: Stalwart Xtra for Minimum:Tillage or No-Tillage Corn i

Soil Texture•v-" -- 4

COARSESand, loamy sand/san

t

ly loamMEDIUMLparn, silt loam, silt iFINESandy clay loam, silty Iclay loam, clay loam, sandy clay, silty clay,day

f • ,Muck or peat soils

Broadcast Rate* Per Acrei

ii

16 qts

.! , 2icits,A.

B.

2.1 qts.

2.1-2.6 qts *

j DO NOT USE

*Forcocklebur, yellow; nutsedge, and velvetieaf control on fine-textured soils-above 3%,organicmatter: Apply 2.6 qtsj of Stalwart Xtra per acre; ^ ^

Ai Do not exceed this rate onihighly erodible land with-less'thaniSO^; plant residuereover. (Sontro^ofcertain weeds may be reduced and a tank mix partner or an application of a postemergenee herbicidemay be needed. ;

Bi Use this rate for all other applications.

Stalwart Xtra^ '

rPage;-2l

. .u"4. Tank^Mixture with tinurpn* (Lorox) for Control of Lambquarters and Pigweed

Fpr-prolonged control p|jlambsquarters and pigweed in DE, MD, NJ, NY, PA, VA, and WV, StalwartXtra may be applied pijeemereence in tank mix combination with hnuron Apply Stalwart Xtra

y^jltj-^r- TrjS^-t >Jt £ f- % JL f t^ | -t j, t/ £Ji f i *?* ^ Xl"" -i^ *

according to the rates>mTable 2 and knurori according to the following rates

Sjoajrexture 4l J - ) J M • ^ .LJJSjndyJoam (1-3%, ojg^ruc matter) v ,Sgndy lQam. 5^6 "orgaguc matter)

3

Med.iuî7aand fuie-textijred^gils ~(J-6 %jorgaiuc matter)

s Broadcast Rate Per Acre0671b Lorox*1 0 Ib Lorox*

t 1.0 Ib Lorox**6rêqTUvalent kruiron fbrmxilatiqn, oriefpJL of (Lorox L equals 1 0 Ib of Lorox DF—, ^ i

Follow instructions and1 precautions on the Stalwart Xtra and linuron labels when tank mixing theseproducts i J

Rotational Crops: Follow the crop rotation instructions in the Stalwart Xtra Alone section for corn.i, i

5. Tank Mixture with1 Pêsdtrione"(Callisto®)—- - < "- H r *,,

For preemergence cpnteolôf weeds in corn, §talwart Xtra may be applied in combination withmesotnone Apply Stalwart Xtra according to the rates in Table 2 and mesotnone at a rate of 5 0-6.0

^ f JTi \ *, ^ -f -* *; C7 -P-? iê n •*

•r s fl:ozr/Â. pbserveâll directions for use/precautions, and limitations on the respective product labelswhen applying these^ products in tank mix combination

'i6. Tank-vMixtures For Ppstemergence Salvage-Weed Control in Field Corn Only

For p*ostemergence control"5f weeds in'speofic types bf field corn, the Stalwart Xtra combinationslisted below may* be lisjedl Full season weed'control from early pfeplant, preplant incorporated, or

* preemergence treatments! caniead-tojmaximum yield potential under competition-free'conditions.Hovrever, if control of emerged weedsîs needed, a postemergelnce prbgram'listed below^ can^beapplied, to.provide resiidu'al control for the remainder of the season.

i f f 'Notes:<(l) Follow^ all'laBel^directibns, instructions, precautions, and limitations for each product used.J(2J Do not use fltud'fef tilikelr^dtK'these^mixture's or corn injury may occur. (3) For each tank mixturewith Stalwart Xtra, ap~ply only to the specific field corn type specified on the tank mix product label.(4) In-row weed control may be reduced because of lack of coverage when applied to corn over 4inches tall.

- il

f


a. Stalwart Xtra + Liberty Herbicide: Postemergence, Use in LibertyLink® Corn or Corn Warrantedby Bayer CropScience as Being Tolerant to Liberty Herbicide - The tank mixture of StalwartXtra + Liberty Herbicide can'be' applied postemef gerice to weeds and cotfi from seed designatedas LibertyLink of corn warranted by Bayer CropScience as being tolerarit to Liberty HerbicideLiberty provides postemergerice controrb'f a'broad spectrum of grass and broadleaf -weeds andthe Stalwart Xtra provides residual control of grasses and broadleaf weeds listed in the labelsection Stalwart'Xtra Applied Alone - Weeds Controlled. For the proper rate of Stalwart Xtraapplied postemergence, refer to Table 3 and use the minimum rate per sjoil texture for seasori-longresidualcontrol. Refer to the Liberty label for the Liberty postemergerice application rateaccording-to weed species and their maximum height at the time of posiemergence application.Where multiple weed specie's are present, use*1he highest Liberty rate specified' to control thespecies and growth stages.present. , !

