natural awakenings mercer, nj september 2014

FREE

H E A L T H Y L I V I N G H E A L T H Y P L A N E T

feel good • live simply • laugh more

Life-Enhancing Yoga Kind-to-Yourself CaregivingMINDFULNESS FOR KIDSCreative Arts for Alzheimer’sTHE POWER OF OM

September 2014 | Greater Mercer County, NJ | NAMercer.com

- CEO of the New Jersey Interventional Pain Society,

- Associate Professor at the NY Medical College- Diplomat / American Board of

Physical Medicine and Rehabilitation- Diplomat / American Academy of

Pain Management- Board Certified in Pain Management

- Clinical Assistant Professor Robert Wood Johnson Medical School Dual Appointment in the Departments of Anesthesia and Physical Medicine & Rehab

2186 Route 27, Suite 2D • North Brunswick, NJ

Treatment Methods at a glance:AcupunctureBotox InjectionsCostovertebral Joint InjectionsEpidural InjectionsThoracic Epidural InjectionsFacet InjectionsSelective Nerve BlocksDiscogramsPlatelet Rich Plasma Tissue Matrix and Stem Cell GraftsIntradiscal Electro Thermocoagulation (IDET)Intradiscal Restoration ProceduresJoint Injections

Laser TherapyManipulation and Manual MedicineMesotherapyMinimally Invasive Spinal Surgical TechniquesNerve BlocksOccupational & Physical TherapyProlotherapyRadiofrequency NeurolysisRegeneration Injection Therapy (RIT)Sacroiliac joint InjectionsSpinal Cord StimulationTrigger Point injectionsVitamin and Nutritional Guidance

Don’t Let Pain Limit Your Life!

Get the same ground-breaking treatments Professional Athletes are using.

Dr. Magaziner’s goal of treatment is to repair, regenerate, and eliminate injury or pain, and its causes.

DrEMagaziner.com 877-817-3273

Specializing In:Orthopedic Regenerative Medicine

Endoscopic Spinal Discectomy

Platelet Rich Plasma Grafts (PRP),Stem Cell Grafts and Prolotherapy

Facial Rejuvenation Therapy

The Center for Spine, Sports, Pain, Management and Orthopedic Regenerative Medicine

healthbriefsglobalbriefsecotipsgreenlivinghealingwayshealthykids

consciouseatingwisewordsfitbodyinspirationnaturalpet

departments themes

SEPTEMBER conscious caretaking plus: yoga

OCTOBER sustainable communities plus: chiropractic and acupuncture

NOVEMBER personal empowerment plus: beauty

DECEMBER awakening humanity plus: holiday themes

FREE

H E A L T H Y L I V I N G H E A L T H Y P L A N E T

feel good • live simply • laugh more

Spend LessEat Better Get Top Value For Your Food Dollar

Rethinking Cancer Natural Therapies Prevent and Heal

Nature’s Antibiotics Recover Health with Less Risk

The Perils of Plastic Rid the House of this Silent Health Menace

August 2013 | Birmingham, AL | NABirmingham.com

4 Greater Mercer County, NJ NAMercer.com

NAMercer.com

HOW TO ADVERTISE To advertise with Natural Awakenings or request a media kit, please contact us at 609-249-9044 or email [email protected]. Deadline for ads: the 10th of the month.

EDITORIAL SUBMISSIONSEmail articles, news items and ideas to: [email protected]. Deadline for editorial: the 10th of the month.

CALENDAR SUBMISSIONSEmail Calendar Events to: [email protected] or fax to 609-249-9044. Deadline for calendar: the 10th of the month.

REGIONAL MARKETSAdvertise your products or services in multiple markets! Natural Awakenings Publishing Corp. is a growing franchised family of locally owned magazines serving communities since 1994. To place your ad in other markets call 239-449-8309. For franchising opportunities call 239-530-1377 or visit NaturalAwakeningsMag.com.

advertising & submissions


Natural Awakenings is your guide to a healthier, more balanced life. In each issue readers find cutting-edge information on natural health, nutrition, fitness, personal growth, green living, creative expression and the products and services that support a healthy lifestyle.

6 newsbriefs

9 healthbriefs

12 globalbriefs

15 ecotip

15 actionalert

20 healingways

22 greenliving

24 fitbody

25 inspiration

26 wisewords

28 healthykids

30 consciouseating

34 naturalpet

36 calendar

40 resourceguide

contents

16 CONSCIOUS CAREGIVING Nurture Yourself While Helping Another by Deborah Shouse

20 SPARKING CREATIVITY IN ELDERS WITH DEMENTIA Re-Engaging Through Art, Music and Dance by Deborah Shouse

22 A LOVELY LOO THAT’S ALL GREEN, TOO Tips for Eco-Friendly Plants, Shades and Cleaners by Avery Mack

24 SAY YES TO YOGA It Boosts Health, Peace, Community and Spirituality by Lynda Bassett

25 OM SWEET OM Sounding the Key Note of the Universe by Sam Saunders

26 KAMINI DESAI EXPLORES A YOGIC LIFE Inner Calmness Leads to Self-Mastery by Linda Sechrist

28 MINDFULNESS FOR LITTLE ONES Teaching Kids to Be Calm and Focused by Traci Childress

30 INDIAN VEGETARIAN COOKING Potent Spices and Veggies Fend Off Disease by Bushra Bajwa

34 THE GREAT CLASSROOM PET DEBATE Kids Like Classroom Pets, Animal Lovers Raise Doubts by Sandra Murphy

12

16

20

9

15

28

30

35

5natural awakenings September 2014

Lori Beveridge, Owner/Publisher

© 2014 by Natural Awakenings. All rights reserved. Although some parts of this publication may be reproduced and reprinted, we require that prior permission be obtained in writing.

Natural Awakenings is a free publication distributed locally and is supported by our advertisers. It is available in selected stores, health and education centers, healing centers, public libraries and wher-ever free publications are generally seen. Please call to find a location near you or if you would like copies placed at your business.

We do not necessarily endorse the views expressed in the articles and advertisements, nor are we re-sponsible for the products and services advertised. We welcome your ideas, articles and feedback.

SUBSCRIPTIONSSubscriptions are available by sending

$25 (for 12 issues) to the publisher. Call for details.

Natural Awakenings is printed on recycled newsprint with soy-based ink.

Phone: 609-249-9044Fax: 609-249-9044

[email protected]

Owner/Publisher Lori Beveridge

Managing Editor Dave Beveridge

Proofreader Randy Kambic

Design & Production Melanie Rankin

Stephen Blancett

Franchise Sales 239-530-1377

contact us

letterfrompublisher

As a garden and yard care buff who revels in

Mercer County’s growing season, I continually

challenge myself to find new ways to green up

my house, especially when activities and projects move

inside in the fall. Letting my mind wander, I ponder what

I want to tackle or change next.

First, I think I’ll add more indoor plants. Several

are already installed and working as air purifiers. My

favorite is the aromatic aloe we break open periodically to soothe cuts, scrapes

and burns. This year I plan to grow a Boston fern to help absorb moisture and

humidity in the bath.

I also want to try out a good-smelling, natural cleaning solution that is safer

for my kids and family pets than conventional products. I’m also intrigued with

the idea of using simple ingredients to experiment with homemade cleaners. After

reading Avery Mack’s article, “A Lovely Loo that’s Green, Too,” I’m even up for

cleaning the bathroom grout to make it sparkly clean. Once I’ve got my bath in

good shape, I look forward to making use of a pampering tip on page 23 on all the

ways coconut oil works as a pure personal care product.

Like me, you may be committed to finally painting a room that you’ve been

putting off doing for years. I was amazed to learn that indoor air is three times

more polluted than outdoor air, and is considered one of the top five hazards to

human health, according to the EPA, and paints and finishes are among the lead-

ing sources, typically releasing low-level toxic emissions into the air for years

after their application. Thank goodness we can now switch to low and VOC-free

(volatile organic compound) paints, which are far safer for the health of people

and the planet.

Will you join me in such good-for-us activities? Going greener is a step-by-

step process, but making our home eco-friendly pays dividends in endless ways, as

anyone who has done it knows!

I invite you to turn the page and read on…


newsbriefs

News Briefs We welcome news items relevant to the subject matter of our magazine. We also welcome any suggestions you may have for a news item.

Contact us for guidelines so we can assist you throughout the process. We’re here to help!

Do you have a special event in the community?

Open a new office? Move? Recently become certified

in a new modality?

[email protected]

Holistic Health Extravaganza in New Egypt

Excitement is building in the quaint town of New Egypt for the annual Holistic Health Extravaganza from 9:30

a.m. to 5 p.m., October 18, at the American Legion. This event brings many varied and experienced practitioners together under one roof. “Shopping local, green and natural, while relaxing and raising funds for two local programs is a unique experience,” comments event host Siobhan Hutchinson of Next Step Strategies, LLC. “Our vision is to introduce people to self-empowerment with natural health tech-niques such as massage, yoga, tai chi, reflexology and what Dr. Oz keeps referring to as the next frontier, energy medicine,” continues Hutchinson. “The event grows each year and includes handmade, natural, green, locally made gifts and services, while helping to raise money and awareness for two local organizations, Plumsted Township Trap, Neuter and Re-lease Program and the local Holiday Food Basket Program.” Practitioners and product types available at this year’s event include aryurvedic reflexology, foot detoxification baths, henna artist, craniosacral massage, singing bowls, herbal teas, essential oils and soaps, a feng shui specialist, aura photography, crystals, minerals, Earth jewelry, and chakra inspired and energized jewelry.

Location: 2 Meadowbrook Lane, New Egypt. For more information, call Siobhan Hutchinson at 609-752-1048, email [email protected] or visit NextStepStrategiesLLC.com. See ad, page 29.

25th Anniversary Greenway Gala in Princeton

Join in saluting Richard S. Goldman, Esq., as he is presented the 2014 Donald B. Jones Conserva-

tion Award from D&R Greenway at the Greenway Gala from 4 to 6 p.m. on September 13 in Princeton. Goldman is being honored for his vision for land preservation in connected regional greenways, pro bono legal support in closing nearly 200 of D&R Greenway’s 260 land transactions and his gifts of expertise and proactive commitment. Donald B. Jones (1911-1994) was a dedicated preservationist who devoted his time and resources to saving the land and historic buildings that give our region its special character. D&R Greenway presents

the award in his honor annually to an individual or group that displays selfless generosity and a commitment to conservation. Beverages and hors d’oeuvres will be provided at this garden party event. Donations can be made and sponsorship opportunities are available.

Cost: $100. Location: D&R Greenway Land Trust’s Meredith’s Garden for Inspira-tion, One Preservation Place, Princeton. For more information or to register for the event, call 609-924-4646 or visit DRGreenway.org.

Richard S. Goldman, Esq.


Dentistry at its Best!Synchronizing Oral Health

with Total Body Health

PRACTICING BIOLOGICAL DENTISTRY

for25 YEARS

Kirk Huckel, DMD, FAGDRuxandra Balescu, DMD

609-924-1414PrincetonDentist.com

New Patients Welcome11 Chambers Street • Princeton, NJ 08542

Your mouth is a vital part of your Total Body Health.

We are dedicated toProtecting Your Health with:

• Clifford Material Reactivity Testing • Sleep Apnea Treatment • Safe Amalgam Removal Protocol Enhanced by Biological Support Program • Highest Quality Restorative Dentistry • Preserving Teeth and Gums for a Lifetime • Beautiful Smiles Achieved by Using the Finest Quality Materials • Nutritional Consulting

IAOMT Accredited

Have a Bite of Apple Day Celebration

Over the years, Apple Day has been a fun and popu-

lar local tradition at Terhune Orchards, in Princeton. This year’s celebration will be held rain or shine from 10 a.m. to 5 p.m. on September 13 and 14. Events and activities planned include a corn stalk maze; tractor-drawn wagon tour of the orchards and pumpkin patches; live music by the Daisy Jug Band; scarecrow-making workshops; picking your own Empire, Stayman Winesap and Red Delicious apples, and much more. For food and refresh-ments, there’ll be a pig roast at the outdoor roasting pit and an all-apple buffet with fresh apples pies, apple cider donuts, apple salad, apple muffins, plus traditional fare of hot dogs, soup, chicken, pies, cider and more.

Cost $5/person, children under 3/free. No admission fee for visiting farm store, winery or pick-your-own apples. Location: 330 Cold Soil Rd. For more information, call 609-924-2310 or visit TerhuneOrchards.com.

Back to School Circa 1900

School bells will ring once again in Pleasant Valley when

Howell Farm invites the public to participate in a unique “back to school” day from 11 a.m. to 3 p.m. on September 6. The program features the educational, social and cultural activities centered on the “one-

room school” in rural life of 1900. The Howell Farm school mistress has McGuffey readers, slates and slate pencils ready for students of all ages to begin their lessons in the three R’s. Visitors can sit in an antique school desk and try their hand at orthography using pen and ink or attempt to solve farm-related arithmetic problems on the chalkboard. As in yester-year, children can help with farm chores before attending the “one-room school.” The school bell will ring to begin lessons, recess and a quick tour of the privy. During recess, children will be introduced to hoops and sticks, tug of war and other old-fashioned games and toys. School lunches served in baskets or pails will be on sale. Participants in the school program may also attend the “box social”. Well-wrapped boxes of homemade pies or goodies will be auctioned off to benefit the school. The lucky gentleman who wins the bid on the teacher’s pie will also share her company.

Location: 70 Wooden’s Lane, Lambertville. Admission and parking are free. For more information, call 609-737-3299 or visit HowellFarm.org.


NJSharing Network Cycling Event in Morristown

Consider joining the Team NJ Sharing Network for a biking event to raise funds to benefit

organ and tissue donations starting at 7 a.m. on September 7 in Morristown. This year’s goal is set at $50,000. NJ Sharing Network is a nonprofit, federally designated organ procurement organization re-sponsible for the recovery of organs and tissue for the nearly 5,000 New Jersey residents currently

awaiting transplantation, and is part of the national recovery system for the more than 120,000 people on waiting lists. There’ll be four routes to choose from based upon cycling skills and endur-ance: The Brev Fondo, the easiest at 18 total miles, 1,416 feet of climbing and a rest halfway through; the Piccolo Fondo, 43 miles, 3,679 feet of climbing and one timed hill climb; the Medio Fond, 63 miles in length, 5,470 feet of climbing and two timed hill climbs; and the 107-mile Gran Fondo, demanding 9,108 feet of climbing and four timed hill climbs. Food and entertainment will be available and all participants are invited to stay for the expo following their rides.

Cost: $200/race. Location: Hyatt Morristown at Headquarters Plaza, 3 Speedwell Ave., Morristown. For more information, call 908-514-1761, email [email protected], or visit NJSharingNetwork.

Art of Living Sudarshan Kriya Program in Chesterfield

The Art of Living Happiness Program is being offered from September 25 to

29 in Chesterfield. This 20-hour course teaches the renowned Sudarshan Kriya technique that incorporates specific natu-ral rhythms of the breath which harmo-nizing the body, mind and emotions. This unique breathing method rejuve-nates and harmonizes the whole system by eliminating stress, fatigue and negative emotions. It strengthens the immune system, increases energy and gives clarity of mind. Studies show that prolactin, a well-being hormone, significantly increases from the very first session of Sudarshan Kriya. “I have been practicing breathing techniques taught in the course which have helped me remain calmer and focused even in the most stressful of circumstanc-es,” says a past participant of the course. “In my personal experience, Art of Living is about having a balance of the inner and outer world.” “This powerful breathing technique offers tremendous benefits to one’s well-being,” adds Balkrishna Sharma, Art of Living instructor. “It provides more energy, creativity and clarity of mind. One becomes more self-sufficient and confident. It improves our perception, expression and observation.”

Cost: $295/$395, students/non-students. Location: 5 Sprague St., Chesterfield. For more information, call 609-436-0714, email [email protected], visit AoLjgd.org/HappyNJ or RSVP for a free introductory session at AoLjgd.org/PJ.

