nilvadipine antagonizes both aβ vasoactivity in isolated arteries, and the reduced cerebral blood...
TRANSCRIPT
www.elsevier.com/locate/brainres
Brain Research 999 (2004) 53–61
Research report
Nilvadipine antagonizes both Ah vasoactivity in isolated arteries,
and the reduced cerebral blood flow in APPsw transgenic mice
Daniel Paris*, Amita Quadros, James Humphrey, Nikunj Patel, Robert Crescentini,Fiona Crawford, Michael Mullan
The Roskamp Institute, 2040 Whitfield Avenue, Sarasota, FL 34243, USA
Accepted 4 November 2003
Abstract
The development of Alzheimer’s disease (AD) is generally thought to correlate with cerebral accumulation of Ah. It has previously been
shown that Ah peptides enhance vasoconstriction in isolated arteries and oppose certain vasorelaxants. Moreover, exogenous application of
Ah peptides causes cerebral vasoconstriction in rodents and in transgenic mouse models of AD that overexpress Ah there is reduced cerebral
blood flow. In the present study, we investigated the effect of nilvadipine, a dihydropyridine-type calcium channel blocker, on Ah induced
vasoconstriction in isolated arteries and in vivo on cerebral blood flow (CBF) of an AD transgenic mouse model overexpressing Ah (Tg
APPsw line 2576). Nilvadipine completely inhibited the vasoactivity elicited by Ah in rat aortae and in human middle cerebral arteries. The
effect of a short treatment duration (2 weeks) with nilvadipine on regional CBF was investigated in 13-month-old Tg APPsw mice and
control littermates using a laser Doppler imager. Additionally, CBF was also measured in 20-month-old Tg APPsw mice and control
littermates that were chronically treated with nilvadipine for 7 months. Untreated Tg APPsw mice showed a reduction of regional CBF
compared to their untreated control littermates. Nilvadipine restored cortical perfusion levels in Tg APPsw to values similar to those observed
in control littermates without notably affecting the CBF of control mice. All together, these data suggest that nilvadipine might be useful for
the treatment of oligemia associated with AD.
D 2003 Elsevier B.V. All rights reserved.
Theme: Other systems of the CNS
Topic: Brain metabolism and blood flow
Keywords: Nilvadipine; Alzheimer; Abeta; Amyloid; Cerebral blood flow; Transgenic
1. Introduction gained increasing attention in recent years. Vascular pathol-
Alzheimer’s disease (AD) is the major cause of dementia
in the elderly in Western countries, and is characterized by
the progressive accumulation of intracellular neurofibrillary
tangles, extracellular parenchymal senile plaques and cere-
brovascular deposits [29]. The principal component of
senile plaques and cerebrovascular deposits is the 39–43
amino acid h-amyloid peptide (Ah), which is proteolyticallyderived from the amyloid precursor protein (APP) [20].
Morphological abnormalities of cerebral capillaries and
related deficient cerebral circulation observed in AD have
0006-8993/$ - see front matter D 2003 Elsevier B.V. All rights reserved.
doi:10.1016/j.brainres.2003.11.061
* Corresponding author. Tel.: +1-941-752-2949; fax: +1-941-752-
2948.
E-mail address: [email protected] (D. Paris).
ogy is the norm in advanced cases of AD, with cerebral
amyloid angiopathy (CAA) being one of the commonest
abnormalities detected at autopsy [6].
The association of cerebral hypoperfusion and AD is
well established [1,13,39]. Functional imaging techniques
including positron emission tomography (PET) and single
photon emission computerized tomography (SPECT) have
also revealed the existence of hypoperfusion in individuals
prior to the clinical diagnosis of AD [12,18]. Recent data
have shown that cerebral hypoperfusion may generate not
only white matter changes but also cortical watershed
infarcts, which further worsen cognitive decline in AD [36].
Ah peptides have been suggested to play a critical role in
the pathobiology of AD since all the mutations associated
with familial form of AD result in the increased production of
these peptides [34]. We have shown previously that Ah
D. Paris et al. / Brain Research 999 (2004) 53–6154
peptides synergistically enhance endothelin-1-induced vaso-
constriction [24] and that in vivo Ah can act as a cerebral
vasoconstrictor [35], suggesting that the accumulation of Ahpeptides in the brain and around cerebrovessels of AD
patients might be a contributing factor to the cerebral olige-
mia suffered by these patients. Additionally, topical applica-
tion of synthetic Ah peptides has been reported to induce
vasoconstriction in the cerebrovasculature of rodents [21].