Follow all applicable use directions, limitations, precautions, and information regardingapplication to corn,on the Stalwart Xtra and Liberty Herbicide labels

b. Stalwart Xtra + Glyphosate (Roundup Ultra) f or fPostemergence Application to Corn with theRoundup Ready® Gene - The tank mixture of Stalwart Xtra + Rounduppostemergence to weeds and to com designated as containing the Roundup Ready GeneApplication may be* applied postemergerice to Roundup Ready'corn upThis mixture wilKp'rovide postemergence'control of weed species on''the

Ultra can be applied

to 12 inches in heightRoundup Ultra'label and

also residual control of weed species on the Stalwart Xtra label Use the jminimum Stalwart Xtrarate postemergence with Roundup Ultra in Roundup Ready corn as specified in Table 3 of thislabel according to^dil texture Refer to thV Supplemental Labeling of RJoundup Ultra forPostemergence Application to Corntwith the Roundup*Ready Gene and to each product labeland follow all appropriate >use directions, applicatK>ntprocedures, precautions, and limitationsApply 24-32 fl oz / A of Roundup Ultra for control of labeled broadleaf land grass weeds Refer to

Roundup Ultra label for directions for control of problem species j

Follow all applicable use directions, limitations, precautions; and information regardingapplication Jo corn, on the Stalwart Xtra and Roundup JJltra labels, and on the SupplementalLabelingiOf Roundup Ultra for Postemergence Application to Corn with the Roundup ReadyGene Where difficult species and/or severe weed populations are expected, use the maximumrate where rate ranges are listed i

I • • - . , _ .

c. Stalwart Xtra + Exceed: Apply 1.33-1.75 qts./ A of Stalwart Xtra + 1.0 oz./A of Exceed to corn thatis 4-12 inches tall, "the application may be broadcast, semi-directed, or directed. The Stalwart Xtrarate is based on soil texture,, with 1.33 qts./A on coarse, and 1.75 qts./A :©n medium stud fine soils.Add a nonionic surfactant at 0.25% v/v. |

This mixture is effective for control of many annual.broadleaf weeds and some grasses. A fewinstances of broadleaf >yeed control antagonism have been observed with this combination. Control ofcertainannual grasses jean be improved with the addition of Accent. j

d. Stalwart Xtra + Exceed + Accent: Apply the same rates of Stalwart Xtrajand Exceed as mentionedabove. Add Accent at 033 oz./A for more effective control of certain annual grasses. Apply tofield corn between|4 and 12 inches. Add a nonionic surfactant at 0.25% v/v. The use of fertilizer orcrop oil concentrates with this combination may cause injury to corn.

e. Stalwart Xtra + Spirit® - Spirit herbicide at 1.0 oz./A can be substituted in place of Exceed in theabove combinations in field com only.

rStalwart Xtra Page 23

Nqtes: Do not use fertilizer or crop oil concentrate with these mixtures or injury to field corn mayoccur The combination of Stalwart-Xtra with other products'*for postemergence weed control in cornis generally not recommended These combinations may cause injuryxand/or weed control concernsJthat would not exist whenjthe products are used separately. A certain inherent risk is involved withthe various combinations of *these products usedpostemergence in corn [It should be noted that earlypreplant, preplant incorporated, orpreemergence control of these weeds would usually provide moretimely .weed control resulting in higher yields than postemergence treatments ]

T'l '!

Mixing Order , ,

Add these products (Tank Mixtures c, d/and e) to the tank mix in-the following order:f f - . ' -

1. Products in wateiYSoluble bags should be added first.

2. Stalwart Xtra. j ii ' . - . , . . • . . . .

3 Additives |

Precautions (1) Follow all label instructions, precautions, and rotational restnchonsfpmndiv^dualfp.rlgductswhenjnaking these applications to field corn When Stalwart Xtra is applied after ]uneflQ}frQ^^uryFrnayoccur the following year if you rotate to crops other than corn or sorghum (2) In-row.weed controlmaySereduced because of lack oficoverage when applied to corn over 4 inches tall