Native Plant Sale Event in Princeton

D&R Greenway Land Trust invites the public to its annual Fall

Native Plant Sale from 3 to 6 p.m. on Septem-ber 12 and 9 a.m. to noon on September 13 outside the Johnson Educa-tion Center, in

Princeton. D&R Green-

way’s Native Plant Nursery is a community

resource for central New Jersey’s native plants that contribute to a healthy, bio-diverse ecosystem. No registration is required. Na-tive plants adapted to the region’s climate and soil conditions making them more drought-resistant than most exotic plants. They also provide essential food and cover, having evolved alongside wild creatures. The food provided by native plants is vital especially in autumn, when animals are busy storing calories either for hibernation or migration. Key examples are the juicy black berries of silky dogwood and pollen from New England aster’s bright purple blooms. Both plants are avail-able at D&R Greenway’s nursery. D&R Greenway’s plants are grown from genetically local seeds gathered on their preserves and tended in the nursery by staff and skilled volunteers. Native plants grown from commercially sourced plugs will also be available for pur-chase. Plants are available in quart and gallon-sized pots, priced from $5 to $12.

Location: D&R Greenway Nursery, One Preservation Place, Princeton. For more information, call Emily Blackman, nursery Manager, at 609-924-4646, email [email protected] or visit online catalog at DRGreenway.org/ PlantCatalog.html.

newsbriefs


healthbriefs

Yoga Boosts Hearts, Shrinks WaistlinesTwo scientific reviews of human clinical research

have found that hatha yoga significantly reduces heart disease risk factors. Researchers from Germany’s University of Duis-burg-Essen reviewed 44 studies involving more than 3,000 people. Overall, the studies found that hatha yoga significantly reduced both systolic and diastolic

blood pressure. Yoga participants also showed lower respiratory and heartbeat rates, significantly reduced triglycerides and low-density lipoprotein (LDL), or bad cholesterol, and increased high-density lipoprotein (HDL), or good cholesterol. Several important diabetes risk markers decreased among the yoga participants; they also realized smaller waistlines. Similar results were reached by scientists from the United Kingdom’s Warwick Medical School. In analyzing 11 studies involving 800 people, they found that regular yoga exercise both reduced diastolic blood pressure and triglycerides and increased beneficial HDL cholesterol levels.

TONGUE DIAGNOSIS REVEALS SLEEP DISORDERSTraditional medicines have long utilized tongue analysis

to diagnose various disorders. Now, a recent study from the Republic of Korea’s Institute of Oriental Medicine sup-ports the accuracy of this ancient health practice in the area of sleep dysfunction. The researchers studied two separate groups of 153

people and 454 elderly people; in both, the color of their tongues was analyzed and compared with cases of sleep disorders within each group. Those experi-encing sleep dysfunctions had a paler tongue color compared with those in the healthy group; they also had more thickly coated tongues.

Licorice Root ReducesDangerous FatA new study published in the journal Nutrafoods

has confirmed that licorice extract helps reduce visceral fat in obese adults. The study tested 60 men and 60 women that were clinically obese with body mass index (BMI) scores of over 30. For three months, they were given either a placebo pill or 300 milligrams per day of licorice root extract. Then they were tested for visceral fat using CT scans and measured for waist cir-cumference, waist-to-hip measurements and BMI scores. The licorice extract group had significantly fewer visceral fat cells, lower BMI scores and reduced waist cir-cumference compared with the placebo group. Previous research with the extract also showed similar weight-loss effects among human subjects.

PRE-K EDUCATION LINKED TO BETTER HEALTH 26 YEARS LATERIn addition to an increased like-

lihood of achieving academic success, children that partici-pate in game-based educational training also have a significantly lower risk of developing future cardiovascular disease, according to University of North Carolina researchers in a paper published this year in Science magazine. Launched in the 1970s, the Carolina Abecedarian Project studied more than 100 children beginning when they were just over 4 years old. Fifty-seven focused on language skills while also receiving nutritional and health services. A control group received the same nutritional and health services, but not the early language education. Early education turned out to be an indicator for significant-ly healthier individuals when they had reached the age of 30, with a lower average systolic blood pressure than those in the control group and no symptoms of metabolic syndrome—a con-dition related to diabetes, heart disease and obesity. Twenty-five percent of the control group had metabolic syndrome symptoms at age 30.


RAISINS LOWER BLOOD PRESSURE AND DIABETES RISK

Researchers from the University of Ken-tucky have determined that snacking on

raisins can decrease high blood pressure and reduce the risk of Type 2 diabetes. For 12 weeks, 46 men and women snacked on either processed snack foods or raisins. At the beginning and end of each month, the researchers tested for blood glucose, diabetic risk markers and blood pressure. Raisin snacking was found to reduce blood

pressure while improving blood glucose and diabetic risk factors. The researchers concluded, “Regular consumption of raisins may reduce glycemia and cardiovas-cular risk factors, including blood pressure.”

Vitamin D3 Cuts Antibiotic Use by ElderlyResearch from the Queensland Institute of

Medical Research, in Australia, has found supplemental vitamin D3 reduces the incidence of infection among seniors. More than 600 subjects, ages 60 to 84, were divided into three groups and for one year took either 1,000 international units (IU) a day of vitamin D3, 2,000 IU a day of vitamin D3, or a placebo. Those given the 2,000 IU of vitamin D3 per day were 28 percent less likely to require antibiotics prescriptions than those taking the placebo. Those older than 70 years were 47 percent less likely to be prescribed antibiotics than the placebo group.

Antioxidant Supplements Improve Eye HealthEye health may be improved by taking cer-

tain antioxidant supplements, according to researchers at Austria’s Medical University of Vienna. They studied 40 healthy volunteers between the ages of 18 and 30 split into two groups, giving a control group a placebo pill and the other a supplement containing vitamins C and E, lutein, zeaxanthin, zinc, copper, selenium, gingko biloba, flavonoids, omega-3 fatty acids and alpha-lipoic acid. The medical scientists tested the health and blood flow of the retinal artery, which feeds the eye with blood and nutrients. The results of the two-week trial showed the supple-ments significantly improved blood flow through the retinal arteries. The supple-ments also helped protect the retinal arteries from free radical damage. The scientists concluded that such supplementation can prevent a type of cellular dysfunction in the eye induced by oxidative stress that is assumed to play a role in age-related macular degeneration.

Mindfulness Meditation Can Hinder Onset of Alzheimer’s

A pilot study from the Harvard Medical School indicates yet

another benefit of meditation. The re-searchers tested 14 people with mild cognitive impairment, which often leads to Alzheimer’s disease, and pro-vided them with either Mindfulness-Based Stress Reduction training or standard care. Brain imaging tests indicated that those engaged in meditative training had increased activity and connections among three areas of the brain—the posterior cingulate cortex, medial prefrontal cortex and left hip-pocampus. Although larger studies are needed, study authors remark, “These preliminary results indicate that in adults with mild cognitive impairment, Mindfulness-Based Stress Reduction therapy may have a positive impact on the regions of the brain most related to mild cognitive impairment and Alzheimer’s disease.”

A smile is the light in your

window that tells others that

there is a caring, sharing

person inside.

~Denis Waitley


Romy Yoga, Louise Profit and the staff of Complete Health Chiro-practic, of Lawrenceville, are en-

couraging yoga teachers, bodyworkers, therapists, medical professionals and health and wellness professionals to attend a comprehensive and practical training on Yoga for Breast Cancer Re-covery & Beyond presented by Camille Kittrell of Exclusive Yoga from 8:30 a.m. to 6:30 p.m. on September 27 and 28 in Lawrenceville. One in eight women will be diagnosed with invasive breast cancer during the course of their lives as cited by the American Cancer Society. Last month, The New York Times reported that the number of women undergo-ing aggressive breast cancer surgery is increasing. The rise in breast cancer diagnosis, combined with positive celebrity survivor profiles and advanced early stage detection of risk, has argu-ably led to a small but growing number of young women that are choosing contra lateral prophylactic mastectomy, a highly aggressive form of surgery. The choice these women are mak-ing may help them establish a proac-

tive sense of control over a frightening cancer, but the healing journey from diagnosis through treatment and their ongoing recovery requires compassion-ate and informed professionals so they can get back to a fully active life they are fighting to protect. When a woman receives the diagnosis of breast cancer it can liter-ally take her breath away. It can feel scary and isolating. There’s a sense of fear of no longer being able to do all the things they could do previously. However, there’s no need to stop some

Yoga for Breast Cancer Recovery & Beyond

of the very practices that can become part of a woman’s healing journey with breast cancer. The science, philosophy and practice of yoga can be integral in breast cancer recovery for those that know how to practice and teach it safely. There are many yoga techniques that can significantly strengthen the body and mind, protect and help heal-ing throughout breast cancer treatment and recovery. Kittrell has conducted Yoga for Breast Cancer Recovery & Beyond teacher trainings and presented work-shops worldwide. The local training, open to everyone, provides 35 Yoga Alliance-accredited CEUs. Kittrell’s program provides yoga instructors with the necessary skills to safely adapt hatha yoga for breast cancer survivors. This population has special ex-ercise needs and precautions according to the type of treatment received—from lumpectomy, mastectomy and lymph node dissection to radiation, chemo-therapy and breast reconstruction. Part medical discourse and part spiritual inquiry, it’ll examine the complex array of physical, mental and emotional challenges that survivors face and how the science, philosophy and psychology of yoga can aid recovery on all levels.

Cost $450. Location: Complete Health Chiropractic, 136 Franklin Corner Rd., Lawrenceville. Registration required. For more information or to register contact Romy Yoga at 732-9914-6607, email [email protected] or visit ExclusiveYoga.com/Training.php. Louise Profit is a certified yoga and Reiki in-structor. See ad, page 25.

localhealthbrief

Aware AcupunctureTCM and 5 Element Acupuncture

Treating pain, sports injuries, Ob/Gyn, and much more.Diane L. Ailey L.Ac, Dipl.Ac.

Call for appointment 609-737-0970114 Straube Center Blvd. Suite K6-7, Pennington, NJ 08534

www.AwareAcupuncture.com

by Louise Profit

For anyone working with women in the health and fitness

industry, it’s a harsh reality that if there are more than eight

women in a class or visiting a practice, the chances are at

least one of those women has had or will have exposure to

breast cancer diagnosis and treatment.


Radioactive SeaJapan’s Nuclear Meltdown is Poisoning California KelpScientists analyzing kelp off the coast of San Diego have linked the presence of the radioactive isotope cesium to the Fukushima Daiichi power plant, in Japan, which melted down in 2011. As part of the ongoing Kelp Watch 2014 project, government and academic institutions have begun receiving results from samples of bull kelp and giant kelp collected along the California coast. “We’re trying to figure out how much is there and how much is getting into the ecosystem,” says Matthew Edwards, Ph.D., of San Diego State University. “Things are linked a little more closely than sometimes we’d like to think. Just because it’s on the other side of the world doesn’t mean that it doesn’t affect us.” With experts predicting a 40-year-plus cleanup at Fukushima, the likelihood of increased cesium in the Pacific Ocean seems inevitable.

For more information, visit KelpWatch.Berkeley.edu.

globalbriefsNews and resources to inspire concerned citizens to work together in building a healthier, stronger society that benefits all.

Apple CorpsGreen Apple Day Aims to Transform SchoolsThe Green Apple Day of Service, to take place on September 27 nationwide, will give parents, teachers, students, companies and local organizations ways to trans-form schools into more healthy, safe and productive learning environments via local service projects. Green Apple is a global movement dedicated to enabling schools to provide clean and healthy air, conserve energy and other resources and serve as places where young people can reap inspired dreams of a brighter future.

Source: MyGreenApple.org

GMO Gung-HoU.S. Farmers Plant More GMO CropsFarmers in the U.S. added 12 million more acres of genetically modified (GM or GMO) crops in 2013, reports Clive James, with the International Service for the Acquisition of Agri-Biotech Applications, and now lead the world in their production by volume. Even as many U.S. con-sumers reject foods containing GM ingredients, many farmers continue to embrace the technology. “In general, choosing GM seed is an economic decision for farmers,” says North Dakota Farmers’ Union President Mark Watne, who grows corn, soy and wheat in Minot. “If you give them a tool to battle weeds at a reasonable cost, they adopt it.”

Source: USA Today

Safer Shampoo Makers Agree Not to Use Cancer-Causing Chemical

This year, the Center for Environ-mental Health (CEH) reached legal agreements with 26 major compa-nies to discontinue using a cancer-causing chemical in shampoo and personal care products, and potential agreements with more than 100 ad-ditional companies are still pending. Cocamide diethanolamine (DEA), a synthetic chemical created from a chemical reaction between coconut oils and diethanolamine, has been used for decades in shampoos and other products as a foaming agent.

In 2012, California listed the chemical as a known carcinogen, based on as-sessment by the World Health Organization’s International Agency for Research on Cancer, which evaluated skin exposure tests on animals. In 2013, the CEH brought lawsuits against companies selling products in California containing the substance without a health warning, as required under Prop 65, the state’s consumer protec-tion law for toxic chemicals. Note: A Think Dirty app offers information about the potentially toxic ingredi-ents in cosmetics and personal care products and what not to buy.

Source: Ecowatch.com (Tinyurl.com/Shampoo-Lawsuit)


At fine retailers everywhere. For more info or to find a retailer, visit

xlear.com


Cleaner AirNew EPA Rules Proposed for Climate ChangeThe White House plans to cut car-bon dioxide emissions from power plants by 30 percent by 2030. Each state will have its own goal within the overall national pollution reduc-tion effort, an attempt to be politi-cally and practically flexible in its implementation. Environmental Pro-tection Agency Administrator Gina McCarthy explains, “Each state’s goal is tailored to its own circum-stances, and states have the flex-ibility to reach the goal in whatever ways work best for them.” States can renovate existing coal-fired plants with newer, cleaner burning technology; switch coal plants to natural gas, which produces much less carbon; and work to persuade residents to be more efficient in their use of electricity. States can also band together in cap-and-trade networks for emission reductions, in which companies buy and sell permits allowing them to produce a certain amount of carbon emissions. Clean producers can be sellers, dirtier pro-ducers buyers. The program represents an absolute reduction in U.S. carbon emissions of nearly one-third, rather than a simple slowing in the growth rate of emissions. Contrary industry groups, many Republicans and some coal-state Democrats oppose the proposal due to its anticipated costs and increased regulations.

Source: The Christian Science Monitor

Apple CrunchCelebrating Pesticide-Free OrchardsThe nationally acclaimed Rodale Institute will cele-brate its fifth annual Organic Apple Festival on Septem-ber 21 in Kutztown, Pennsylvania, more than 30 years after planting the trees. Organizers note that when growers select just one genetic variety of apple to reproduce and culti-vate, they create a monoculture that easily becomes more susceptible to pests and diseases than an orchard that hosts several varieties. An array of insects and blights favor this all-American fruit, which is why standard apples are the single-most pesticide-contaminated produce item at conventional groceries. Large agribusiness operations typically grow fruit bred for durability and color during shipping and shelf life. Organic apples, by contrast, are chosen for flavor and regional adaptability.

Source: Facebook.com/RodaleInstitute

Ice CubedGreenland a Big Contributor to Sea Level RiseNew research by University of California-Irvine and NASA glaciologists published in Nature Geoscience shows that Greenland is more vulnerable to warm ocean waters from climate change than previously thought. Newly discovered deep valleys stretch for dozens of miles under the Greenland ice sheet in

bedrock well below sea level. As subtropical Atlantic waters hit the fronts of hun-dreds of glaciers, their edges will erode much further than had been assumed and release far greater amounts of water. Ice melt from the subcontinent has already accelerated as warmer marine cur-rents have migrated north, although older models predicted that once higher ground was reached in a few years, the ocean-induced melting would halt, Greenland’s frozen mass would stop shrinking and its effect on higher sea waters would be curtailed.

Source: Environmental News Network (Tinyurl.com/Greenland-Sea-Rise)

Online OpportunityMajor University Offers Integrative Medicine CertificateThe George Washington University School of Medicine and Health Sciences is inaugurating an online Integra-tive Medicine Program in partnership with the Metabolic Medical Institute and accepting applications toward graduate certification in integrative medicine.

Integrative medicine focuses on the whole person, and the curriculum includes prevention, self-care, nutrition, exercise prescription, dietary supplements and wellness-based therapies. Students also review advanced predictive diagnostics, biotechnology, and systems biology utilizing proteomics, genomics and metabolo-mics. Graduates will gain cutting-edge knowledge to make well-informed decisions with their patients about treating disease, promoting vitality and optimizing aging.