Fig. 1. (A) Effect of nilvadipine on Ah1 – 40 vasoactivity in isolated rat aortae. Ao
nilvadipine, nilvadipine +Ah1 – 40, or untreated (control) 5 min before the addition
ET-1 dose ( P < 0.001), Ah ( P < 0.001) and of nilvadipine ( P< 0.001). There w
( P< 0.001) or nilvadipine ( P < 0.001) and among ET-1 dose, Ah and nilvadipi
between-group differences ( P< 0.001), and post hoc testing showed significant dif
( P< 0.001), but not between control and Ah + nilvadipine ( P= 0.697), control an
The symbol * on the bar graph indicates a statistically significant difference with th
in isolated human middle cerebral arteries. Human cerebral artery rings were t
nilvadipine +Ah1 – 40, 1 AM of scrambled Ah, or untreated (control) 5 min before
ANOVA of ET-1 dose ( P < 0.001), Ah ( P< 0.001) and nilvadipine ( P < 0.001) b
significant interactive terms between ET-1 dose and either Ah ( P < 0.02) or nilvad
between-groups differences ( P< 0.001), and post hoc testing showed significant
( P< 0.009) and Ah and Ah + nilvadipine ( P < 0.001), but not between control and
The symbol * on the bar graph indicates a statistically significant difference with
Ah overexpression in young (2–3 months) transgenic animal
models of AD has been shown to reduce the increased CBF
produced by activation of the vibrissae in the somatosensory
cortex, suggesting that increased Ah levels produces a
potentially deleterious mismatch between substrate delivery
and energy demands imposed by neural activity [8,11,22].
We wished to determine whether calcium channel block-
ers could oppose Ah’s vasoconstriction enhancing effects
rtic rings were treated with 1 AM of freshly solubilized Ah1 – 40, 100 nM of
of a dose range of ET-1. There were significant main effects by ANOVA of
ere also significant interactive terms between ET-1 dose and either Ahne ( P < 0.001). One-way ANOVA across ET-1 doses revealed significant
ferences between control and Ah ( P < 0.001), and Ah and Ah+ nilvadipine
d nilvadipine ( P= 0.979), or nilvadipine and nilvadipine +Ah ( P= 0.468).
e vehicle treatment ( P< 0.05). (B) Effect of nilvadipine on Ah vasoactivity
reated with 1 AM of freshly solubilized Ah1 – 40, 100 nM of nilvadipine,
the addition of a dose range of ET-1. There were significant main effects by
ut no significant main effect of scrambled Ah ( P= 0.549). There were also
ipine ( P< 0.001). One-way ANOVA across ET-1 doses revealed significant
differences between control and Ah ( P< 0.007), control and nilvadipine
scrambled Ah ( P= 0.999), or nilvadipine and nilvadipine +Ah ( P= 0.999).
the vehicle treatment ( P < 0.05).
D. Paris et al. / Brain Research 999 (2004) 53–61 55
and the reduced CBF in transgenic APPsw mice. Experi-
ments were performed ex vivo by recording isometric
tension in isolated rat aortae and human middle cerebral
arteries, and in vivo by measuring regional variation of CBF
in Tg APPsw mice and control littermates using a laser
scanner Doppler imager.
Fig. 2. Effect of nilvadipine on mean arterial blood pressure in 13-month-
old control and Tg APPsw mice. ANOVA revealed a significant main effect
of nilvadipine ( P < 0.001) but no significant main effect of genotype
( P= 0.999). Post hoc analysis showed significant differences between
control mice treated with vehicle and control mice treated with nilvadipine
( P< 0.03), Tg APPsw mice treated with vehicle and Tg APPsw treated with
nilvadipine ( P < 0.01) but no significant difference between control and Tg
APPsw mice treated with vehicle ( P= 0.999) and between control and Tg
APPsw mice treated with nilvadipine ( P= 0.998).