(Stalwart Xtra, j Page 24

i STORAGE AND DISPOSALDo not contaminate "water, food, or feed by storage or disposal IPesticide Storage ThiS!prbduct"may be stored at temperatures down to -30°F For mmor spills, leaks,etc * follow all'precauuons indicated on this label and clean up immediately. Take special care toavoid contamination of equipment and facilities during cleanup procedures and disposal of wastes.Pesticide Disposal: Wastes resulting^ from'the use of thisproduct are toxic Improper1 disposal ofunused pesticide, spray mixture, or rmsate is a violation of federal law Pesticide, spray mixture, orrinsate that cannot be used according to label instructions must be disposed of according'tb federal,state, or localfprocedures. JFor guidance inproper-^disppsal methods, contact your State<Pesticide orEnvironmental Control Agency, or the Hazardous Waste representative at'the nearest EPA RegionalOffice. Open dumping is prohibited.Container Disposal: j . • • . . . : : - . • • - .Containers < 5 Gallons: Non-refiilable container. Do not reuse or refill this container. Triple rinsecontainer (or equivalent) promptly after emptying. Triple rinse as follows: Empty the remainingcontents into application equipment or a mix tank and drain for 10 seconds after the flow'Beginsfto'"drip. Fill 'the container, Vi full wim'waêrând'recap SHake for 10 seconds. Pour-rinsate into applicationequipment or a mix tank or store rinsate for later use or disposal. Drain fort10'secorids after'the flowbegins to drip. Repeatithis procedure two'more times. Offer for recycling, if available; or punctureand dispose of in a sanitary landfill, by incineration, or if allowed by state and local authorities, byburning. If burned, stay out of smoke. jMinibuik Containers: Non-refiliable container. Do not reuse or refill thislcontainer. Triple rinsecontainer (or equivaleiit) promptly after emptying. Triple rinse as follow: Empty, the remainingcontents into applicatibri equipment of a mix tank. Fill the container Â full with water. Replace andtighten closures. Tip container on its side and roll it back and forth, ensuring at least one completerevolution, for 30 seconds. Stand the container on its end and tip it back and forih several times.Turn the container over onto it other end and tip it back and forth several times. Empty the rinsateinto application equipment or a mix tank or store rinsate for later use or disposal. Repeat thisprocedure two more times, then offer for recycling if available or puneturejand dispose of in asanitary landfill, by incineration, or if allowed by state and local authorities! by burning. If burned,stay out of smoke. jBulk Containers: Refillable container. Refill this container withpesticide only. Do not reuse thiscontainer for any Other purpose. Cleaning the container before final disposal is the responsibility ofthe person disposing of the container. Cleaning before refilling is the responsibility of the refiller. Toclean the container before final disposal, empty the remaining contents from thiscontainer intoapplication equipment or mix tank. Fill the container about 10 percent full- with water. Agitatevigorously or recirculate water with the pump for 2 minutes. Pour or pump rinsate into applicatibnequipment or rinsate collection system. Repeat this rinsing procedure two-more times. When thecontainer is empty, replace the cap and seal all openings that have been opened during use; andreturn to the point of purchase, or to a designated location named at the time of purchase of thisproduct. Prior to refilling, inspect carefully for damage such as craeks,puriGtures; abrasions, worn-outthreads and closure devices. Check for leaks after refilling and before transporting. Do not transport ifthis container is damaged or leaking. If the container, is damaged or leaking!, call Chem-Trec. If thecontainer is damaged and leaking or material has been spilled, follow these! procedures:• Cover spill with absorbent material. f• Sweep into disposalicontainer. j• Wash area with detergent and water and follow with clean water rinse. I• Do not allow to contaminate water supplies. j» Dispose of according to instructions. ! __


If not returned to the point of purchase or to a designated location, clean empty container as• instructed above and offer for recycling. Disposal of-this container must be in compliance with stateand local regulations. I. !

NOTICESipcam Agro USA, Incl warrants that this product conforms to the chemical description on the labelthereof and is reasonably'fit for purposes stated on such label only when used in accordance withdirections under normal use conditions. It is impossible to eliminate all risks inherently associatedwith use of this product. Crop injury, ineffectiveness or other unintended consequences may resultbecause of such factors las weather conditions, presence of other materials, or the mariner of use orapplication, all of which are beyond the control of SIPCAM. To the extent permitted by law, in nocase shall SIPCAM be liable for consequential, special or indirect damages resulting from the use orhandling of this product. To the extent permitted by law, all such risks shall be assumed by the Buyer.SIPCAM MAKES NO WARRANTIES OF MERCHANTABILITY OR FITNESS FOR A PARTICULARPURPOSE NOR ANY OTHER EXPRESS OR IMPLIED WARRANTY EXCEPT AS STATED ABOVE.

}

, j

Stalwart and Sim-Trol are registered trademarks of Sipcam Agro USA, Inc.Beacon, Callisto, Concep,jExceed; and Grainoxone are registered trademarks of Syngenta Group

Company iAccent/ and Lorox are registered trademarks of E. I. duPont de Nemours and Company, Inc.Ag^-Chem RoGator is a registeredtrademark of Ag-Ghem Equipment CompanyAgsofb is aregisteredtrademark of Oil-Dii CorporationBahvely 'Basagrahi-and Miark^man are registered trademarks of BASF CorporationCelatom MP-79 is ati-adtemark of Eagle-Picher.Industries, Inc.COmpeX is a registered jfrademark Of >KALO Agricultural Chemicals, Inc.Hi-Cycle1™ is a trademark Of John Deere CompanyLandrnaster, Roundup, Rbundup Ready, Roiuidup Ultra and Screen are registered trademarks of

Monsanto Company' |Balance, Brominal> Buctiil, Liberty, and LibertyLink are registered trademarks of Bayer CropScienceTyler Patriot™ is a trademark of Tyler Ltd. PartnershipUnite is a registeredtrajdemark of HACO, Inc.Willmar Air Ride is a registered trademark of Willmar ManufacturingX-77 is a registered trademark of Loveland Industries, Inc.

office of chemical safety and pollution prevention …€¦ · office of chemical safety and...

Documents