To learn more and enroll in the program, visit MMIMedicine.com.

globalbriefs


We do it all While alWays offering you “green options”

From Top To Bottom, In & OutWe repair, install or replace: doors, all types of

tiles, hardwood, carpeting, molding, rotted wood, sheetrock, pavers and decks.

Powerwashing • Prime & Paint • Water ProofingFinish Basements • Kitchen & Bath Remodeling

RemembeR “We do it all” so you don’t have to!

We do it all home improvements & Repairs llC

LIC #13VH06769500 • Insured

and yes, we even clean windows, change batteries & light bulbs!

no job too big... no job too smallWe Do it all!!

Call, text or email us today for a Free estimate

609-851-1753 • [email protected]

NewPhone

Number!

Make your community a little GREENER … Support our advertisers

For every $100 spent in locally owned business,

$68 returns to the community

source: the350project.net

Cell BillOvercharging Mobile Devices Wastes MoneySmartphone maker Nokia esti-mates most devices need only about two hours to fully charge, making overnight charging highly wasteful; users also should disengage and unplug chargers from the wall when they’re done. Another helpful tip from Battery University.com is not to wait until cell phone power is nearly or completely depleted before re-charging, because full discharges put a strain on the battery that can shorten its lifespan. Umbra Fisk, an environmental columnist at Grist.org, advises using a power strip and even a timer as parts of a central charging area for all mobile devices to facilitate monitoring and reduce overcharging. Energy Star-qualified (EnergyStar.gov) cordless phones demand about half the energy of standard units. Energy Star reports that the average U.S. household spends $100 annually to power devices while they are off, constituting nearly 10 percent of annual electric utility bills and amounting to an annual total of 100 billion-plus kilowatt hours of U.S. electricity consumption and more than $10 bil-lion in annual energy costs.

actionalert

ecotip

Planetary PushPublic Demands Climate Change SolutionsPeople throughout the U.S. and worldwide, representing hundreds of grassroots and non-government organizations, will converge on New York City for the Peoples

Climate March on September 21. As United Nations Secretary General Ban Ki-moon calls for heads of state to mobilize at an historic U.N. Summit on Climate Change that weekend, the people will demand ac-tion via the largest-ever climate change citizens’ demonstra-tion. Concerned groups and individuals expect to exchange ideas, articulate common challenges and address solutions.

Learn more and sign up at PeoplesClimateMarch.org. Find a partial list of participating organizations at Tinyurl.com/GroupsMarching.


“If you’re depressed, tired or sick, your caregiving is likely to suffer,” counsels John Schall, CEO of Care-

giver Action Network, in Washington, D.C., and a former family caregiver. “For the sake of your loved one, take care of yourself.” The AARP estimates that some 34 million family caregivers provide for someone that is ill or disabled in the U.S. According to the National Alliance for Caregiving, in Bethesda, Maryland, caregivers generally struggle with finding time for themselves, managing emotional and physical stress and balancing work and family responsibilities. Experts suggest that the following seven steps can help people enjoy a healthier, less stressful and more conscious approach to care giving—and receiving.

Reframe CareWhen Lori La Bey’s mom was diag-nosed with dementia, the daughter initially felt she was the only family

member that could help her. How-ever, gradually, the Minneapolis-based international caregiver advocate and founder of AlzheimersSpeaks.com learned to welcome help from others. “Being perfect gets in the way of true connections,” she observes. Although La Bey began her care-giving out of love, the volume of related tasks soon sparked stress. That’s when she taught herself to slow down and reframe her outlook: Before going into her mom’s room, folding her laundry, scheduling healthcare practitioners and delivering dinner, La Bey paused to consciously ask: “Is Mom safe, happy and pain-free?” Centering on those three questions reminded her that she was doing this work out of love. Psychotherapist Diana Denholm, Ph.D., of West Palm Beach, Florida, heightened her own consciousness by learning to see caregiving as a collab-orative effort. Denholm, author of The Caregiving Wife’s Handbook: Caring for Your Seriously Ill Husband, Caring for Yourself (CaregivingWife.com), sought

to keep her husband as engaged and active as possible. When she had difficult issues to discuss, she’d make a “talking date” with him, offering choices by saying, “I’d love to chat with you. Would Tuesday before dinner or Thursday after breakfast work for you?” Before the date, she’d select a comfortable room and clear her mind by meditating, napping or mind-fully sipping herbal tea. The conversa-tions would cover anything from how to work with their health professionals to plans for his end-of-life ceremony. They agreed on strategies and worked together as a team.

Redefine Assistance“I’ll carry your luggage for you, Dad, since you’re not feeling well”… La Bey still remembers her father’s down-turned mouth as she tugged the suitcase out of his hands. “I was trying to be helpful, but instead I took away his dignity and power,” she later real-ized. “If I had packed his bag lighter, he could have carried it like always.” When are we helping and when are we doing too much? “Put yourself in the sick person’s shoes. Avoid doing something the per-son can do for himself,” agrees Den-holm. Controlling behavior changes the dynamics of the relationship and can put the caregiver in a parental role. She recommends a holistic brainstorming exercise in which the caregiver writes answers to such questions as: What am I frustrated about? What really annoys me? Why am I angry with myself? The results offer a window to un-derstanding our own feelings. “Feeling anger could mean we’re acting co-dependently and taking on too many responsibilities,” Denholm says. “The caregiver’s job isn’t to save the patient, but merely to support him or her in necessary ways.”

Ask for Help“I don’t want to be a burden,” and “We’re afraid of losing our privacy,” and “I’m the only one who can take care of him; no one else can do it right,” are common concerns. “These self-limiting beliefs prevent people from reaching out for help,” says family caregiver and life coach Yosaif August,

Conscious CaregivingNurture Yourself While Helping Another

by Deborah Shouse


founder of Yes To Life Coaching (YesToLifeCoaching.com), in Phila-delphia, Pennsylvania, and author of Coaching for Caregivers: How to Reach Out Before You Burn Out. August quotes a recent Johns Hopkins study that reported caregivers might improve their health “… when caregiving is done willingly, at manage-able levels and with individuals who are capable of expressing gratitude.” Accepting assistance makes caregiving more manageable. August understands how over-whelming the experience can be and advises caregivers to ask themselves: “What do I need help with right now?” Keep answers specific, such as, “I need someone to prepare dinner to-morrow night, mow the lawn and pick up our vitamins.” August also suggests creating a family Declaration of Interdepen-dence, a personal statement docu-menting how the family prefers to be helped, along with the attitudes and behaviors they find especially sup-portive. Encourage family and friends to ask these two questions: “Are you open to advice?” and “Is this a good time to talk about your spouse’s condi-tion?” Make much-needed breaks sacrosanct from such discussions.

Nurture through NourishmentMore than 50 percent of caregivers surveyed in a 21st-century study spear-headed by the National Alliance for Caregiving reported, “I don’t have time to take care of myself.” That can trans-late to a lack of exercise, an unhealthy diet and little or no respite. “If you aren’t healthy and strong, you can’t properly care for anyone else,” says Liana Werner-Gray, New York City natural lifestyle consultant and author of The Earth Diet (TheEarthDiet.org). To be-gin each day, she advises drinking one cup of warm water with juice from half a lemon, explaining that stress produc-es acid and lemon water metabolizes as alkalinity and helps keep the body’s pH balanced. For healthy snacks, Werner-Gray recommends easy and nutrition-rich choices like fresh fruits, green smooth-ies, organic nut butters and a trail mix

of raw nuts, seeds and dried fruits. Save time with the smoothies by making a large batch and freezing portions to enjoy later. A basic recipe might include two handfuls of greens, such as spinach and kale, a banana and other fruits, almond milk or purified water and maybe adding flaxseed, cinnamon or goji berries. When appropriate, share the same health-boosting foods with the loved one. Victoria Moran, of New York City, is the director of the Main Street Vegan Academy and author of a dozen books on health and well-being including Main Street Vegan and Liv-ing a Charmed Life. She offers such conscious eating tips as eating full meals of “real” food instead of snacks; selecting beautiful foods; and ritual-izing indulgences, such as a special spot for relaxing with high-quality dark chocolate and tea using good china while listening to classical music.

Stand for ExerciseEven though caregivers may feel they don’t have time to spare, Dr. Jordan D. Metzl, author of The Exercise Cure, says it’s vital to incorporate physi-cal activity. He recommends starting by walking 30 minutes a day for one month. If necessary, it can be done in 10-minute increments.

Extending a Hand to Caregivers

If your caregiving friends can’t articulate what they need, try these lovely offerings.

n Send a cheerful card.

n Gift a plant.

n Weed their garden.

n Cook a meal.

n Schedule a walk together.

n Sit with a loved one for several hours so they can run errands.

n Volunteer to get their car washed.

n Take them to a movie or out to dinner.

n Buy a gift certificate to use online.

n Treat them to a massage.


SHARE HOW YOU ARE HELPING

OUR COMMUNITY BECOME MORE SUSTAINABLE

by advertising in Natural Awakenings’ OctoberSustainable Communities Edition

Reach eco-conscious and green enthusiasts seeking:• Alternative Fuel Vehicles • Energy-Efficient Lighting• Bicycle Shops • Garden Supplies• Community Gardens • Organic Foods & Co-ops• Composting • Recycling• Earth-Friendly Cleaning • Solar Power Sales & Service• Eco-Chic Home Decor • Thrift & Resale Shops• Eco-Landscapers • Water Purification • Clean Energy Products & Services • Environmental Building & Diagnostics — and many more leading suppliers and providers

Contact us at: 609-249-9044 [email protected]


According to a study by Mayo Clinic Physician James Levine, Ph.D., in Scottsdale, Arizona, “Sitting is the new smok-ing.” Researchers have linked sitting for long periods of time with a number of health concerns that include obesity, metabolic syndrome and increased risks of death from cardiovascular disease and cancer. The solution is to move more and sit less—walk while on the phone and stand up while reading. Metzl suggests a stretch break every 20 minutes. Three of his “com-mandments” for fitness are having fun, setting goals and minimizing sitting. “Schedule exercise and respite breaks and make them as inviolate as a doctor’s visit,” advises Schall.

Commune with SpiritAugust suggests establishing a twofold consciousness-raising ritual to welcome and appreciate life. Begin each day by showing gratitude for being alive and end it focused on forgiveness and grati-tude. “When you cultivate gratitude, you notice more things to be grateful for,” says August. La Bey concurs, and writes down at least five things she is grateful for every day. She mentally replays time with her mom and appreciates the little moments and signs of hope, like “the twinkle in Mom’s eye or the way she held hands and smiled.” This puts her in an upbeat frame of mind

when she drifts off to sleep. She also writes out her intention for the day, envisioning positive outcomes. She might affirm: “I am going to have a grace-filled day. Things will go smoothly.” Denholm centers herself by

petting her cats. Some caregivers chant or practice meditation or mindful breathing, while others might take a walk, shop, or sit quietly in a church.

Notice BlessingsLa Bey discovered that her journey as a caregiver also dramatically enhanced her own life. “Mom taught me so much,” she relates. “I learned compas-sion and unconditional love on multi-ple levels. I learned to live in gratitude, instead of loss.” August notes, “Even in the tough times, I experienced an engaged, poi-gnant and rich connection with my parents.” For Denholm, treasured gifts in-cluded strengthening her communica-tion with her husband and working as a team. “Allowing yourself to reach out for assistance and make time for respite will deeply enrich your caregiving ex-perience,” concludes Schall.

Deborah Shouse is the author of Love in the Land of Dementia: Finding Hope in the Caregiver’s Journey. Follow her blog at DeborahShouseWrites.wordpress.com.

Make a list of favorite ways to relax and renew

during short respites, such as reading, listening to

music, stepping outside, sipping coffee with friends

or taking a hot shower, and refer to it often. Online Help

for CaregiversAlzheimersSpeaks.com Radio show, blogs, free webinars and resource directory

CaregiverAction.org Advocacy, peer support and other practical information

TheCaregiverSpace.org Free social network to share experi-ences, find critical resources, cope with stress and learn to fulfill care partner roles most effectively

CaregivingWife.com Helps caregivers solve problems, learn survival tips and improve the care partners’ relationship

CarePages.com Free patient blogs connect friends and family

CaringBridge.org Share views and receive support

LotsaHelpingHands.org Coordinates ways to address specific needs by those rallying to help

ShareTheCare.org Join in organizing a healing team and/or support system

Come visit us every weekend!

West Windsor Community

Free Market Bag!Bring this coupon with you to the Farmers’ Market any Saturday 9am – 1pm.* Enter the train station from Alexander Road to find us.

15 Farms and 11 Artisan Vendors!• Just-picked organic produce and fruit• Asian vegetables, exotic mushrooms • Live music, hot food and family fun...Open 9am to 1pm every Saturday at the Princeton Junction Train Station.www.westwindsorfarmersmarket.org

Farms: Beechtree, Cherry Grove, Chia-Sin, Davidson’s Exotic Mushrooms, Jeff’s Organic Produce, Fulper Family Farmstead, Great Road, Griggstown, Hopewell Valley Vineyards, Krowicki, North Slope Organic, Shibumi Mushrooms, Stults, Terhune Orchards, WoodsEdge

Non-Farm Vendors: First Field, Frank’s Pickled Peppers, FunniBonz, Happy Wanderer, Jammin’ Crepes, Nice and Sharp, Stony Brook Orchids, Terra Momo Bread, The Artisan Tree, Tico’s Juices, The Touch That Heals

*Limit, one per customer until supplies run out. *Offer good until Oct. 1, 2014


Is there a way to upend the limits of Alzheimer’s disease? Expressive thera-pies focus on what people can do

and their successes. Cultural programs offer creative opportunities for those with dementia and their care partners. Artful Imagination Prompts Participation “Looking at art and making observa-tions gives people living with dementia a chance to exercise their imagination and creativity,” says Susan Shifrin, Ph.D., director of ARTZ Philadelphia, part of the Artists for Alzheimer’s program founded by John Zeisel, Ph.D., and Sean Caulfield. “There are no right or wrong answers. People are enlivened, realizing they still have ideas to contribute.” Prior to a museum visit, an ARTZ facilitator brings photos of familiar works of art that evoke memories, emo-tions and conversation to a care facility. The facilitator then tailors a museum visit so that the most engaging works of art are viewed. A similarly beneficial at-home ARTZ experience relates to the individual’s background or inter-ests, looking for images that tell a story

healingways

about families or feature animals the loved one likes. “Use open-ended, non-judg-mental questions to discuss the art,” Shifrin suggests. “It’s all about listen-ing to the response and encouraging the conversation.” Musical Connections Trigger HappinessDan Cohen, of Brooklyn, New York, had a simple yet profound idea: Furnish people that have memory loss with an iPod loaded with their favorite music. It’s helping people nationwide reconnect with themselves through listening to their personal playlists. He has repeatedly seen how “The music transforms lives.” Cohen notes, “Residents who were formerly idle become engrossed in lis-tening to their favorite music. They are empowered to choose the songs they want to hear. They become engaged as the music triggers memories. I’ve also seen the experience make people more social.” He recommends using head-phones to minimize distractions. Sit together, turn on the iPod and watch for smiles of delight.

Sparking Creativity in Elders with Dementia

Re-Engaging Through Art, Music and Dance

by Deborah Shouse

Join for FREE atNaturalAwakeningsSingles.com

Fall In Love Again, Find Your Soul MateJ oin the largest database

of health-conscious and eco-minded, spiritual singles for FREE and manifest an extraordinary relationship!


Route 130 And 206 In Bordentown, NJ609-372-4020

Retro Fitness Of B-Town Agreement Members Receive Discounts From Our Local B2B Partners.Retro Fitness Of B-Town Agreement Members Receive Discounts From Our Local B2B Partners.

FREE Fitness Assesment | One 1 on 1 Personal Training Session And Nutrition Session With Agreement Membership

*$0 Enrollment Fee

*Offers cannot be combined*Inquire at club

Retro Fitness of Bordentown is offering onefree month to anyone that switches theirmembership from any local gym to ours.

1 Free Month*

Take advantage of our various non-contract o�ers

6 Months for $179+tax!Senior Discount 3 Months for $99+tax!

1 Month Student Special for $33+tax! Around $1 a Day!

By Donating School Supplies To Local Schools in Bordentown

You Receive Your

1st Month Free*

Back To School Donate Supplies

No ContractNeeded

September 29th at 7PM for Free!