2. Materials and methods
2.1. Vessel experiments
Human middle cerebral arteries (HMCA) were obtained
under IRB approval following the autopsy of 4 elderly
patients (average age: 80.3F 2.9 years and average post-
mortem delay including the time necessary to perform the
autopsy: 3 h 50 minF 23 min) with no recorded cerebro-
vascular disease, including history of stroke, transient is-
chemic attacks or cerebrovascular dementia. HMCA were
first rinsed in ice-cold HBSS containing 2� penicillin–
streptomycin and washed in 50 ml PBS. Rat aortic rings
were obtained from 9-month-old male Sprague–Dawley
rats (Zivic Miller, Zelienople, PA, USA). Arteries were
segmented into 3 mm rings and suspended in Kreb’s buffer
on hooks connected to a tensiometer linked to a MacLab
system. Artery rings were equilibrated for 2 h in 7 ml tissue
baths containing Kreb’s buffer (changed every 30 min)
oxygenated with 95% O2/CO2, and thermoregulated at 37
jC. A baseline tension of 2 g was applied to each ring, 2
min prior their treatment with either 1 AM Ah (purity
greater than 95%, Biosource, California), 100 nM nilvadi-
pine, or a combination of Ah and nilvadipine. Following 5
min of treatment, artery rings were submitted to a dose
range of endothelin-1 (ET-1, Sigma, Missouri) ranging from
1 to 5 nM. Each dose of ET-1 was added only after the
constriction response to the previous dose had reached a
plateau. The specificity of the Ah vasoactive effects was
tested by employing 1 AM of scrambled Ah (VIG-
KYHGMSNLVGRSFEVHQGKGAEVDAHGLF-
DIEAFVDV, Biosource) in isolated human middle cerebral
artery. Results were expressed as the meansF S.E. of the
tension (in g) obtained for each doses of ET-1 and for the
different treatments. Similar experiments were repeated with
100 nM amlodipine and 100 nM nitrendipine instead of
nilvadipine in rat aortae.
2.2. Determination of regional CBF by laser scanner
Doppler imaging
Mice expressing mutant APPK670N,M671L (Tg APPsw
line 2576) [13] and control littermates were studied at 13
months of age (control n = 11; Tg APPsw n = 11). Control
and Tg APPsw littermates were injected subcutaneously
with nilvadipine (1 mg/kg of body weight) or the vehicle
(50% DMSO in PBS) daily for 15 days. The dose of
nilvadipine used for this study was chosen according to
previously published pharmacokinetic data in rodents
[38]. Diastolic (DP) and systolic blood pressure (SP)
was measured in 13-month-old animals with a non-inva-
sive blood pressure analyzer (Columbus Instruments,
Ohio) 10 days after the beginning of the nilvadipine
treatment (20 h after the nilvadipine or vehicle injection).
Mean arterial blood pressure (MAP) was then calculated
using the following formula: MAP= diastolic blood pres-
sure + 1/3(systolic blood pressure� diastolic blood pres-
sure). Additionally, 13-month-old control and Tg APPsw
littermates were treated daily with a subcutaneous injec-
tion of nilvadipine (1 mg/kg of body weight) or the
vehicle (50% DMSO in PBS) for 7 months.
For CBF measurement, mice were anesthetized with a
gas mixture of 3% isofluorane, 0.9 l/min nitrous oxide and
0.5 l/min oxygen. CBF measurements were made within 6
h of the last dose of nilvadipine in the 15 days treated
animals and 10 days after the last injection in 7 months
treated animals. Animals were then immobilized on a mouse
stereotaxic table and maintained under anesthesia with a
mouse anesthetic mask (Kopf Instruments, Tunjunga, CA)
delivering 3% isofluorane, 0.5 l/min nitrous oxide and 0.3 l/
min oxygen. Rectal temperature was maintained at 37 jCusing a mouse homeothermic blanket system (Harvad Ap-
paratus, Holliston, MA). An incision was made through the
scalp and the skin retracted to expose the skull. The
periosteal connective tissue, which adheres to the skull,
was removed with a sterile cotton swab. Animals were
maintained on a mixture of 1.5% isofluorane, 0.5 l/min
D. Paris et al. / Brain Research 999 (2004) 53–6156
nitrous oxide and 0.3 l/min oxygen. Cortical perfusion was
measured with the Laser-Doppler Perfusion Imager from
Moor Instruments (Wilmington, DE) as previously de-
scribed [2]. A computer-controlled optical scanner directed
a low-powered He–Ne laser beam over the exposed cortex.
The scanner head was positioned parallel to the cerebral
cortex at a distance of 26 cm. The scanning procedure took
1 min 21 s for measurements of 5538 pixels covering an
area of 0.8� 0.8 cm. At each measuring site, the beam
illuminated the tissue to a depth of 0.6 mm. An image color-
coded to denote specific relative perfusion levels was
displayed on a video monitor. All images were acquired at
2-min intervals for a period of 30 min (15 images for each
animal). All images were stored in computer memory for
subsequent analysis. For each animal, a square area of 0.05
Fig. 3. (I) Two-dimensional color-coded microvascular flow maps of the brain of
Laser Doppler imaging flow data depicting the variation of regional CBF in the co
Tg APPsw mice treated with nilvadipine (D). (II) Effect of nilvadipine on the CBF
of genotype ( P< 0.001), of area of the brain examined ( P < 0.001), of nilvadip
( P< 0.002) and between genotype and nilvadipine ( P < 0.001). Post hoc analysis
and Tg APPsw ( P < 0.001), parietal cortex of control and Tg APPsw ( P < 0.00
differences were observed between control animals treated with the vehicle only
entire, parietal and occipital cortex ( P= 0.999; P= 0.992; P= 0.999) showing that
significant differences between Tg APPsw mice treated with the vehicle only and T
parietal and occipital cortex ( P < 0.003; P < 0.001; P< 0.001). However, no signif
with nilvadipine for the CBF measured in the entire, parietal and occipital cortex (
of Tg APPsw mice to values similar to those observed in control mice.
