ipc apex expo 2012 show directory
DESCRIPTION
• DESIGN • PRINTED BOARDS • ELECTRONICS ASSEMBLY • TEST with a new focus on printed electronicsTRANSCRIPT
• DESIGN • PRINTED BOARDS • ELECTRONICS ASSEMBLY • TEST
with a new focus on printed electronics
INFORMATION that INSPIRES INNOVATION
www.IPCAPEXEXPO.org
SHOW DIRECTORY
APEX 2012 Inside Cover Show Directory_revised size outlined.pdf 1 1/11/2012 8:42:50 AM
1
TAB
LE O
F C
ON
TEN
TS
Table of Contents
WelcomeWelcome and Acknowledgements . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2Convention Center Meeting Rooms Floor Plans . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4Show Schedule . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6
General InformationRegistration Hours . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 15Official Hotels . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 15Information You Should Know . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 15
Special EventsFREE Keynote Sessions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 16William Shatner Book Signing . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 16FREE International Reception . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 19FREE First-Timers’ Welcome Breakfast . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 19FREE Women in Electronics Networking Meeting . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 19FREE Show Floor Reception . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 19FREE Government Relations Committee Open Forum . . . . . . . . . . . . . . . . . . . . . . . . . . . 19Event Luncheons . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 19Meet & Eat . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 19On the Show Floor
New Product Zone . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 20 NPL Defect Database Clinic . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 20IPC Bookstore . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 20Connection Zone — Internet Kiosks and Phone Charging Stations . . . . . . . . . . . 20IPC APEX EXPO Hand Soldering Competition and IPC Grand Championship . . 20
Programs for Designers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22
Programs for Executives . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23
Technical ProgramsFREE BUZZ Sessions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24FREE Technical Posters . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27Technical Conference Sessions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 28Professional Development Courses . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 35IPC Standards Development Meetings . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 38
ExhibitorsNew Products Listing . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 45Index of Exhibitors by Product Category . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 49Exhibitors Listing . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 82Advertisers Index . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 130Exhibit Hall Floor Plans . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 132
Many thanks to our Exhibitor Sponsors:
Lanyards Conference Backpacks Mobile Guide
Attendee Bags
.
Phone Charging Station/Connection Zone Pens
Keep the conversations going …
✓ Meet & Eat — No dinner
plans? Don’t go solo. Sign
up to join your peers at
local restaurants …
see page 19
✓ Twitter — Get up-to-
the-minute show
announcements and tweet
away … see page 15
✓ My APEX EXPO — Reach
out privately to other
attendees and exhibitors
online … see page 19
✓ IPC Technet — Join the
social media outlet that’s
just about the technology
… see page 111
APEX 2012 Inside Cover Show Directory_revised size outlined.pdf 1 1/11/2012 8:42:50 AM
Welcome and Acknowledgements2
www.IPCAPEXEXPO.orgWE
LCO
ME
IPC Board of DirectorsChairman Robert (Bob) J. Ferguson, Avantor Performance Materials Vice Chairman Stephen (Steve) Pudles, Spectral Response LLCSecretary/Treasurer Don Schroeder, CTS CorporationImmediate Past Chairman Nilesh S. Naik, OneSource GroupInterim President & CEO C. James (Jim) Herring