Join our nutrionist Kelley MacKinnon to learn aboutCleaning Up Our Diet and straying away from the standard american diet

of processed foods and transition into whole healthy eating!

Free for all Seminar Clean Eating

Dance Movement Integrates Souls“Dance therapy enhances connections in the brain and uses movement to inte-grate body, mind and spirit,” says Erica Hornthal, owner of Chicago’s North Shore Dance Therapy, a psychotherapy practice that helps individuals cope with the challenges of dementia. Hornthal often notices a real change after people experience move-ment therapy. Often, when she enters a memory care facility she sees people withdrawn or sleeping. After she guides them in specific movements designed to connect mind and body, participants are usually awake, more alert and mak-ing eye contact. “We might reach our arms up, then down, to connect with ourselves. We might give ourselves a hug and then stretch toward our neighbor,” explains Hornthal, a board-certified dance movement therapist. “All the move-ments have a psychosocial goal.” She suggests that care partners play familiar music and encourage their loved one to move as they wish to. The care partner might move her head or wiggle her fingers to the music, invit-

ing the other to do the same. “Focus on what your loved one can do and cel-ebrate their abilities,” Hornthal advises. Brushing Watercolor Memories“Even after memory and cognitive functions are damaged, the abil-ity to create art can continue,” says Karen Clond, a licensed master social worker and dementia care specialist at the Alzheimer’s Association Heart of America chapter, in Prairie Village, Kansas. “The organization’s Memo-ries in the Making art program works because the amygdala, the part of the brain involved with emotions and memory that processes feelings like fear, also processes beauty, apprecia-tion and attachment.” Sally Jenny developed the program in 1988, which now boasts more than 4,000 participant artists a week. Facili-tators create a safe and encouraging at-mosphere to explore painting with wa-tercolors, which can unlock memories, stimulate thoughts and promote social interaction. The process also produces tangible pieces they’ve created and can revisit. “The artists have complete con-

trol over their work,” Clond comments. “It’s a failure-free activity.” For at-home painting activities, she suggests inviting guidelines: Provide good-quality supplies; have no expec-tations; find something good in every effort; ask them to title their piece and affix their artist’s signature; call them an artist and provide artistic respect. Telling Personal Stories Improves Well-Being“Creative storytelling for dementia patients replaces the pressure to re-member with the freedom to imagine,” remarks Joan Williamson, of Milwau-kee, Wisconsin, a coordinator and mas-ter trainer with TimeSlips. She’s seen it improve communication, self-esteem and social interaction for people with memory loss. Whether exploring art, music, movement or storytelling, expressive therapies can enrich the lives and con-nections of people with dementia and their care partners.

Deborah Shouse is the author of Love in the Land of Dementia. Visit DeborahShouseWrites.wordpress.com.

NestingEggHomeCare.com

WELCOME TO A NEW DAYAND TO NESTING EGG.

Nesting Egg is a non-medical, companionship care agency born

from a vision to provide those in need with the highest quality

homecare in a life stimulating environment.

Contact us today at 1-888-335-3537.

Companionship Services

24-Hour Care

Family Respite Care

Hospital Sitters

Care After Discharge

New or Expecting Parents

Relocation Services


greenliving

Key elements like low-flow faucets and showerheads, VOC-free paint, sustainable flooring and nonporous

countertops form the foundation of an eco-friendly bathroom. Now let’s take a look at the softer side of green. Start by considering the use of honeycomb window shades and dou-ble-glazed windows to keep this most intimate room comfortable year-round and reduce utility bills. Periodically let-ting in fresh air helps keep the room dry and reduces growth of mold, mildew and bacteria. While the kitchen harbors the most germs in the house, the bathroom is a close second. Instead of harsh chemical cleansers, try white vinegar, a safe and economical alternative. Its acidity is ef-fective in killing most germs. Madeleine Somerville, of Edmonton, Alberta, Canada, author of All You Need Is Less, uses heated vinegar misted on the shower door to remove soap scum. To achieve a shiny tub, she advises mixing one-quarter cup of baking soda, one tablespoon of natural dishwashing soap and enough water to make a paste. The baking soda also freshens the drain when the tub is rinsed. Toilet bowl ring

stains can be scrubbed away with a pumice stone. “Cleaning faucet aerators and exhaust vents on a regular basis extends equipment life, maintains efficiency and prevents minor plumbing prob-lems,” advises Keita Turner, a New York City area interior designer. Turner has also installed dual-flush toilets that necessitate less water and upkeep. Bathroom odors are another concern. A few drops of essential oil on a cotton ball placed inside the toilet paper roll freshens the air every time the roll turns—without the plastic waste byproduct from store-bought brands. Baking soda removes odors in the bath like it does in the fridge. Upgrade from a simple bowlful by designing a mini-Zen meditation spot using a flat, open wooden box and a doll house-sized rake. Adding a smooth rock or two for texture heightens visual appeal. Green plants can chip in by absorb-ing odors, as well. Many, like the Boston fern, thrive in shower steam. Flowering plants add an inviting touch. Be sure to choose child- and pet-safe greenery. Even quick, water-saving showers eventually result in towels and wash-

A Lovely Loo that’s All Green, Too

Tips for Eco-Friendly Plants, Shades and Cleaners

by Avery Mack

cloths destined for the laundry. The Good Housekeeping Research Institute suggests that towels can be used up to four times before washing if they are hung to dry between showers, reducing both water and energy usage. To avoid spreading germs, personal-ize towels and washcloths for each child by color or marking with an initial or colored dot. Organic cotton towels are eco-friendly, comfy and widely avail-able, as are organic cotton bath mats. For the crafty, make a mat from recycled towels or upgrade to a foot-massaging mat made from recycled wine corks. On special occasions when a soothing bath is called for, add a whimsical touch with Mr. Green, the world’s first rubber duck made in the U.S. from environmentally friendly, recycled and recyclable material. “Recycled materials call for different sculpting and molds, so designing Mr. Green was the hardest thing we’ve ever done,” says Craig Wolfe, presi-dent of CelebriDucks, in San Rafael, California. It’s a fun way to remind kids about going green while they spend a few extra minutes getting clean.

Cleaning RecipesFreshen drains and keep oils and lotions from clogging bathroom pipes by pouring one cup of baking soda into the drain, followed by a cup of hot, white vinegar. After it foams, wait five minutes and then flush with hot water.

Mix two tablespoons of salt with one teaspoon of white vinegar to form a paste effective for cleaning chrome faucets.

Scrub chrome with a cut lemon to remove hard water stains.

Use lemon juice and an old tooth-brush to scrub grout.

Periodically douse the toilet with a half-cup of lemon juice and swish with a toilet bowl brush to keep it fresh.

Add a few tablespoons of lemon juice into a spray bottle filled with water to clean windows and mirrors.

Primary Source: BroccoliCupcake.com


Green Bathroom Trivian Never clean with sponges—they merely move the germs around; use a washable cloth wipe instead.

n Turkish cotton towels dry faster than the Egyptian variety.

n Always put the upper toilet lid down. Testing by scientists at Leeds University found airborne germs 10 inches above and around the commode.

n Low-flow toilets use as little as 1.6 gallons per flush compared to older styles that use five to seven gallons. The average person flushes five times a day.

n A bath averages 35 to 50 gallons of water versus a 10-minute shower with a low-flow showerhead maxing out at about 25 gallons. Better yet, take quicker showers and turn off the water while lathering and shaving.

n Conventional showerheads run at 5 gpm (gallons per minute) compared with low-flow at 2.5 gpm. Conventional faucets can flow at 3 gpm versus low-flow faucets at half that rate.

For a calculation of personal water usage, visit Tinyurl.com/PersonalWaterUse.

Primary Source: GraceLinks.org

To indulge in post-shower per-sonal pampering, consider health-enhancing coconut oil for head-to-toe moisturizing. As a hair treatment, coconut oil blocks protein loss and reduces frizz. Make a home exfoliat-ing sugar scrub by combining one-half cup of virgin coconut oil, one cup of organic sugar and 20 drops of lime or another essential oil to gently scrub away dry winter skin. Dry skin and ragged cuticles also benefit from whipped coconut oil. Its antifungal properties help keep toenails healthy and sandal-ready. Goat’s milk soap can reduce symp-toms of dry skin, eczema and psoriasis. Its alpha-hydroxy acids remove dead skin cells. Add honey as a natural anti-bacterial boost. Mixing in colloidal oatmeal produces a gentle exfoliator. Let the next upgrade of the bath-room be of a more personal nature aligned with our core values of being good to our family and our home planet.

Avery Mack is a freelance writer in St. Louis, MO. Connect via [email protected].

Recommended House Plants

Plants on the counter or windowsill add green to the room and serve as air purifiers.

Aloe—provides gel inside the leaves to soothe burns and shaving nicks

Boston fern—can be challenging to grow, but absorbs humidity and moisture

English ivy—can reduce airborne fe-cal matter particles

Eucalyptus—adds its own fresh aroma

Heart leaf philodendron—cleans the air; poisonous if eaten by kids or pets

Peace lily—cleans the air; poisonous to pets, especially cats

Snake plant—needs little light or wa-ter; cleans the air of chemicals used in personal products

Primary Source: ThisOldHouse.com

SPECIALFEEDS

SpecialFeedsForSpecialNeeds.com609-598-0261

Why take a trip to a drive thru when we can deliver a fresh, organic meal

to your door step?

Mention this

ad and receive

10% OFF your order

PrismHypnosis.com

609-235-9030Solutions for

Healthy Living

Do not dwell in the past,

do not dream of the future,

concentrate the mind on the

present moment.

~ Buddha


fitbody

Lois Parker Carmona first stepped into a yoga studio looking for better physical health. “I was doing hot

vinyasa because I wanted to sweat. I wanted to feel better,” she recalls. Many people on a similar quest try yoga for the first time during Septem-ber’s National Yoga Month (YogaHealth Foundation.org/yoga_month), founded by Johannes Fisslinger. “This year, more than 2,200 yoga studios will offer in-formative public events or a free week of classes to new students to educate everyone about the health benefits of yoga and inspire a healthy lifestyle,” says Fisslinger. “Yoga and mindfulness are an essential part of America’s newly emerging health paradigm.” Like many others, as Carmona deepened her practice, she discovered that yoga’s benefits transcend the physi-cal. Then she went further, becoming a certified Baptiste yoga instructor and co-owner of Melrose Yoga, in Melrose, Massachusetts. “Many of us are so busy and consumed with the constant motion of day-to-day ac-tivities that we lose complete track of who we are, along with the state of our bod-ies,” she says. “Yoga recon-nects me with myself.”

FlexibilityOne reason that people try yoga is to improve their flexibility. A recent report from Yoga Alliance, a nonprofit associa-tion based in Arlington, Virginia, states that it can improve flexibility and mo-bility and increase range of motion over time as ligaments, tendons and muscles lengthen and become more elastic. It also helps relieve muscular tension throughout the body. The Alliance’s Danica Amore notes that flexibility means different things to different people. “A senior might define flexibility as being able to pick up the grandkids, while young people might consider it essential to their athletic abilities.” Flexibility can also mean being able to turn around easily while backing out of the driveway or running with fewer injuries, adds Carmona.

Improvements in flexibility gen-erally depend on an individual’s age, health and commitment to practicing yoga, as well as the

style chosen. “There are so many different lineages of yoga, and each teacher has his or her own style. Plus, each individual progresses at their own pace,” Amore explains. “It’s really a ques-tion of where you want this personal practice to take you and how you embrace it in your private life.” The bottom line is that every-one’s journey is different.

Mental HealthMany experts concur that yoga can be effective in reducing stress. As students continue their practice, they feel less stress and an increased sense of peace and relaxation, along with other mental health benefits. “Yoga gives you what is often called a ‘witness consciousness’,” says John Kepner, executive director of the International Association of Yoga Thera-pists, in Little Rock, Arkansas. “Being able to observe the external events around you, but not being caught up in the drama. In modern terms, it’s an increased ability to stay cool, calm and collected. After a good yoga class, your troubles can appear further away.”

Improved RelationshipsWhen stress is reduced, an increased sense of calm tends to permeate all areas of one’s life, observes Kepner. “Based on my experience, yoga also helps improve relationships.” He has taught the same group of students for 10 years and notes their special relationship: “If one goes to the same yoga class regularly, a friendship tends to develop with others in the class, called Songhai. After a while, practicing together becomes one of the most valu-able parts of the practice,” he says. This beneficial, deeper sense of community—a major allure of a long-term yoga practice—develops mainly from the intangible sense of working together in terms of physical, mental and spiritual support.

Spirituality and Connectedness“Even beginning students quickly real-ize how connecting with their bodies and their breath helps them in their everyday lives,” says Carmona. “It adds a transcendent dimension to everything you do in life.” In addition to its more immediate tangible benefits, other long-term ben-efits experienced by students may be harder to define or quantify. Carmona observes, “People generally say that yoga has changed their life, physically, mentally and spiritually.”

Lynda Bassett is a freelance writer outside Boston, MA. Connect at [email protected].

Say Yes to YogaIt Boosts Health, Peace, Community and Spiritualityby Lynda Bassett


“Om” is a Hindu sacred sound considered the greatest of all mantras, traditionally used

in prayers, chants and meditation—possessing high spiritual and creative power, it can be recited by anyone. Om is both a sound and a symbol rich in meaning and depth. When pronounced correctly, it is actually “AUM.” Aum consists of four syllables: A, U, M and the silent syllable. The first syllable is A, pronounced as a prolonged “awe.” The sound starts at the back of the throat and is stretched out; sense the feeling of the solar plexus and chest vibrating. The next is U, pronounced as a prolonged “o- o- ,” with the sound gradu-ally rolling forward along the upper palate and vibrating the throat. The third syllable, M, is pro-nounced as a prolonged “mmmm,” with front teeth gently touching. Start to feel the top of the head vibrate. The last syllable is the deep silence of the infinite. As intelligence rises from the deep silence, merge the chant from the M to the deep silence.

Why do we chant it?Everything in the universe is pulsating and vibrating—with nothing standing still. The sound Om, when chanted, vibrates at 432 Hz, the same vibrational frequency found throughout nature. By chanting the keynote sound of the universe, we are symbolically and physically tuning in to and acknowledg-ing our connection to all other living beings, nature and the universe. The universal vibrations and rhyth-mic pronunciation also physically affect the body by slowing the nervous system and calming the mind, similar to the effects of meditation. When the mind relaxes, blood pressure decreases and ultimately, heart health improves. Finally, chanting AUM is well-suited to mark the beginning or end of a yoga practice or meditation session or as a respite from regular daily activi-ties. It signifies that this is a special time to care for ourselves and practice being mindful.

Sam Saunders lives and teaches yoga in Dubai. Connect at [email protected].

inspiration

Om Sweet OmSounding the Key Note of the Universe

by Sam Saunders


We encourage and welcome participation

by experts in our community.

Local articles are what make Natural Awakenings a community resource for naturally healthy and sustainable living... for everyone.

We want our readers to get to know you. Submitting editorial for one or more of our departments provides you with the opportunity to share knowledge and bring focus to your business and/or practice.

For details, editorial and styling guidelines, contact us. We’re

here to help!

Get Published in Natural Awakenings!

Contact us directly at:609-249-9044

[email protected]

wisewords

Kamini Desai’s Ph.D.-worthy ver-satile body of teachings combines her lifelong interests in Western

psychology and Eastern philosophy. Trained at the Kripalu Center for Yoga & Health, in Stockbridge, Massachusetts, she develops and leads core programs for Florida’s Amrit Yoga Institute, provid-ing advanced studies dedicated to the science and system of integrated human development. A resident of Salt Springs, Florida, and the Netherlands, she teaches in 10 countries on three continents.

What is a yogic lifestyle? It means being focused on inner peace. Through the study of yoga as a complete science of self-mastery, I’m cultivating the realization of my highest self beyond body and mind. This intention is the director of my unfolding life. I like to use the metaphor of a ship. If this higher self as a wise captain isn’t steadily setting the course at the helm, then on any given day, the happy, sad, griev-ing, enthusiastic or de-pressed me will likely be steering my life in a contrary direction and I’ll just be going in circles. In the Inte-grative Amrit Method of Yoga, along with the integrative method of yoga nidra

Kamini Desai Explores a Yogic Life

Inner Calmness Leads to Self-Masteryby Linda Sechrist

that I practice and teach, my focus is on the release of body energy, rather than any physical pose. Energy is healing. When energy is freed up, it naturally calms the mind and creates a spontane-ous, meditative state in which the high-est self can be experientially known. To free energy, I attune to the sensations resulting from the physical alignments in any yoga posture. Each pose focuses attention on sensations occurring along the meridian lines in the body, allowing areas that are blocked and limited to open up and energy to optimally flow. Then, in what Amrit yoga describes as the “second half of the posture,” I close my eyes and feel that released energy becoming magnified through my attention. The stronger the

energy becomes, the more the mind organically dissolves into a meditative state where mental, emotional and physical healing can hap-pen spontaneously.