cm2 (360 pixels) equally distributed between the right and
left hemispheres was defined and applied to each image of
the series in order to measure the CBF in the parietal and
occipital cortex using the MoorLDI Image Processing V3.0h
software. CBF was also measured in the entire cortex by
manually delineating for each mouse the cortex area (0.51–
0.54 cm2 corresponding to 3504–3714 pixels). Relative
perfusion values for each area studied were normalized
against the CBF values obtained in untreated control mice
and expressed as a % of control CBF. At the end of the
procedure, arterial blood samples were collected from the
left carotid of the animals in order to assess physiological
parameters ( pCO2, pO2 and pH) using a PhOx2 blood gas
analyzer (Nova Biomedical, Waltham, MA). The pCO2 of
control 49.4F 3.4 and Tg APPsw 50.1F 3.9 mm Hg; the
13-month-old control and Tg APPsw recorded with a laser Doppler imager.
rtex of control (A), Tg APPsw (B), control treated with nilvadipine (C) and
of control and Tg APPsw mice. ANOVA revealed a significant main effect
ine ( P< 0.001) as well as an interactive term between genotype and area
revealed a significant difference between CBF in the entire cortex of control
1), occipital cortex of control and Tg APPsw ( P< 0.001). No significant
and control animals treated with nilvadipine for the CBF measured in the
nilvadipine does not affect CBF in control mice. Post hoc analysis showed
g APPsw mice treated with nilvadipine for the CBF measured in the entire,
icant difference were observed between control and Tg APPsw mice treated
P= 0.999; P= 0.999; P= 0.812), showing that nilvadipine increases the CBF
Fig. 3 (continued).
D. Paris et al. / Brain Research 999 (2004) 53–61 57
pO2 of control 95.3F 9.1 and Tg APPsw 101.8F 9.2 mm
Hg; the pH of control 7.20F 0.03 and Tg APPsw
7.22F 0.05 were comparable to regular physiological var-
iables usually recorded in mice [28].
2.3. Data analysis
Data are expressed as meansF S.E. Multiple compari-
sons were evaluated by analysis of variance and post hoc
comparisons performed with Scheffe’s method using SPSS
V11.0 for Windows. Probability values less than 5% were
considered statistically significant.
3. Results
The effect of nivaldipine on the vasoactivity elicited by
freshly solubilized Ah1–40 was investigated in isolated rat
aortae and human middle cerebral arteries. Nilvadipine
appears to potently inhibit the enhancement of endothelin-
1 (ET-1) induced vasoconstriction by Ah in isolated rat
aortae (Fig. 1). Nitrendipine and amlodipine (100 nM)
inhibited the vasoactive effect of Ah in isolated rat aortae
to an extent similar to nilvadipine (data not shown), further
suggesting that calcium channel blockers in general can
efficiently oppose the vasoconstrictive effect of Ah in rat
D. Paris et al. / Brain Research 999 (2004) 53–6158
aortae. Nilvadipine’s effect on Ah vasoactivity was further
tested in isolated human middle cerebral artery. We report
that Ah enhances ET-1-induced vasoconstriction in human
middle cerebral artery and that nilvadipine completely
prevents Ah vasoactivity in human cerebral artery (Fig. 1).
In this large human cerebral artery, nilvadipine appears to
partially oppose the vasoconstriction induced by ET-1 alone,
an effect that was not observed in isolated rat aortae,
suggesting that nilvadipine displays a more profound vaso-
dilatator action in cerebral artery compared to peripheral
vessel. A scrambled Ah peptide was used to assess the
specificity of the Ah vasoactive effect and did not affect ET-
1-induced vasoconstriction.