What was it like to grow up as the daughter of Yogi Amrit Desai, a well-known guru?

I feel blessed that I was exposed to my father’s

teachings from a young age. His message that I

first embraced was that people and

things will always change, and if I rely on either of


COLON HYDROTHERAPYMention This Natural Awakenings Ad For 25% Off Initial Session

REDUCED GAS AND BLOATINGRELIEVES CONSTIPATION &

PROMOTES REGULARITYDETOX • WEIGHT LOSS

Call 609-587-8919 • www.wellnesswithinnj.com 3692 Nottingham Way, Hamilton, NJ 08690

Our all natural personal skin care product brings comforting relief to sufferers of many skin irritations. DermaClear has proven to be effective against:

• Shingles • Psoriasis • Eczema • Burns• Allergic Rash • Jock Itch • Stings • & more

DermaClear will simply feel good putting it on. Cooling and soothing, the Calcium Montmorillonite/Calcium Bentonite clay penetrates pores and open areas of the skin and pulls out toxins and inflammation. The proprietory blend of homeopathics go even deeper, address the root causes and assist to bring even deeper toxins to the surface.

4-oz jar-$29.99+ $5 shipping-up to 5 jars

Order Online Today atNAWebstore.com or call 888-822-0246

Wholesale Pricing Available to Stores and Practitioners

Have a Stubborn Skin Disorder and Tried Everything Else?

Finally there is a solution, try Natural Awakenings DermaClear, a natural, affordable skin repair salve.

them for happiness and peace of mind, I’m depending on the undependable. The need is to find internal stability in the midst of every polarity. My dad, now approaching 82, has always been an example of one whose entire life is about moving towards a changeless state of being and of what it means to remain a nonjudgmental witness to all that happens in life. Still, I had to learn my own lessons.

How have you benefited from yoga? I began studying with my dad when I was 16. Now, at 46, I more fully value the depth of yoga. The longer I practice, the more grateful I am that my mind is less fragmented than it otherwise would be. I’m progressively able to deal with situations that would have sent me over the edge before. I more naturally avoid wasting a lot of mental energy in internalized, “If they say this then I’m going to say that,” conversations. With less mental chatter, I have more energy and stamina to focus on what is in front of me. I can be totally absorbed in each present moment for a deeper sense of fulfillment in what I’m doing.

How do you feel about the Westernization of yoga?Individuals that begin any style of yoga for its physical benefits are off to a good start, but anyone that maintains a regular practice becomes curious about yoga’s other benefits, like relaxation, more peace and a sense of happiness that arises without any apparent cause. Eventually they ask, “Why is this good thing or greater bliss happening to me? What else is there besides postures?” Although everyone eventually learns many life skills, we rarely learn how to live our lives well, manage our emotions and relate to others in ways that create more peace and happiness within. These are the uncaused benefits of yoga that people come to love.

Find more of her words of wisdom in articles posted at KaminiDesai.com.

Linda Sechrist is a senior staff writer for Natural Awakenings. Visit ItsAllAbout We.com for the recorded interview.


Order Online Today at NAWebstore.com

or call: 888-822-0246

A FewDrops Can

Change Your Life!

1-11 bottles ...... $19.99 ea.12-23 bottles .... $14.99 ea.24 + bottles .........$9.99 ea.$5 Shipping/up to 8 bottles

1 bottle = 6-8 wk. supply

You could feel better, lose weight or increase energy and mental clarity with a few drops of Natural Awakenings DETOXIFIED IODINE daily in water or on your skin when used as directed. An essential component of the thyroid, iodine replacement has been reported to give relief from:

• Depression • Weight Gain• Fibromyalgia • Low Energy• Hypothyroidism • Hyperthyroidism• Radiation • Bacteria & Viruses

Shop Natural Awakenings’ Online Webstore for More Special, Natural Products

Mindfulness, simply defined, is being in the moment. Using simple tools can help us consciously notice our breath, bodies and sensations, as well as what is

happening around us. As we practice noticing, we can more readily return to the moment and more immediately con-nect with ourselves and others. Integrating five mindfulness practices into our young children’s lives is easy and yields powerful dividends.

Build Relationship with Breath Connecting the rhythm of breathing to experiences helps children understand how to calm down. (Older children might enjoy learning the effects of breathing throughout their system.) First, ask children to notice their breath. Invite them to put a hand in front of their nose and breathe and say, “This is breath. All living things breathe.” Encourage them to share their response to the experience. Next, move to modeling breathing patterns in relation to experiences and feelings such as, “I feel so frustrated that my breath is moving fast. Look at my chest.” Then model return-ing to calm breathing with, “I am putting my hand on my chest and reminding myself to take longer breaths.” Help children notice how their breath changes through-out the day. Games can support this increased awareness. Ask the child to lie down, place their hands on their chest

Mindfulness for Little Ones

Teaching Kids to Be Calm and Focused

by Traci Childress

healthykids

Buy into your community … Support our advertisers


NEXT STEP STRATEGIES, LLCA Holistic Approach to Health & Vitality

Siobhan Hutchinson, MAHolistic Health Practitioner

T’ai Chi, Qigong & Reiki Master TeacherEnergy Medicine

Serving Mercer, Ocean, Monmouth & Bucks Counties

NextStepStrategiesLLC.com609-752-1048

All Natural/OrganicToxin-Free ProductsResidential/Office/RealEstateEvent Cleaning-Before, During & After

[email protected]

“Keeping your family and our world

healthy together”Mention this ad for

10% OFF!

DOWN TO EARTHAll Natural Cleaning Service

and belly and lie still. Ask them to notice their breath, and then have them stand up and jump up and down before noticing their breath again. After hard play, tell them, “Your breath is moving so fast because you were running hard.” At bedtime, soothingly note, “Your breath is getting sleepy and slow.” Remember to be a witness, rather than a judge. Play is an excellent way to discover how breathing changes. Partner with a child to try to simulate how favorite animals breathe. Invite them to try sustaining a sound, such as chanting a vowel letter, and time how long they can do it.

Notice Feelings and SensationsPractice a regular mind/body check-in. At breakfast, inquire, “How are you feeling today?” or “Feelings check! At the mo-ment, I am feeling tired and excited. What about you?” The idea is not to change or fix anything, just to notice, allowing a broadly defined perspective. Children might be able to describe a specific feeling or only an overall sensation like jumpy or buzzing.

Cultivate Sensory Awareness Paying attention to sensations can bring children and adults into the moment. Integrate sensory awareness into daily life with simple questions like, “What do you see? What do you hear? What do you smell?” We can bring this practice with us everywhere—into the waiting room at the dentist’s office, in the car or on a plane.

Practice Moments of QuietIntentionally quiet moments support the development of mindfulness and empower children to consider “not doing” a valid part of everyday life. When they are given the opportu-nity for quiet time, they often love it. Try asking the child to get so quiet that they can hear a particular sound in the room—their breath, the tick of a clock or the hum of a computer. Once they hear it and you do too, you can dismiss the practice session with a bell, gentle clap or another soft sound.

Send Well Wishes The traditional Buddhist practice of mettha, or loving kind-ness, meditation involves reciting phrases that we direct first to ourselves and then outward toward others. For example, think, “May I be safe. May I be well. May I be at peace,” and then repeat the same phrases for someone we love, someone we don’t know personally and ultimately, all beings. When, for example, children ask why ambulances emit such loud, wailing sounds, we might explain, “Emergency rescue workers are helpers. Their sirens mean they are going to help someone. When we hear the sirens, we can wish them well by saying, ‘May they be safe.’”

Traci Childress, co-founder and executive director of the Children’s Community School, in Philadelphia, PA, teaches mindfulness practices and yoga. Learn more at TraciChildress.com.

Join us for our Spiritual Transformation Service Sundays at 10:30 AM, Princeton Masonic Lodge, 345 River Rd, Princeton (1 mile off Rt. 27).

For directions or more information about our Sunday service, classes and workshops, call (609) 924-8422 or visit cslprinceton.org

Try a Fresh Approach to Spiritual Wisdom

The Center for Spiritual Living Princeton is a warm and welcoming, trans-denominational community. Our Center offers a fresh and practical approach to spirituality that draws on the timeless wisdom of the ages to promote both spiritual and personal growth.


phot

os b

y St

ephe

n B

lanc

ett

consciouseating

“We are now seeing 20 percent

non-Indian customers in our store,” says Vipul Patel, owner of the Louisville, Kentucky, branch of Patel Brothers, the largest Indian U.S. grocery store chain. “Usu-ally, new customers come in with an Indian recipe and we help them find the ingredients.”

Indian VeggiesVegetarianism has been a way of life in India for millennia. Some Indian vegeta-bles may already seem familiar; winter melon, or white pumpkin, for example, is a squash that cooks and tastes like its orange counterpart. Eggplants native to India are egg-shaped and smaller than the American variety; they cook in less time and have a less bitter taste. Other popular Indian vegetables, such as okra seedpods (eaten as a cur-ried entrée or side dish and also used to thicken stews and soups), fenugreek

Indian Vegetarian CookingPotent Spices and Veggies Fend Off Disease

by Bushra Bajwa

leaves and aromatic seeds from the pea family have become common American crops. Tindura, a gourd

used in curry, and daikon, often eaten raw in salads or seasoned as stuffing in flatbread, are relatively new here. “By eating a larger variety of vegetables, consumers benefit from an increased array of vital nutrients and spe-cialized phytochemicals that have heal-ing and medicinal qualities,” says Ronald Hubbs, a practitioner at NW Naturo-pathic Medicine, in Portland, Oregon. He advises against overcooking vegetables to maintain their nutritional qualities. Hubbs notes that bitter gourd is probably one of the most underappreci-ated Western foods, yet studies on mice sponsored by the Garvan Institute of Medical Research, in Sydney, Australia, and the Chinese government show that it contains four compounds that are ef-fective in reducing blood glucose levels in diabetic patients.

Also consider pickled vegetables, known as achar. “Naturally fermenting vegetables can turn some of them into su-perfoods, with enhanced properties that are rich in healthy bacteria and support digestion and immunity,” says Hubbs, cit-ing studies in the Journal of Nutrition and Clinical Microbiology Reviews. Daals, or lentils, including Indian diet staples peas and beans, provide a good source of protein that is also high in fiber, he says. Lentils—highly versatile and available with or without the skin, whole or split—can be eaten thick and creamy, soup-like or dry, cooked with other vegetables or simply enhanced with basic Indian spices. Popular legumes include black-eyed peas and garbanzo beans. Different regions in the Indian subcontinent have their preferred daal spices and cooking methods, but all citizens often serve them with boiled rice or Indian bread, called chapatti.

Indian SpicesAlthough often considered “hot”, the blend of aromatic herbs and spices used in many Indian dishes, including those incorporating dairy, can be layered in for tantalizing flavors without necessitating frequent water breaks. Many commonly used herbs and spices have proven medicinal properties, historically recognized for

Vegetarians seeking flavorful variations can turn to 9,000 Indian, Pakistani

and Bangladeshi grocery stores nationwide.

Indian dishes offer tantalizing options in a vegetable-rich diet. EZ Garam Masala

Authentic garam masala is made with whole spices that have been roasted and ground, but this quick and easy substitute will add a warm, sweet flavor to vegetables, rice and other foods.

2 Tbsp ground coriander1 Tbsp ground cumin 1 Tbsp ground cardamom1 Tbsp ground black pepper1 Tbsp ground fennel seed1 tsp ground mustard ½ tsp ground cloves½ tsp ground cinnamon1 tsp ground cayenne red pepper2 Tbsp ground turmeric

Mix the spices in a small bowl, place in an airtight container and store in a cool, dry place.


their healing properties in ayurvedic therapies and more recently, in Indian alternative medicine. According to Uni-versity of Illinois research, fennel flower (black seed) and fenugreek improve lactation. University of Maryland Medi-cal Center research shows that fennel seeds aid digestion. Further, the Journal of Phytopathology reports that carom seeds have antiseptic properties. Recently, researchers at Penn State University found that antioxidant spic-es such as turmeric, oregano, cinna-mon, cloves and paprika reduced tri-glycerides in the blood by 30 percent, helping to reduce the risk of chronic disease. “That’s because adding spices to a meal decreases the amount of fat in the bloodstream after eating,” explains study leader Ann Skulas-Ray, Ph.D. “There are clear benefits to add-

Spicy Indian Family RecipesBasic Okra3 Tbsp olive oil2 finely chopped medium yellow onion2 finely chopped vine tomatoes18 oz okra (about 50 pieces), washed, dried, ends trimmed and then cut into ½-inch piecesSea salt to tasteRed chili powder to taste½ tsp coriander powder ½ tsp turmeric powder Fresh cilantro for garnish

Heat oil in a 2-quart saucepan to lightly brown the onions.

Add salt, chili powder, coriander powder and turmeric. Mix.

Add tomatoes and cook on medium heat for 5 to 6 minutes, covered.

Add the okra, mix well and simmer for another 8 to 10 minutes.

Serve garnished with cilantro.

Organic Baby Potatoes and Chickpeas1 Tbsp olive oil2 cups chickpeas, cooked, drained and rinsed3 baby potatoes, washed and diced

1 finely chopped tomatoSea salt to taste1 tsp garam masala blend of ground spices1 jalapeño finely chopped (optional)¼ tsp baking soda2 Tbsp purified waterFresh cilantro for garnish

Heat oil in saucepan before adding ingredients.

Add chickpeas, potatoes, tomatoes, salt and garam masala to saucepan and bring to a boil.

Add baking soda and water, and then simmer for 7 to 8 minutes or until pota-toes are tender.

Maash Daal2 Tbsp olive oil2 cups maash (urad) lentils1 medium yellow onion, peeled and finely chopped1 tsp ginger, peeled and finely chopped1 clove garlic, peeled and finely chopped½ tsp turmeric½ tsp coriander powder2 cups purified waterSea salt to tasteChili powder to taste2 tomatoes, finely choppedFresh cilantro and chilies for garnish

Wash lentils and soak in warm water for 1 hour.

Heat oil in saucepan to brown onions.

Add ginger and garlic, spices and toma-toes and stir for a few minutes to make a paste.

Add lentils and water, and then bring to boil.

Simmer on low to medium heat for 30 minutes.

Bitter Gourd2 Tbsp olive oil5 bitter gourds1 medium yellow onion, peeled and sliced finely2 tomatoes, chopped finely1 tsp turmericSea salt to taste

Wash and trim bitter gourd ends.

Cut in half lengthwise and remove the seeds.

Slice the halves into ¼-inch pieces.

Rub salt into the pieces and set aside for 20 to 30 minutes (to remove the bitterness).

Rinse out the salt and dry the bitter gourd.

Heat oil in saucepan and then add bitter gourd, turmeric and salt.

Sauté on medium heat for 3 to 4 minutes.

Add onions and sauté for another 5 minutes.

Add tomatoes, mix well and cook on medium heat for another 5 minutes.

Recipes courtesy of Bushra Bajwa.

ing spices to your meal, even if you’re only adding them occasionally.” Sprinkling a little turmeric and gin-ger on legumes or other vegetables while boiling or sautéing them can create a palate-pleasing dish with health ben-efits. Numerous studies, including those from the University of Michigan and the University of Minnesota, show that these ingredients may help fight several kinds of cancer, reduce inflammation and relieve arthritis pain, among other benefits. Americans can easily learn to bring out the best in their own Indian cuisine with the subcontinent’s alluring blends of herbs and spices delivering both un-forgettable flavor and nutrient-rich fare.

Bushra Bajwa is a freelance writer in Issaquah, WA. Connect at [email protected].


(good cholesterol). Consequently, onions are beneficial in preventing heart disease and stroke.

4. Garlic Known health benefits of garlic are exten-sive. The Journal of Nutritional Biochemistry reports that garlic inhibits cardiac artery calcification and reduces the amounts of free radicals in the bloodstream, helping to reduce plaque deposits in the arter-ies. Research by the University of Maryland Medical Center also attests that garlic contains anti-inflammatory compounds that help protect against conditions often associated with aging, like asthma and arthritis.

5. Legumes All types of everyday legumes are an excellent source of cholesterol-lowering fiber and energy-

boosting protein and iron. No one bean

has an advantage over the others in providing vital nutrients. Lentils are high in fiber and, according to a study published in Nutrition Reviews, help to manage blood sugar. Black beans are rich in anthocyanidins. Kidney beans, filled with thiamin, work to improve functioning of neurotransmitters essential for memory, notes the National Institutes on Aging. Green beans are rich in vitamin K, essential to bone sup-port. Garbanzo beans provide high amounts of minerals that aid in metabolizing carbohydrates, fats and proteins and strengthening tooth enamel, as studied by Dr. Lydia Bazzano, a professor at Tulane University School of Public Health and Tropical Medicine. According to research by the National Institutes of Health and others, fiber-rich legumes play an important role in the prevention of gallstones, increased cardiac health, regulation of blood sugar, low-ered total cholesterol levels (as well as increasing beneficial HDL cholesterol) and protection from cancers, especially colorectal cancer.

Today’s battle against the effects of aging buzzes with hype about acai, goji, noni and mangosteen. But what about the foods most people typically eat?

It turns out that many anti-aging foods can be found in every-day kitchens, and unlike some other solutions, they can keep us looking and feeling younger and improve our all-around health without breaking the budget.

1. Oranges Loaded with antioxidants, oranges are also packed with vitamin C, fiber and folate and sig-nificant amounts of vitamins A and B1, potassium and cal-cium. According to studies by the Australian research group CSIRO and others, oranges help boost immunity, lower cholesterol and reduce free radical damage and oxida-tive stress.

2. Blueberries One of the most exciting nutritional properties of blue-berries is their abundance of anti-oxidants called anthocyanins. Studies

published in the Journal of Neuroscience suggest that these powerful phytonutrients

neutralize free radical damage, enhance the health of all body tissues, protect the

cardiovascular system, guard the brain against oxidative stress, and improve brain

function, including memory.

3. Onions The more pungent the onion, the greater the health benefits. Studies like those from Cornell University have found that high onion consumption lowers blood sugar levels and decreases total cholesterol, while increasing levels of HDL

NATURAL DEFENSETop 10 Whole Foods to Counter Aging

by Gary Null

consciouseating


6. Shiitake Mushrooms These fungi are a good source of iron and lentinan, a polysac-charide that studies at the Iizu-ka Institute, in Japan, suggest activates our immune system’s tumor-fighting T cells.

7. Tomatoes Tomatoes are loaded with healthy vitamins and trace minerals. They are also a good source of lycopene, which studies from the American Association for Cancer Research have linked to the protection of DNA from damage, prevention of heart disease and protection against cancers,

including colorectal, breast, endo-metrial, lung and pancreatic

types. Tomatoes are also rich with carotenoids, which research by the Cochrane Hepato-Biliary Group has associated with protection

from heart disease and can-cer, improved night vision and

regulation of blood sugar.

8. Leafy Greens Calorie-for-calorie, greens are among the most nutrient-packed foods we can eat. Spinach, kale, arugula, Swiss chard, cabbage, collard greens and watercress are all solid sources of powerful nutrients. Eating a variety of leafy greens has been shown by Katherine Tucker, Ph.D., with the Jean Mayer U.S. Department of Agriculture Human Nutrition Research Center on Aging at Tufts University, to help improve bone density (a problem area when aging), increase night vision, lower blood pressure, boost energy, increase circulatory health, protect against macular degen-eration, and work to prevent a variety of cancers.

9. Soy Although soy is a legume, it deserves separate mention, because of its extensive and well-researched health benefits and use in a wide range of forms. Soy offers a high concentration of molybdenum, a trace mineral that plays a role in three enzyme systems involved in metabolizing carbs,

fats and proteins and tryptophan, an amino acid essential for growth

and normal me-tabolism, as well as iron, fiber, phos-phorus, omega-3

fatty acids, magne-sium, copper, vitamin

B2 and potassium.

10. Whole Grains While most Americans know that whole-grain breads and pastas are healthier than those made with refined white flour, we might include many grains other than wheat in our diet, in order to fight the effects of aging. Spelt, for example, provides ribofla-vin, which research from the Micronutrient Information Center with the Linus Pauling Institute shows can promote healthy skin and good vision. Barley can help with sleep regulation. Millet can help reduce the risk of a heart attack and lower blood pressure. With all these examples of truly good eating right in our own kitchen, there is no reason not to start improving our diet right now to pave the way for a longer, healthier life.

Gary Null has written over 70 books, booklets and audio CDs on health and wellness, nutrition and alternative medicine. His syndicated radio talk show, Natural Living with Gary Null, is the longest-running continuously airing health program in America, and now also airs on the Internet. Null owns a dietary supplement company and a health foods store in New York City. For more information, visit GaryNull.com.

• 100% Organic Produce• Delicious & Healthy Deli Selections• Vitamins, Herbs & Homeopathic Remedies

mrsgreens.comVisit Our Website at:

Good food. Good for you. Good for the earth.

$5 OFF $50 PURCHASEPLU # 75047


AWAKENING AMERICA

Natural AwakeningsCelebrates 20 Yearsof Conscious Living

Read What People Are Saying About

Natural AwakeningsNatural Awakenings provides helpful information on natural health and en-vironmental issues with a consistently positive perspective and tone, which is not always easy considering how serious and intimidating some of these topics are. It’s a rarity.

~ Sayer Ji, founder, GreenMedInfo.com

Publications like Natural Awakenings reach many people and I’m so glad to be able to share a voice beyond the propaganda.

~ Melinda Hemmelgarn, Food Sleuth

I have changed so much over the last year finally realizing that life is so much bigger than me. I love this Earth and all the wonders that are a part of it, and your magazine contributes to my appreciation.

~ Theresa Sutton, Connecticut

It is unusual to see your level of writing and consciousness in a free publica-tion. Thanks for a great work.

~ Kaih Khriste’ King, Arizona

Natural Awakenings magazine is the only advertising I use for my practice other than word of mouth referrals and it has brought us new patients consis-tently especially now that we advertise monthly. The quality of the leads is great and we really enjoy helping the holistic-minded patient. The publisher is great to work with and truly wants to see the business succeed. We plan on always advertising with Natural Awak-enings and expanding our presence in the magazine.

~ Cate Vieregger, DDS, Colorado

A classroom pet can help stu-dents learn about caring for another species, but is

it the best way to teach? “A classroom pet can be a great opportunity to teach children gentle behavior. Many kids take pride in caring for the pet,” observes Terry Man-rique, now a professional parent coach in Columbus, Ohio, who earlier worked with children ages 5 and 6 at Little People’s Country, in LaGrange, Illinois. To prevent jealousy, students can rotate responsibilities for animal care in the classroom and during school breaks. Pet Care Trust, which awards grants to teachers for hosting pets, pro-vides care instructions and informa-tion about transmittable diseases for a bearded dragon, tarantula, rat, rabbit, leopard gecko, guinea pig, gerbil, dwarf hamster, beta fish, ball python, mouse and aquatic turtle. (Find more information via Tinyurl.com/Avoid PassingDisease.) The ASPCA advises that the pet’s environment shouldn’t be stressful and care should meet its specific needs. For example, keep handling of an animal to a minimum, and then only with adult supervision. Provide food, clean water and basic veterinary care, including vaccinations and parasite

THE GREAT CLASSROOM PET DEBATEKids Like Classroom Pets, Animal Lovers Raise Doubts

by Sandra Murphy

control, grooming, exercise and social interaction. Diligence in finding and eliminating hazardous substances and situations is equally vital. Susan Tellem, co-founder of American Tortoise Rescue, in Malibu, California, elaborates on her area of expertise—turtles and tortoises. “A tank isn’t a natural environment for a reptile and doesn’t allow enough room for exercise. It’s like asking a hu-man to live in a bathtub,” says Tellem. She points out that they also need a proper diet and natural sun, not artifi-cial light. Tellum used to take rescued turtles for classroom visits until a particularly large specimen staged a protest to the unnatural environment by making a mess, tearing up school papers and posters. Tellem further warns that a tur-tle might bite (and not let go until the person relaxes) or pinch small fingers

naturalpet


when retreating back into its shell. These days, she prefers to share an educational DVD that shows turtles at their best—in their own habitat. (Find more information at Tortoise.com.) “Constant artificial lighting goes against the natural sleep cycle of an animal,” comments Vet-erinarian Amber Andersen, in Rancho Palos Verdes, California. “You can see it at shelters—dogs and cats are unable to achieve a restful sleep and become agitated.” Too often, the responsibility for caring for a classroom pet falls on the teacher during holiday breaks and summer months. “We had a popular chinchilla that was usually nocturnal, but also made appearances during the day,” says Manrique. “Then one of the teachers brought her dog to school, which caused stress for the chinchilla. When a new student had an allergic

9 Worst School Pets

reaction to the furry creature, we had to find a new home for him. Our next pets were fish.” Manrique’s students have also secured fertilized eggs from a local farmer to watch them hatch before the chicks returned home to the farm. “When we had caterpillars that turned into butterflies, a fun field trip

to the park became the official winged release party,” she says. There is always the chance a pet might die during the school year. Parents are advised when a classroom pet dies and students have a classroom discus-sion to help them work through their grief. Lisa Cohn, co-author of Bash and Lucy Fetch Confi-dence, in Portland, Oregon, wrote the book with her son, Michael, after the sudden death of their dog, Lucy, as a way to help them deal with their sadness. The Humane Society of the United States

Birds—can be messy and noisy, bite when handled too much or roughly, are stressed by too much noise and can pass salmonella.

Chinchillas—nocturnal; need cool, constant temperatures of less than 85 degrees and don’t like to be handled. They need time out of the cage daily (subject to being stepped on by eager children) and require an allergen dust bath to remove oil from their fur.

Ferrets—emit a strong odor and have a tendency to nip.

Frogs—petting can transmit salmonella.

Hamsters—nocturnal; poking can lead to a bite.

Iguanas—can grow to over six feet long and a tail-swiping can be painful; generally not friendly and have highly specific dietary needs.

Rabbits—don’t like to be handled, can bite or scratch; need a calm and peace-ful environment to avoid potential stress-

induced heart attacks. Dr. Clark Fobian, of Sedalia, Missouri, president of the American Veterinary Medical Associa-tion, says they require hay or grasses, fresh greens, vegetables and a high-grade pellet food, plus toys to prevent boredom and excessive tooth growth.

Snakes—can be aggressive during molting.

Turtles—need sunlight, specific diet and more exercise space than a tank can provide; salmonella may be transmitted through their drinking water or by touch.

Better AlternativesFish—relaxing to watch and easy to feed.

Guinea pig—larger than a hamster and more easily handled; need space to move around and another companion guinea pig. Fresh food, high in vitamin C, is necessary, according to Fobian. Mites can be a problem requiring a vet visit.

Source: Adapted from PetMD.com

is not in favor of classroom pets. To avoid being vulnerable to predators in the wild, animals often hide symptoms of illness or injury. In captivity, that behavior can delay veterinary help. Recommended alternatives to bringing animals into the classroom include field trips to nature centers, wildlife refuges and animal shelters. The society’s Kind News magazine for students from kindergarten through sixth grade shares stories of rescued animals, pet care tips and how-tos for nurturing backyard wildlife (Humane Society.org). Before deciding on a classroom

pet, consider life from the pet’s point of view—how loud is the class, how old are the

kids, how much maintenance will be needed and how much space is needed for a proper habitat. There might be a bet-ter way to learn—and teach.

Contact Sandra Murphy at StLouisFreelanceWriter@mind spring.com.

Try to be a rainbow in someone’s cloud.

~Maya Angelou


MONDAY, SEPTEMBER 1Diet to Go Food Tasting – 9-11am. Free. Fresh made food delivered directly. Come see why these prepared meals are not only more affordable, but fits the perfect weight-loss plan perfectly. Retro Fitness of Bordentown, 860 Rte 206, Bordentown. 609-372-4020.

WEDNESDAY, SEPTEMBER 3Tea & Tour, Morven Museum & Garden – noon and 2pm. Tea served at 1pm. Invite a friend (or a few) to relax in the classic elegance of Morven’s Garden Room overlooking the Colonial Revival Garden. Tea includes tea sandwiches, scones, and an assortment of fresh fruit and sweets. A docent-led tour accompanies the tea and can be taken either time. Reservation required. Cost $16/$20, member/non-member. Morven Museum & Garden, 55 Stock-ton St, Princeton. 609-924-8144 x103.

THURSDAY, SEPTEMBER 4Community Acupuncture Sessions – Call for appointment times. Treatment designed for stress management and routine aches. Aware Acupuncture, 114 Straube Center Blvd, Ste K 6-7, Pennington. 609-737-0970.

Children’s Story time in Garden – 11am-12pm. Ali Morgan, wife of farm manager Scott Morgan, will foster your child’s imagination through her special children’s story readings. RSVP requested. Blue Moon Acres Farm Market, 11 Willow Creek Dr, Pennington. 609-737-8333.

SATURDAY, SEPTEMBER 6WWFM Events – 9am-1pm. Free. Special events for West Windsor Farmers’ Market. Music: Blue Jersey Band, Community Groups: PHS, free b/p and health screenings; WWAC, children art activity; Cooking Demonstration, Chef Adam of Griggstown Farm. Princeton Junction Train Station, Vaughn Drive Park-ing Lot, Princeton Junction. 609-933-4452.

Back to School Day – 11am-3pm. Free. School bells ring once again in Pleasant Valley when Howell Farm invites the public to participate in a unique “back to school” day. The program features the educational, social and cultural activities centered on the “one-room school” in rural life of 1900. Howell Living Farm, 70 Wooden’s Lane, Lambertville. 609-737-3299.

Mercer County Insect Festival – 1-4pm. For chil-dren of all ages. Hunt for insects in the meadow, bugs galore, butterfly birth, and hayrides. Local naturalists and Master Gardeners will offer insect displays, games, crafts, live honeybees, a puppet show, and more. Mercer Education Gardens, 431A Federal City Rd, Pennington. 609-989-6830.

SUNDAY, SEPTEMBER 7Back to School, Create your own Curriculum to build your Life – 10:15am. If you are looking for a warm, dynamic community of spiritually-minded people, try a transformation services and mingle afterward with refreshments and conversation. The

calendarofevents making decisions about how to use it to create fulfillment. Led by Shirley Roberts, Helen Burton and Carol King. RWJ Health & Wellness Center, 3100 Quakerbridge Rd, Hamilton. Register 609-584-5900.

FRIDAY, SEPTEMBER 12Fall Native Plant Sale – 3-6pm. D&R Greenway’s Native Plant Nursery at the Johnson Education Cen-ter, 1 Preservation Place, Princeton. 609-924-4646.

SATURDAY, SEPTEMBER 135 Mile Race / 1 Mile Fun Walk – 8:30am. Hosted by Community Education & Outreach of Princeton HealthCare System and Princeton Fitness & Well-ness Center. Proceeds benefit the Jim Craigie Center for Joint Replacement at University Medical Center of Princeton. Cost $30/$20, run/walk per person. Education Testing Services, 660 Rosedale Rd, Princeton. 609-897-8982.

Fall Native Plant Sale – 9am-12pm. See September 12 listing. Princeton.

WWFM Events – 9am-1pm. Free. Special events for West Windsor Farmers’ Market. Music: Jeff Griesemer, Community Groups: Twin Rescue Squad, free b/p screening; Cooking Demonstration: WWCFM cooking basics. Princeton Junction Train Station, Vaughn Drive Parking Lot, Princeton Junc-tion. 609-933-4452.

Apple Day – 10am-5pm. Celebrate fall at the 39th Annual Apple Day at Terhune Orchards. Join your friends and neighbors for two days of fun, activities, and music for the harvest season. Cost admission $5/person, under 3 free. Terhune Orchards, 330 Cold Soil Rd, Princeton. 609-924-2310.

Sample Saturday – 10am-2pm. Meet neighborhood chiropractors and healers. Posture evaluations, neck massages, acupuncture and homeopathic consulta-tions and education. Big Bear Natural Foods, 7 Rte 31 N, Pennington. 609-737-8822.