Next, the effect of nilvadipine was investigated in vivo in
13-month-old Tg APPsw mice and control littermates. Mice
were treated for a period of 15 days with 1 mg/kg of body
weight of nilvadipine delivered subcutaneously. After 10
days of treatment, blood pressure was monitored and a
Fig. 4. Effect of chronic nilvadipine treatment in 20-month-old Tg APPsw
microvascular flow maps of the brain of 20-month-old control and Tg APPsw recor
the variation of regional CBF in the cortex of control (A), Tg APPsw (B), control tr
(II) Effect of chronic nilvadipine treatment on the CBF of 20-month-old control an
( P< 0.001), of area of the brain examined ( P< 0.001) and of nilvadipine ( P < 0.0
entire cortex of control and Tg APPsw ( P < 0.001). No significant differences were
animals treated with nilvadipine for the CBF measured in the entire and parietal co
between Tg APPsw mice treated with the vehicle only and Tg APPsw mice treat
significant reduction of blood pressure was noticed in the
group of animals treated with nilvadipine compared with
animals treated with vehicle (Fig. 2). No difference in blood
pressure was observed between Tg APPsw mice and control
littermates. Following 15 days of treatment with nilvadipine
or vehicle, cortical cerebral blood flow (CBF) was deter-
mined using a laser Doppler imager (LDI). A reduction of
CBF was observed globally (including occipital, parietal
and frontal cortical areas) in the cortex of Tg APPsw
compared to their control littermate and most of this
reduction was due to reduction of flow in the occipital
and parietal areas (Fig. 3). Nilvadipine treatment did not
significantly affect the CBF of control animals for the
different areas of the brain examined despite the observed
reduction of blood pressure. Interestingly, nilvadipine in-
creased the CBF of Tg APPsw mice to values similar to
those observed in control animals treated with nilvadipine or
vehicle alone for the different areas of the brain examined.
and control littermates. (I) Representative two-dimensional color-coded
ded with a laser Doppler imager. Laser Doppler imaging flow data depicting
eated with nilvadipine (C) and Tg APPsw mice treated with nilvadipine (D).
d Tg APPsw mice. ANOVA revealed a significant main effect of genotype
01). Post hoc analysis revealed a significant difference between CBF in the
observed between control animals treated with the vehicle only and control
rtex ( P= 0.992; P= 0.993). Post hoc analysis showed significant differences
ed with nilvadipine for the CBF measured in the entire cortex ( P < 0.04).
Fig. 4 (continued).
D. Paris et al. / Brain Research 999 (2004) 53–61 59
The effect of nilvadipine was also evaluated in older animals
(20 months) that were subjected to a chronic treatment for 7
months from the age of 13 months. Data analysis revealed
that a chronic treatment with nilvadipine reduces the CBF
deficits observed in the brain of 20-month-old Tg APPsw
mice without affecting notably the CBF of control animals
(Fig. 4).
4. Discussion
The contribution of the vasculature to the pathophysiol-
ogy of AD is becoming increasingly recognized [5,8,14,15].
Most of the cardiovascular risk factors (such as hyperten-
sion, hypercholesterolemia, atherosclerosis, APOEq4, dia-
betes, coronary or carotid artery disease) also constitute
independent risk factors for AD, suggesting that vascular
pathologies have a profound impact on the development of
AD. In fact, peripheral vascular diseases are believed to
alter the cerebral circulation resulting in chronic hypoper-
fusion or oligemia [14]. The clinical presentation of AD is
more severe in patients exhibiting evidence of cerebrovas-
cular disease (CVD) than patients without infarcts
[7,19,32]. There is increasing evidence that hypertension
may contribute to the development of dementia
[3,16,25,27]. Interestingly, some calcium channel blockers
D. Paris et al. / Brain Research 999 (2004) 53–6160
used for the treatment of hypertension have been shown to
reduce the incidence of stroke and dementia including AD
[9,26,33], although others such as nifedipine have been
associated with decreased cognition in the elderly [17]. We
therefore tested the effect of three different calcium channel
blockers (nilvadipine, nitrendipine and amlodipine) on the
enhancement of ET-1-induced vasoconstriction induced by
Ah in rat aortae. All these calcium channel blockers
completely antagonized Ah vasoactivity in rat aortae. In
isolated human middle cerebral artery, Ah also stimulated
ET-1-induced vasoconstriction and this effect was fully
prevented by nilvadipine.
Recently, nilvadipine has been shown to increase the
CBF in ischaemic regions of the brains of patients affected
with both hypertension and chronic major cerebral artery
occlusion [23]. Moreover, nilvadipine has been reported to
have a selective effect on the cerebral artery [37] contrary to
other dihydropyridine calcium channel blocker such as
nifedipine which acts as a vasodilating agent resulting in
blood pressure reduction without affecting regional blood
flow in the brain [31].