Canning Class – 11am-3pm. Free. Throughout the day, farmers will be canning and pickling surplus garden crops like cucumbers, zucchini, tomatoes and more. You can sample the results and take home recipes and other secrets that made canning a mainstay of the 1900 farm. Howell Living Farm, 70 Wooden’s Lane, Lambertville. 609-737-3299.

Organic Turf Revival Workshop – 11am-12:30pm. Presentation will provide practical knowledge of ba-sic organic systems for turf management, rebuilding soil, and soil health. Learn to revive summer stressed turf sustainably and prepare for next year’s growing season. Cost $15/$5, per person/each additional. Blue Moon Acres Farm Market, 11 Willow Creek Dr, Pennington. 609-737-8333.

Back to Camp Day at Wargo Pond – 2-4pm. Free. Bring your family and friends back to camp for an afternoon around the pond. Meet up with summer camp friends and see your counselors again when you hike around the pond, use the seine net from the shore, create watercolors on the dock and enjoy marshmallows roasted on a campfire. Just like camp, it’s rain or shine so dress for the weather. Stony Brook-Millstone Watershed Association, 31 Titus Mill Rd, Pennington. 609-737-7592.

SUNDAY, SEPTEMBER 14Apple Day – 10am-5pm. See September 13 listing. Princeton.

Center for Spiritual Living Princeton. Location at Princeton Masonic Lodge, 345 River Rd (Rte 605), Princeton. 609-924-8422.

How Sweet it Is, Pairing Wine & Chocolate – 2pm. Enjoy a sweet afternoon filled with tips on how to pair your two favorite foods. Includes instruction, wine tasting, tour and your personal assortment of Pierre’s Chocolates. Cost $35. Crossings Vineyards & Winery, Washington Crossing. 215-493-6500x19.

TUESDAY, SEPTEMBER 9Read & Pick Program, Chickens – 9:30 and 11am. Parents and children (age’s preschool to 8 years) are welcome to celebrate everything wonderful about chickens. Event includes two book readings about chickens then visit laying hens and learn a dance. Cost: $7/child. Registration requested. Terhune Or-chards, 330 Cold Soil Rd, Princeton. 609-924-2310.

Shape for Life – Information Session – 6:30pm. Free. Learn to change your lifestyle and permanently lose weight. Jill Nitz, bariatric coordinator, who specializes in the treatment of obesity, discusses RWJ Hamilton’s Comprehensive Weight Loss Pro-gram - including physician supervised weight loss, a tailored exercise program and nutritional counseling. RWJ Fitness & Wellness Center, 3100 Quakerbridge Rd, Hamilton. 609-584-5900.

WEDNESDAY, SEPTEMBER 10Take a Walk on the Wild Side – 8:30-9:30am. Start your autumn day off right with a walk on the Watershed Reserve trails with Teacher-Naturalist Allison Jackson. Walks will happen rain or shine so dress appropriately for seasonal temperatures and possible muddy conditions. Walks will continue bi-weekly throughout the season – join one or all. Binoculars and nature journal are encouraged. Cost $free/$5 member/non-member. Stony Brook-Millstone Watershed Association, 31 Titus Mill Rd, Pennington. 609-737-7592.

THURSDAY, SEPTEMBER 11Children’s Story time in Garden – 11am-12pm. See September 4 listing. Pennington.

Time at Last – 2pm. Free. Navigating Retirement. So much of our life and identity revolves around work. This supportive group discusses the joys, concerns and challenges of having extra time and

NOTE: All calendar events must be received via email by the 10th of the month and adhere to our guidelines. Email [email protected].


Your Mental Movie – 10:15 am. If you are look-ing for a warm, dynamic community of spiritually minded people, try a transformation services and mingle afterward with refreshments and conversa-tion. The Center for Spiritual Living Princeton. Location at Princeton Masonic Lodge, 345 River Rd (Rte 605), Princeton. 609-924-8422.

TUESDAY, SEPTEMBER 16Encore Careers: Doing Good While Doing Well – 6:30-8pm. Free. Combine passion, purpose and paycheck in a second career. Carol King, of PSRC’s “Next Step: Engaged Retirement and En-core Careers” will teach you how you can use your skills, knowledge and experience. RWJ Fitness & Wellness Center, 3100 Quakerbridge Rd, Hamilton. 609-584-5900.

WEDNESDAY, SEPTEMBER 17Time to Start a New Routine – 2-3:30pm. Classes are led by a registered dietitian. Includes taste sam-pling and recipes to take home. Register at least 3 days prior to class. The lazy days of summer may have added a few pounds. Cost: $10. RWJ Fitness & Wellness Center, 3100 Quakerbridge Rd, Hamilton. 609-584-5900.

Health Rhythms Drumming – 7-8pm. Group drum-ming is good fun and good for you. HealthRythms®, an evidence-based program, strengthens the immune system and reduces stress. Drums provided or bring your own. Mauri Tyler, CTRS, CMP. Cost: $15. RWJ Fitness & Wellness Center, 3100 Quakerbridge Rd, Hamilton. 609-584-5900.

Millstone Watershed Association, 31 Titus Mill Rd, Pennington. 609-737-7592.

SATURDAY, SEPTEMBER 20WWFM Events – 9am-1pm. Free. Special events for West Windsor Farmers’ Market. Music: A Little Bit Off; Community Groups: Yes We Can Food Drive, PHS, free health screenings; Massage: The Touch That Heals. Princeton Junction Train Station, Vaughn Drive Parking Lot, Princeton Junction. 609-933-4452.

On the Move – 9:30-11:30am. For families and children 5 yo+. Discover the mystery and magic of migration on the Watershed Reserve. During this morning walk, we will scan the skies for migratory hawks and search our meadows for Monarchs and dragonflies on their way to their winter grounds. This hike is co-sponsored by Washington Crossing Audubon Society. Cost $5/person. Stony Brook-Millstone Watershed Association, 31 Titus Mill Rd, Pennington. 609-737-7592.

Plein Air Painting Workshop – 10am-2pm. Explore how color defines forms, learn how to represent natural colors and experiment with brush strokes and textures. Taught by Arts Council of Princeton instructor Ray Brown. Workshop includes a Naturalist-led walk on the Reserve trails. Bring bag lunch. Cost $50/$60 member/non-member, 16yo+. Stony Brook-Millstone Watershed Association, 31 Titus Mill Rd, Pennington. Register through ACP at 609-924-8777.

Corn Shocking Class – 11am-3pm. Free. Visitors are invited to help farmers arrange corn stalks into shocks of about 100 stalks in the field. Cutting and shocking the corn lets the corn continue to dry down, leaving room to bring wagons into the field at harvest time and making it easier to access the ears, some of which are 8 feet off the ground. Howell Living Farm, 70 Wooden’s Lane, Lambertville. 609-737-3299.

SUNDAY, SEPTEMBER 21Row, Row, Row Your Boat – 10:15am. If you are looking for a warm, dynamic community of spiritually minded people, try a transformation services and mingle afterward with refreshments and conversation. The Center for Spiritual Living Princeton. Location at Princeton Masonic Lodge, 345 River Rd (Rte 605), Princeton. 609-924-8422.

TUESDAY, SEPTEMBER 23Read & Pick Program, Tractors – 9:30 and 11am. Parents and children (ages preschool to 8 years) are welcome to celebrate everything wonderful about tractors. Event includes two book readings about tractors and how they help farmers, then make craft and take tractor ride. Cost: $7/child. Registration requested. Terhune Orchards, 330 Cold Soil Rd, Princeton. 609-924-2310.

WEDNESDAY, SEPTEMBER 24Take a Walk on the Wild Side – 8:30-9:30am. Start your autumn day off right with a walk on the Watershed Reserve trails with Teacher-Naturalist Allison Jackson. Walks will happen rain or shine so dress appropriately for seasonal temperatures and possible muddy conditions. Walks will continue bi-weekly throughout the season – join one or all. Binoculars and nature journal are encouraged. Cost free/members, $5/non-members. Stony Brook-Millstone Watershed Association, 31 Titus Mill Rd, Pennington. 609-737-7592.

THURSDAY, SEPTEMBER 18Children’s Story time in Garden – 11am-12pm. See September 4 listing. Pennington.

Community Acupuncture Sessions – Call for ap-pointment times. See September 4 listing. Pennington.

Free Vision Screenings – 4-7pm. Princeton Health-Care System and the New Jersey Commission for the Blind: Project Prevention Unit offer these free vision screenings to uninsured or underinsured adults and children. All children must be accompanied by a legal guardian. Hamilton YMCA, 1315 Whitehorse Mercerville Rd, Hamilton. 1-888-897-8979.

Creepy Spider Night Hike – 7:30-9pm. Crab spiders, jumping spiders, wolf spiders, orb and funnel weavers and more. Join Education Direc-tor Jeff Hoagland on our annual night hunt on the Watershed Reserve trails. Bring a flashlight. Cost $8/$12 member/non-member, 5 yo+. Stony Brook-

SPREAD YOUR LIGHT

Help your community

become a healthier and happier place

to live by advertising in

Natural Awakenings’

October Sustainable

Communities Edition

To advertise or

participate in our

next edition, call

609-249-9044


THURSDAY, SEPTEMBER 25Art of Happiness Program – Sudarshan Kriya technique. Call for times. Twenty-hour course in-corporates specific natural rhythms of breath to har-monize body, mind and emotions. Cost $295/$395, students/non-students. 5 Sprague St, Chesterfield. 609-436-0714.

Children’s Story time in Garden – 11am-12pm. See September 4 listing. Pennington.

FRIDAY, SEPTEMBER 26Art of Happiness Program – Sudarshan Kriya technique. See September 25 listing. Chesterfield.

SATURDAY, SEPTEMBER 27WWFM Events – 9am-1pm. Free. Special events for West Windsor Farmers’ Market. Music: Sicilian Blue; Community Groups: Capital Health nutri-tionist, Twin Rescue Squad, free b/p screenings; Cooking Demo: Dorothy Mullen, Suppers program. Princeton Junction Train Station, Vaughn Drive Parking Lot, Princeton Junction. 609-933-4452.

Uproot Your Limiting Hidden Beliefs – 10am-12pm. Are you ready to uncover and release your limiting beliefs and create new, positive beliefs that have the power to transform your life? Try the introductory workshop. Suggested $15. Center for Spiritual Living, Princeton. Call for location details. 609-924-8422.

Art of Happiness Program – Sudarshan Kriya technique. See September 25 listing. Chesterfield

Reiki Level 1 Certification – 10am-6pm. Receive certification upon successful completion of this class taught by Pam Jones, RN. Class awards 7 nursing con-tact hours. Cost: $160. RWJ Fitness & Wellness Center, 3100 Quakerbridge Rd, Hamilton. 609-584-5900.

Introduction to Shamanic Journey – 10:30am-6:30pm. Cindy O’Connor, Shamanic Practitioner and Reiki Master will offer and introductory workshop into shamanic journeying. No previous experience. Cost $220. Energy for Healing, 4446 Rte 27, Kingston. 609-273-4399.

SUNDAY, SEPTEMBER 28Art of Happiness Program – Sudarshan Kriya technique. See September 25 listing. Chesterfield.

Introduction to Shamanic Journey – 10:30am-6:30pm. See September 27 listing. Kingston.

Making a Commitment to Love – 10:15am. If you are looking for a warm, dynamic community of spiritually minded people, try a transformation services and mingle afterward with refreshments and conversation. The Center for Spiritual Living Princeton. Location at Princeton Masonic Lodge, 345 River Rd (Rte 605), Princeton. 609-924-8422.

MONDAY, SEPTEMBER 29Art of Happiness Program – Sudarshan Kriya technique. See September 25 listing. Chesterfield.

Just for Girls – 6-8pm. Bring your 9-11-year-old daughter to this fun introduction to puberty, body image, self-esteem, and nutrition. Join nurses Stacey Poole, RN, and Heather Comisky, RN, for an interactive evening to help guide your daughter through this significant time in her life. Cost: $15. RWJ Fitness & Wellness Center, 3100 Quakerbridge Rd, Hamilton. 609-584-5900.

Nutrition Seminar, Clean Eating – 7-8pm. Free. Clean diet and move away from the SAD diet (stan-dard American diet) of processed foods, towards a wholesome food diet. Discover the health benefits of eating whole. Retro Fitness of Bordentown, 860 Rte 206, Bordentown. 609-372-4020.

plan aheadSATURDAY, OCTOBER 4WWFM Events – 9am-1pm. Free. Special events for West Windsor Farmers’ Market. Music: Larry Tritel; Community Groups: PHS free b/p and health screenings; Cooking Demo: Allie O’Brien of Garden State Community Kitchen; Massage: The Touch That Heals. Princeton Junction Train Station, Vaughn Drive Parking Lot, Princeton Junction. 609-933-4452.

TUESDAY, OCTOBER 7Read & Pick Program, Pumpkins – 9:30 and 11am. Parents and children (ages preschool to 8 years) are welcome to celebrate everything won-derful about pumpkins. Event includes two book readings about pumpkins then pick own decorative pumpkin. Cost: $7/child. Registration requested. Terhune Orchards, 330 Cold Soil Rd, Princeton. 609-924-2310.

CalendarA wonderful resource

for filling your workshops, seminars and

other events.

Two styles available: n Calendar of Dated Events: Designed for events on a specific date of the month. 50 words.

n Calendar of Ongoing Events: Designed for recurring events that fall on the same day each week. 25 words.

[email protected]

Contact us for guidelines so we can assist you through the process.

We’re here to help!

Always remember that you are absolutely unique—just like everyone else.~Margaret Mead


ongoingevents

sundaySpiritual Awakening Service – 10:15am. If you are looking for a warm, dynamic community of spiritually minded people, we encourage you to come to one of our Sunday Transformation Services and mingle afterwards with refreshments and con-versation. The Center for Spiritual Living Prince- ton holds services every Sunday at the Princeton Masonic Lodge, 354 River Rd, (Rt 605) Kingston. 609-924-8422.

Soup Kitchen – 4:30-6pm. 3rd Sun. Volunteers arrive at 3pm. Free hot meal served. VFW Post 5700, 140 Dutch Neck Rd, Hightstown. Information: Adrenne 609-336-7260.

mondayDiscover the Serenity of T’ai Chih – 11am. Dis-cover the Serenity of T’ai Chi Chih (Joy thru Move-ment Class). Need better balance, concerned about high blood pressure, quality sleep a challenge? Join class at Monroe Twp Senior Ctr, Monroe. For more information, additional locations, & to learn how to save on class fee, contact Siobhan at 609-752-1048.

Rise to the Task Free Dinner – 4-5:30pm. Free community dinner. First Presbyterian Church of Hightstown, 320 N Main St, Hightstown. For more info contact Rise office at 609-443-4464.

Interval Circuit Training – 6-7pm. Join group for workout led by Jesse for both members and non-members. Cost $10. Retro Fitness of Bordentown, 860 Rte 206, Bordentown. 609-372-4020.

Breast Cancer Support Group – 6-7:30pm. 3rd Tues. No registration required walk-ins welcome. UMCP Breast Health Center, 300B Princeton-Hightstown Rd, East Windsor Medical Commons 2, East Windsor.

Discover the Serenity of T’ai Chih – 6:30pm. Discover the Serenity of T’ai Chi Chih (Joy thru Movement Class). Need better balance, concerned about high blood pressure, quality sleep a challenge? Join class at VFW, 77 Christine Ave, Hamilton. For more information, additional locations, & to learn how to save on class fee, contact Siobhan at 609-752-1048.

tuesdayBoot Camp With Devon – 6-7pm. Join group for workout led by Devon for both members and non-members. Cost $10. Retro Fitness of Bordentown, 860 Rte 206, Bordentown. 609-372-4020.

Discover the Serenity of T’ai Chih – 6:30pm. Discover the Serenity of T’ai Chi Chih (Joy thru Movement Class). Need better balance, concerned about high blood pressure, quality sleep a challenge? Join class at American Legion, 2 Meadowbrook Ln, New Egypt. For more information, additional loca-tions & to learn how to save on class fee, contact Siobhan at 609-752-1048.

wednesdayDiscover the Serenity of T’ai Chih – 8:45am. Discover the Serenity of T’ai Chi Chih (Joy thru Movement Class). Need better balance, concerned about high blood pressure, quality sleep a challenge? Join class at Energy for Healing, 4446 Main St, Kingston. For more information, additional loca-tions, & to learn how to save on class fee, contact Siobhan at 609-752-1048.