We thus investigated the effects of a 2-week treatment
regime with nilvadipine in a transgenic mouse model of
AD (Tg APPsw line 2576). The Tg APPsw mice used for
this study develop a partial AD-like phenotype including
learning and memory deficits and pathological findings of
amyloid plaque deposition, increased Ah1–40 and Ah1–42
levels, gliosis, inflammatory responses, phosphorylated tau
epitopes, but not neurofibrillary tangles or neuronal loss
[10]. Laser Doppler imaging revealed a regional decrease
in resting CBF in 13 months Tg APPsw mice compared to
control littermates. No change in cortical CBF was notice-
able between control mice treated with nilvadipine and
control animals injected with vehicle only. However,
nilvadipine treatment increased the CBF in Tg APPsw
animals to values similar to those observed in control
animals. Similar results were observed in 20-month-old
Tg APPsw mice that were treated chronically for 7 months
with nilvadipine. The effects in the chronically treated
group were not due to the immediate effects of nilvadipine
treatment, which was discontinued 10 days before CBF
measurements were made. Our observation showing that
nilvadipine increases the CBF of Tg APPsw mice suggests
that calcium channel blockers might be beneficial in
dementia by restoring CBF in these patients. Impaired
CBF is likely to impede the optimal delivery of nutrients
and oxygen to neurons and glial cells as well as the
efficient removal of metabolic wastes. In laboratory ani-
mals, chronic hypoperfusion has been shown to lead to
memory impairment and capillary degeneration [4]. A
growing number of clinical studies have shown that CBF
reduction and hypometabolism correlate positively with
cognitive decline in AD patients [30]. However, it is still
a matter of debate whether regional hypometabolism and
hypoperfusion result from or precede the neurodegenera-
tive changes observed in AD. Resting CBF is reduced in
Tg APPsw and in another transgenic mouse model of AD
(line 2123) before the appearance of Ah deposits and
cognitive deficits [22], suggesting that CBF reduction
might precede the pathologic changes observed in these
mouse models of AD. All together, these data suggest that
the accumulation of soluble and insoluble Ah species in
the brain of these animals is sufficient to impair CBF.
Although it is not clear whether nilvadipine directly effects
CBF via the cerebrovasculature or indirectly impacts CBF
via cerebral metabolism or even the peripheral vasculature,
our data suggest that nilvadipine may be potentially useful
in the treatment of oligemia affecting AD patients.
Acknowledgements
We are grateful to Dr. Minoru Ohtsuka from Medicinal
Science Research, Fujisawa Pharmaceutical, for helpful
discussion and to Fujisawa Pharmaceutical, for providing
financial support for the completion of this study. We wish
to thank Mr. Bob and Mrs. Diane Roskamp for providing
additional support, which helped to make this work
possible.
References
[1] P. Bartenstein, S. Minoshima, C. Hirsch, K. Buch, F. Willoch, D.
Mosch, D. Schad, M. Schwaiger, A. Kurz, Quantitative assessment
of cerebral blood flow in patients with Alzheimer’s disease by
SPECT, J. Nucl. Med. 38 (1997) 1095–1101.
[2] L. Belayev, E. Pinard, H. Nallet, J. Seylaz, Y. Liu, P. Riyamongkol,
W. Zhao, R. Busto, M.D. Ginsberg, Albumin therapy of transient
focal cerebral ischemia: in vivo analysis of dynamic microvascular
responses, Stroke 33 (2002) 1077–1084.
[3] W.H. Birkenhager, F. Forette, M.L. Seux, J.G. Wang, J.A. Staessen,
Blood pressure, cognitive functions, and prevention of dementias in
older patients with hypertension, Arch. Intern. Med. 161 (2001)
152–156.
[4] G.I. De Jong, E. Farkas, C.M. Stienstra, J.R. Plass, J.N. Keijser, J.C.
de la Torre, P.G. Luiten, Cerebral hypoperfusion yields capillary dam-
age in the hippocampal CA1 area that correlates with spatial memory
impairment, Neuroscience 91 (1999) 203–210.
[5] J.C. de la Torre, Alzheimer disease as a vascular disorder: nosological
evidence, Stroke 33 (2002) 1152–1162.
[6] R.J. Ellis, J.M. Olichney, L.J. Thal, S.S. Mirra, J.C. Morris, D.
Beekly, A. Heyman, Cerebral amyloid angiopathy in the brains
of patients with Alzheimer’s disease: the CERAD experience,
Part XV, Neurology 46 (1996) 1592–1596.
[7] M.M. Esiri, Z. Nagy, M.Z. Smith, L. Barnetson, A.D. Smith, Cere-
brovascular disease and threshold for dementia in the early stages of
Alzheimer’s disease, Lancet 354 (1999) 919–920.
[8] E. Farkas, P.G. Luiten, Cerebral microvascular pathology in aging and
Alzheimer’s disease, Prog. Neurobiol. 64 (2001) 575–611.
[9] F. Forette, M.L. Seux, J.A. Staessen, L. Thijs, M.R. Babarskiene, S.
Babeanu, A. Bossini, R. Fagard, B. Gil-Extremera, T. Laks, Z.
Kobalava, C. Sarti, J. Tuomilehto, H. Vanhanen, J. Webster, Y. Yodfat,
W.H. Birkenhager, The prevention of dementia with antihypertensive
treatment: new evidence from the Systolic Hypertension in Europe
(Syst-Eur) study, Arch. Intern. Med. 162 (2002) 2046–2052.
[10] K. Hsiao, P. Chapman, S. Nilsen, C. Eckman, Y. Harigaya, S.
Younkin, F. Yang, G. Cole, Correlative memory deficits, Abeta
D. Paris et al. / Brain Research 999 (2004) 53–61 61
elevation, and amyloid plaques in transgenic mice, Science 274
(1996) 99–102.
[11] C. Iadecola, F. Zhang, K. Niwa, C. Eckman, S.K. Turner, E. Fischer,
S. Younkin, D.R. Borchelt, K.K. Hsiao, G.A. Carlson, SOD1 rescues
cerebral endothelial dysfunction in mice overexpressing amyloid pre-
cursor protein, Nat. Neurosci. 2 (1999) 157–161.
[12] K.A. Johnson, M.S. Albert, Perfusion abnormalities in prodromal AD,
Neurobiol. Aging 21 (2000) 289–292.
[13] K. Johnson, S. Mueller, T. Walshe, R. English, B. Holman, Cerebral
perfusion imaging in Alzheimer’s disease, Arch. Neurol. 44 (1987)
165–168.
[14] R.N. Kalaria, Small vessel disease and Alzheimer’s dementia: patho-
logical considerations, Cerebrovasc. Dis. 13 (2002) 48–52.
[15] T. Kudo, K. Imaizumi, H. Tanimukai, T. Katayama, N. Sato, Y.
Nakamura, T. Tanaka, Y. Kashiwagi, Y. Jinno, M. Tohyama, M.
Takeda, Are cerebrovascular factors involved in Alzheimer’s dis-
ease? Neurobiol. Aging 21 (2000) 215–224.
[16] L.J. Launer, G.W. Ross, H. Petrovitch, K. Masaki, D. Foley, L.R.
White, R.J. Havlik, Midlife blood pressure and dementia: the
Honolulu-Asia aging study, Neurobiol. Aging 21 (2000) 49–55.
[17] C.J. Maxwell, D.B. Hogan, E.M. Ebly, Calcium-channel blockers
and cognitive function in elderly people: results from the Canadian
study of health and aging, CMAJ, Can. Med. Assoc. J. 161 (1999)
501–506.
[18] K. Nagata, Y. Kondoh, R. Atchison, M. Sato, Y. Satoh, Y. Watahiki,
Y. Hirata, E. Yokoyama, Vascular and metabolic reserve in Alzheim-
er’s disease, Neurobiol. Aging 21 (2002) 301–307.
[19] Z. Nagy, M.M. Esiri, K.A. Jobst, J.H. Morris, E.M. King, B.
McDonald, C. Joachim, S. Litchfield, L. Barnetson, A.D. Smith, The
effects of additional pathology on the cognitive deficit in Alzheimer
disease, J. Neuropathol. Exp. Neurol. 56 (1997) 165–170.
[20] A. Naidu, D. Quon, B. Cordell, Beta-amyloid peptide produced in
vitro is degraded by proteinases released by cultured cells, J. Biol.
Chem. 270 (1995) 1369–1374.
[21] K. Niwa, V.A. Porter, K. Kazama, D. Cornfield, G.A. Carlson, C.
Iadecola, Abeta-peptides enhance vasoconstriction in cerebral circula-
tion, Am. J. Physiol, Heart Circ. Physiol. 281 (2001) H2417–H2424.
[22] K. Niwa, K. Kazama, S.G. Younkin, G.A. Carlson, C. Iadecola,
Alterations in cerebral blood flow and glucose utilization in mice
overexpressing the amyloid precursor protein, Neurobiol. Dis. 9
(2002) 61–68.
[23] K. Ogasawara, A. Noda, S. Yasuda, M. Kobayashi, H. Yukawa, A.