Bright Beginnings – 10:30-11:30am. This infor-mative, relaxed group is for parents and caregivers of infants. Each week focuses on a different topic of interest to new parents, and guest speakers are occasionally featured. Infants and children under 4 years of age are welcome to attend with the parent or caregiver. $5 payable at door. Princeton Fitness & Wellness Center, Princeton North Shopping Center, 1225 State Rd, Princeton. 609-683-7888.

Discover the Serenity of T’ai Chih – Evenings. Discover the Serenity of T’ai Chi Chih (Joy thru Movement Class). Need better balance, concerned about high blood pressure, quality sleep a challenge? Join class locations in Bordentown area. For more information, additional locations, & to learn how to save on class fee, contact Siobhan at 609-752-1048.

thursday4 Mom’s Networking Hour – 1-2pm. Weekly parenting topics with RWJ Hamilton experts and sharing with other moms. RWJ Hamilton Center for Health & Wellness, 1 Hamilton Health Place, Hamilton. 609-584-5900.

CPAP Workshop – 6pm. 3rd Thurs. Free workshop provided by the Sleep Care Center for patients with sleep disorders. A respiratory therapist will provide CPAP education, adjust CPAP pressures, refit masks and discuss the importance of CPAP/BiPAP usage. RWJ Hamilton Center for Health & Wellness, 1 Hamilton Health Place, Hamilton. 609-584-6681.

Interval Circuit Training – 7-8pm. Join group for workout led by Jesse for both members and non-members. Cost $10. Retro Fitness of Bordentown, 860 Rte 206, Bordentown. 609-372-4020.

fridayInterval Circuit Training – 7-8am. Join group for workout led by Jesse for both members and non-members. Cost $10. Retro Fitness of Bordentown, 860 Rte 206, Bordentown. 609-372-4020.

Breastfeeding Support Group – 11am-12pm. Expectant parents will learn about the benefits of breastfeeding, getting started, positioning, nutri-tion, pumping and avoiding common problems. Facilitated by Lactation Consultant. Free. PHC Community Education & Outreach Program, 731 Alexander Rd, Ste 3, Princeton. 888-897-8979.

Men in Retirement – 2pm. 1st Friday. This social group for men meets and have regularly scheduled small group activities. Come and meet other men who are making or have made the transition into retirement. Suzanne Patterson Bldg, Princeton Senior Resource Center, 45 Stockton St, Princeton. 609-924-7108.

saturdayInterval Circuit Training – 8:30-9:30am. Join group for workout led by Jesse for both members and non-members. Cost $10. Retro Fitness of Bor-dentown, 860 Rte 206, Bordentown. 609-372-4020.

Discover the Serenity of T’ai Chih – 9 and 11am. Discover the Serenity of T’ai Chi Chih (Joy thru Movement Class). Need better balance, concerned about high blood pressure, quality sleep a challenge? Join class at 9 in Newton or 11 in Langhorne, PA. For more information, additional locations & to learn how to save on class fee, contact Siobhan at 609-752-1048.

WWFM Farmers’ Market – 9am-1pm. West Windsor Community Farmers’ Market. 15 farms and 11 artisan food and natural product vendors. Princeton Junction Train Station, Vaughn Drive Parking Lot (Alexander Rd & Vaughn Dr), Princeton Junction. 609-933-4452.

NOTE: All calendar events must be received via email by the 10th of the month and adhere to our guidelines. Email [email protected].


HOLISTIC DENTISTS

PRINCETON CENTER FOR DENTAL AESTHETICSDr. Ruxandra Balescu, DMD Dr. Kirk Huckel, DMD, FAGD 11 Chambers St, Princeton 609-924-1414 PrincetonDentist.com

We offer a unique approach to the health care of the mouth based on a holistic understanding of the whole body. Please contact us to learn how we can serve your needs. See ad, page 7.

HYPNOSIS

PRISM HYPNOSISDr. Ira Weiner 609-235-9030 PrismHypnosis.com

Do you smoke, feel stressed or in pain, crack under pressure, or want to break unhealthy habits? Contact us and visit our website for healthful solutions that work. See ad, page 23.

NATURAL SERVICES

BLACK FOREST ACRESTrudy Ringwald Country Herbalist & Certified Reboundologist 553 Rte 130 N, East Windsor 1100 Rte 33, Hamilton 609-448-4885/609-586-6187 BlackForestAcres.Net

Two locations for the natural connection to live well and eat right. Natural and organic foods, vitamins, supplements, groceries and mos t impor t an t , f r ee consultation.

NUTRITION

NUTRITIONAL CONSULTANTClaire Gutierrez 194 N Harrison St, Princeton 609-799-3089 [email protected] VisanoConsulting.com

Let me help analyze your current diet thru nutritional assessment and assist you in making necessary adjustments and modifications to eventually achieve optimal health.

ACUPUNCTURE

AWARE ACUPUNCTUREDiane L. Ailey, L.Ac. Dipl.Ac. 114 Straube Center Blvd, Ste K6-7 Pennington • 609-737-0970 [email protected]

If you suffer from pain, digestive problems, arthritis, autoimmune disease, asthma, allergies, headaches/migraines, Bell’s palsy, fatigue, stress, anxiety, menstrual/menopausal symptoms and disorders, learn how we can help in healing mind, body and spirit. See ad, page 11.

ALTERNATIVE MEDICINE

DOROTA M. GRIBBIN, M.D.181 N Harrison St, Princeton 2333 Whitehorse-Mercerville Rd, Mercerville 609-588-0540 DMGribbInMD.com

Get the most out of your years naturally and without surgery. Specializing on natural pain relief and body regeneration, with exceptional patient care. See ad, page 43.

BODYWORK

REIKI MASTERMrs. Donna Tomaszewski Hamilton/West Windsor Area 609-586-5409 by appointment ReikiPlace.org

Discover the gentle positive energy that is Reiki to effectively relieve stress while experiencing profound feelings of relaxation, peace and well-being. One-hour session: $75.

SIOBHAN HUTCHINSON, MAHolistic Health Practitioner 609-752-1048 NextStepStrategiesllc.com [email protected]

Enhance balance of Body/Mind/Spirit through T’ai Chi Chih, Seijaku, Qigong, Reiki and Donna Eden Energy. Clients can choose classes or personalized one-on-one sessions for deep relaxation and reducing the effects of stress. See ad, page 29.

COLON THERAPY

A WELLNESS WITHIN3692 Nottingham Way, Hamilton 609-587-8919 WellnessWithinNJ.com

Are you wondering what is colon hydrotherapy? Will it work for me? Contac t us for the answers and to reduce gas and bloating, relieve

constipation and promote regularity. Ask about our detox or weight loss programs. See ad, page 27.

EDUCATION/SCHOOLS

WALDORF SCHOOL OF PRINCETON1062 Cherry Hill Rd, Princeton 609-466-1970 x115 PrincetonWaldorf.org

Waldorf Schoolof Princeton

The Waldorf curriculum, used in 1,000+ schools worldwide, integrates arts, academics, movement, and music, emphasizing social and environmental responsi-

bility. The hands-on approach is screen free.

GREEN LIVING

SUN 101 SOLARDaniel Hicks 609-460-4637 [email protected] Sun101Solar.com

We are more than just a solar installer. We see ourselves as educators and stewards of the environment. We always do our best to educate about the benefits of going solar and being energy efficient. See ad, page 17.

WE DO IT ALL Home Improvements/Repairs 609-851-1753 [email protected]

We do it all while always offering green options. Repair, install, replace: doors, all types tiles, hardwood, carpeting, molding, pavers and decks. Powerwashing, painting, water proofing and finish basements, kitchen and bath remodeling. No job too big or small.

Connecting you to the leaders in natural healthcare and green living in our community. To be included, email [email protected] or call 609-249-9044 to request our media kit.

communityresourceguide


ORGANIC FARMS

CHERRY GROVE FARM3200 Lawrenceville Rd, Lawrenceville 609-219-0053 CherryGroveFarm.com

Organic and natural products including farmstead cheeses; Buttercup Brie, seasonal Jacks, Rosedale, Herdsman, Toma, Havilah and Cheddar Curds. Additional products include whey-fed pork,

grass-fed lamb and beef, pasture-raised eggs and myriad locally sourced goods. See ad, page 27.

REGENERATIVE MEDICINE

EDWARD MAGAZINER, M.D.2186 Rte 27, Ste 2D, North Brunswick 877-817-3273 DrEMagaziner.com

Dr. Magaziner has dedicated his career to helping people with pain and musculoskeletal injuries using state-of-the-art and innovative pain management treatments including Platelet Rich Plasma, S t e m C e l l T h e r a p y a n d Prolotherapy to alleviate these problems. See ad, page 2.

JOIN US ON:

facebook.com/NaturalAwakenkingsMercerCounty

twitter.com/@NaturalMercer

If You Learn fromNatural Awakenings,Share the Knowledge

[email protected]

• Birmingham, AL• Huntsville, AL• Mobile/Baldwin, AL*• Little Rock/Hot Spg., AR*• Phoenix, AZ• Tucson, AZ• East Bay Area, CA• San Diego, CA• Denver/Boulder, CO• Fairfi eld County, CT• Hartford, CT• New Haven/

Middlesex, CT• Washington, DC• Daytona/Volusia/

Flagler, FL• NW FL Emerald Coast• Ft. Lauderdale, FL• Jacksonville/St. Aug., FL• Melbourne/Vero, FL• Miami & Florida Keys*• Naples/Ft. Myers, FL• North Central FL*• Orlando, FL*• Palm Beach, FL• Peace River, FL• Sarasota, FL• Tampa/St. Pete., FL• FL’s Treasure Coast• Atlanta, GA• Chicago, IL• Indianapolis, IN

• Baton Rouge, LA• Lafayette, LA• New Orleans, LA*• Boston, MA• Portland, ME• Ann Arbor, MI• East Michigan• Wayne County, MI• Western MI• Minneapolis/St. Paul, MN• Asheville, NC*• Charlotte, NC• Lake Norman, NC• Triangle NC• Central NJ• Hudson County, NJ*• Mercer County, NJ• Monmouth/Ocean, NJ• North NJ*• North Central NJ• South NJ*• Santa Fe/Abq., NM• Las Vegas, NV• Albany, NY• Central NY• Long Island, NY• Manhattan, NY• Queens, NY• Rochester, NY• Rockland/Orange, NY• Syracuse, NY• Westchester/

Putnam Co’s., NY

• Central OH• Cincinnati, OH• Toledo, OH• Oklahoma City, OK• Portland, OR• Bucks/Montgomery

Counties, PA• Harrisburg/York, PA• Lancaster, PA• Lehigh Valley, PA• Pocono, PA/

Warren Co., NJ• Rhode Island• Charleston, SC• Columbia, SC• Grand Strand, SC*• Greenville, SC• Chattanooga, TN• Knoxville, TN*• Memphis, TN• Austin, TX• Dallas Metroplex, TX• Dallas/FW Metro N• Houston, TX*• San Antonio, TX• Richmond, VA• VA’s Blue Ridge • Seattle, WA• Madison, WI• Milwaukee, WI• Puerto Rico

*Existing magazines for sale

Natural Awakenings publishes in over 90 markets across the U.S. and Puerto RicoTURN YOUR PASSION

INTO A BUSINESS...

• Low Investment• Work from Home• Great Support Team• Marketing Tools• Meaningful New

Career

own aNatural Awakenings

magazine in your community!

For more information visit our website NaturalAwakeningsMag.com/mymagazine

or call 239-530-1377


A NEW DAYA NEW APP

Enjoy Natural Awakenings on the GO!Your healthy living, healthy planet lifestyle app for the iPhone and iPad.

Search iTunes app store for “Natural Awakenings” and download our FREE app!

• NATIONAL DIRECTORYfind healthy/green businesses with directions

• THIS MONTHall new content

• HEALTHY KIDS

• NATURAL PETS• ARTICLE ARCHIVES

search thousands of topics by keyword

• EN ESPAÑOLbuscar articulos en Español

“Pain is a symptom,” says Dorota

M. Gribbin, M.D., Assistant Clinical Professor at Columbia University – College of Physicians and Surgeons, Chairman of

Physical Medicine and Rehabilitation section at Robert Wood Johnson University Hospital at Hamilton and Medical Director of Com-prehensive Pain and Regenerative Center. “In order to manage pain effectively, it is essential to pinpoint its cause.” She is named one of the best doctors in the New York Metro Area by Castle Connolly Medical Ltd. for 14 consecu-tive years between 1999 and 2013.

REGENERATE rather than ReplaceRegenerate rather than replace your

joints, tendons, muscles, skin, and wounds with Regenerative Injection Therapy with Growth Factors in Platelets Rich Plasma (PRP) and Kinines in Platelets Poor Plasma (PPP). PRP therapy strengthens and heals arthritic and strained joints, tendons, ligaments, muscles, and skin — including non healing wounds and aging skin of your face. PRP injections can be performed all over the body. It is a natural regenerative method of treat-ment of sports injuries, arthritic joints, lower back pain, disc disease, tennis elbow, carpal tunnel syndrome, ACL and meniscal tears, shin splints, rotator cuff tears, plantar fasciitis, iliotibial band syndrome, piriformis syndrome, tennis/golfer’s elbow, sprained/torn muscles, and aging skin.

How does PRP Therapy work?To prepare PRP, a small amount of blood

is taken from the patient. The blood is then placed in a centrifuge. The centrifuge spins and automatically produces the PRP. The entire process takes less than 15 minutes and increases the concentration of platelets and growth factors up to 500 percent. When PRP is injected into the damaged area it stimulates

the tendon or ligament, causing mild inflam-mation that triggers the healing cascade. As a result new collagen begins to develop. As this collagen matures it begins to shrink caus-ing the tightening and strengthening of the tendons or ligaments of the damaged area. The initial consultation with the doctor will deter-mine if PRP/PPP therapy is right for you.

RADIOFREQUENCY: A Revolution-ary Modality in the Treatment of Painful Conditions and in Body Regeneration & Rejuvenation

Surgery should be the last resort. Most painful conditions are treated conservatively with a nonsurgical approach. In addition to medications, physical modalities (ultrasound, TENS, massage, exercise) and injection techniques RADIOFREQUENCY is a revolu-tionary technology which incapacitates the conduction of pain and also treats cellulite, tightens the subcutaneous tissue and erases scars and wrinkles.

Traditionally, therapeutic injections have involved injecting an anti-inflammatory agent, usually corticosteroids. Good news: not neces-sarily anymore! Radiofrequency ablation of the median branch sensory nerve “turns off” a small nerve which conducts pain. It is used for effective treatment of pain with long lasting results. The outcomes are amazing: years of pain relief, lowering or eliminating the need for pain medications.

Aesthetic MedicineHer aesthetic medicine treatment op-

tions include treatment for the reduction of cellulite, fatty tissue, and skin tightening of the face, neck, abdomen, buttocks, hips and thighs. This treatment is achieved through a non-surgical liposuction and body sculpting procedure using the same radio frequency energy, but different instruments as men-tioned previously.

See What People Are Raving AboutAge Defense:

Regenerating SerumRetinol Eye CreamMorning GlowMoisturizing Sun ScreenElite Sunscreen

Body Care:

ExfoliatorTone Zone

Complexion Care:Bright LightBright Light Lotion

Acne Care:Acne Tx CleanserAcne Tx Toner PadsAcne TX Night SpotsAcne TX Dew Cream

Advertorial

health&wellness

Non-Invasive Pain Treatment: No Surgery, No Cortisone

by Dorota M. Gribbin, MD

CARBON FIBER BODY. NO CARBON FOOTPRINT.From this point onward, the world will follow in your tread marks – the ones you’ll leave with up to 170HP and 0–60MPH in approximately 7 seconds.

For the Ultimate buying experience, it has to be Princeton BMW.

866-259-8720 | PrincetonBMW.com 3630 Quakerbridge Road | Hamilton, NJ 08619

natural awakenings mercer, nj september 2014

Documents

n g h e

t h y p

n e tfeel good

holiday themesfreeh

physical medicine rehab

greater mercer county

natural awakenings publishing

associate professor