Ogawa, Effect of calcium antagonist on cerebral blood flow and
oxygen metabolism in patients with hypertension and chronic major
cerebral artery occlusion: a positron emission tomography study,
Nucl. Med. Common. 24 (2003) 71–76.
[24] D. Paris, T. Town, T. Mori, T.A. Parker, J. Humphrey, M. Mullan,
Soluble beta-amyloid peptides mediate vasoactivity via activation of
a pro-inflammatory pathway, Neurobiol. Aging 21 (2000) 183–197.
[25] S.S. Richards, C.L. Emsley, J. Roberts, M.D. Murray, K. Hall, S. Gao,
H.C. Hendrie, The association between vascular risk factor-mediating
medications and cognition and dementia diagnosis in a community-
based sample of African-Americans, J. Am. Geriatr. Soc. 48 (2000)
1035–1041.
[26] A.S. Rigaud, M.L. Seux, J.A. Staessen, W.H. Birkenhager, F. Forette,
Cerebral complications of hypertension, J. Hum. Hypertens. 14
(2000) 605–616.
[27] A.S. Rigaud, M. Olde-Rikkert, O. Hanon, M.L. Seux, F. Forette,
Antihypertensive drugs and cognitive function, Curr. Hypertens.
Rep. 4 (2002) 211–215.
[28] O.U. Scremin, D.P. Holschneider, K. Chen, M.G. Li, J.C. Shih, Ce-
rebral cortical blood flow maps are reorganized in MAOB-deficient
mice, Brain Res. 824 (1999) 36–44.
[29] D.J. Selkoe, Alzheimer’s disease: genes, proteins, and therapy, Phys-
iol. Rev. 81 (2001) 741–766.
[30] W.J. Shih, J.W. Ashford, J.J. Coupal, Y.U. Ryo, V.V. Stipp, S.L.
Magoun, K. Gross, Consecutive brain SPECT surface three-dimen-
sional displays show progression of cerebral cortical abnormalities
in Alzheimer’s disease, Clin. Nucl. Med. 24 (1999) 773–777.
[31] H. Shimamoto, Y. Shimamoto, Nilvadipine increases cerebral blood
flow in elderly hypertensives: comparison with nifedipine, J. Hum.
Hypertens. 9 (1995) 271–279.
[32] D.A. Snowdon, L.H. Greiner, J.A. Mortimer, K.P. Riley, P.A. Greiner,
W.R. Markesbery, Brain infarction and the clinical expression of Alz-
heimer disease. The Nun Study, JAMA 277 (1997) 813–817.
[33] J.A. Staessen, J.G. Wang, L. Thijs, Calcium-channel blockade and
cardiovascular prognosis: recent evidence from clinical outcome tri-
als, Am. J. Hypertens. 15 (2002) 85S–93S.
[34] H. Steiner, A. Capell, U. Leimer, C. Haass, Genes and mechanisms
involved in beta-amyloid generation and Alzheimer’s disease, Eur.
Arch. Psychiatry Clin. Neurosci. 249 (1999) 266–270.
[35] Z. Suo, J. Humphrey, A. Kundtz, F. Sethi, A. Placzek, F. Crawford,
M. Mullan, Soluble Alzheimers beta-amyloid constricts the cerebral
vasculature in vivo, Neurosci. Lett. 257 (1998) 77–80.
[36] O.C. Suter, T. Sunthorn, R. Kraftsik, J. Straubel, P. Darekar, K.
Khalili, J. Miklossy, Cerebral hypoperfusion generates cortical
watershed microinfarcts in Alzheimer disease, Stroke 33 (2002)
1986–1992.
[37] S. Takakura, Y. Satoh, H. Sato, J. Mori, M. Kohsaka, Effects of
nilvadipine on regional cerebral blood flow and skin blood flow in
anesthetized cats, Arch. Int. Pharmacodyn. Ther. 319 (1992) 38–48.
[38] Y. Tokuma, M. Sekiguchi, T. Niwa, H. Noguchi, Pharmacokinetics of
nilvadipine, a new dihydropyridine calcium antagonist, in mice, rats,
rabbits and dogs, Xenobiotica 18 (1988) 21–28.
[39] G. Waldemar, P. Bruhn, M. Kristensen, A. Johnsen, O.B. Paulson,
N.A. Lassen, Heterogeneity of neocortical cerebral blood flow deficits
in dementia of the Alzheimer type: a [99mTc]-d,1-HMPAO SPECT
study, J. Neurol. Neurosurg. Psychiatry 57 (1994) 285–295.