DirectorsPeter Bigelow, IMI Inc. Robert (Bob) J. Black, Juki Automation Systems, Inc. Andy Hyatt, Creation Technologies Bhawnesh Mathur, EPIC Technologies Joseph (Joe) O’Neil, Hunter Technology Marc Peo, Heller Industries, Inc. Rex Rozario, OBE, Graphic Plc Dongkai Shangguan, Ph.D., Flextronics International Raymond (Ray) P. Sharpe, Isola S.a.r.l. Shane Whiteside, TTM Technologies Mikel Williams, DDi Corp. Mark A. Wolfe, Phoenix International Corp. Alan W. Wong, Aavid Thermalloy, LLC
With support from: •ChinaPrintedCircuitAssociation(CPCA)• EuropeanInstituteofPrintedCircuits(EIPC)•GroupementdesFournisseursdel’IndustrieElectronique(GFIE)•HongKongPrintedCircuitAssociation(HKPCA)• InternationalElectronicsManufacturingInitiative(iNEMI)• IndianPrintedCircuitAssociation• JapanElectronicsPackagingandCircuitsAssociation(JPCA)• JapanRoboticsAssociation(JARA)• JEDECSolidStateTechnologyAssociation• KoreaPrintedCircuitAssociation(KPCA)•MicroelectronicsPackagingandTestEngineeringCouncil(MEPTEC)•OE-A(OrganicandPrintedElectronicsAssociation)• SurfaceMountandCircuitBoardAssociation(SMCBA)• TaiwanExternalTradeDevelopmentCouncil(TAITRA)• TaiwanPrintedCircuitAssociation(TPCA)
IPC APEX EXPO is produced by IPC — Association Connecting Electronics Industries®
•ASSEMBLY•CircuitCellar• Circuitnet• CircuitsAssembly• CoatingInternational• ControlDesign• ElectronicsAssembly• ElectronicsIndustryUpdate• ElectronicsProtection• ElektorUS
• EMChina.org.cn• EMSNow• EMTWorldwide• EuroAsiaSemiconductor• FLEX007•GlobalPCBMarketplace•GlobalSMT&Packaging• Industrial&SpecialtyPrinting• IPCOutlook•MedicalDeviceNow.com
•MedicalProductsOutsourcing•MembraneSwitchNews•MetalFinishing•MoreRFID.com• PCB007• PCBCafé• PCBDESIGN007• +PlasticElectronics• PrintedCircuitDesign&FAB• PrintedCircuitJournal
• PrintedCircuitWorld• PrintElectronicNews• SMT Magazine •SMTnet.com• SurfaceMountWorld•U.S.Tech•WiringHarnessNews
In cooperation with:
3
INFO
RM
ATI
ON
that I
NSP
IRES
INN
OVA
TIO
N
IPC APEX Trade Show SubcommitteeChairman: Scott E. Wischoffer, Fuji America Corporation • JasonSpera,AegisIndustrialSoftwareCorporation•MarkOgden,ASMAssemblySystems•MikeKonrad,AqueousTechnologies• LeovandeVall,AssembléonAmerica• JimGriffin,BTUInternational• KarenMoore-Watts,DEKInternationalGmbH• JohnPerrotta,EuroplacerNorthAmerica•MarcPeo,HellerIndustries•DouglasDixon,HenkelCorporation• BrianDuffey,MYDATAautomation,Inc.•GregWood,NordsonASYMTEK•MarkRagard,PanasonicFactorySolutionsCompanyofAmerica•CarstenSalewski,ViscomIncorporated
IPC EXPO Trade Show SubcommitteeChairman: Fred Johnson, Schmid Systems Inc.•RickLies,ChemcutCorporation• JohnFix,TaiyoAmerica,Inc.• KurtPalmer,TapcoCircuitSupply,ADivisionofTapcoAssociates,Inc.•DonWalsh,UyemuraInternationalCorporation
Technical Program Committee •Conference Director: Greg Munie, Ph.D., IPC• JasbirBath,ChristopherAssociates/KokiSolder• BeverleyChristian,Ph.D,ResearchinMotionLimited•GaryM.Ferrari,FTGCircuits• PatriciaJ.Goldman,PJGoldmanConsulting•CarolA.Handwerker,Ph.D.Sc.D,PurdueUniversity•WayneJohnson,Ph.D.,AuburnUniversity• RussellH.Nowland,Alcatel-Lucent•AlanRae,Ph.D.,NanomaterialInnovationCenter
Check out the Newest Addition to IPC APEX EXPO — PRINTED ELECTRONICS! PrintedElectronics
On the Show Floor Booth No.CarmelChemicals/TanakaHoldingsCo.. . . . . . . . . . . . . 403Cemco Ltd. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 841Coatema Coating Machinery GmbH . . . . . . . . . . . . . . . 418Conductive Compounds Inc. . . . . . . . . . . . . . . . . . . . 421DEKInternational . . . . . . . . . . . . . . . . . . . . . . . 2600Diamond-MT,Inc. . . . . . . . . . . . . . . . . . . . . . . . . 413DuPont Electronic Technologies . . . . . . . . . . . . . . . . 2313FLEXCon . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 420Henkel Electronic Materials LLC. . . . . . . . . . . . . . . . 2711Heraeus Materials Technology . . . . . . . . . . . . . . . . 3444KurokiIndustrialCo.,Ltd. . . . . . . . . . . . . . . . . . . . . 936Metal Etch Services . . . . . . . . . . . . . . . . . . . . . . . 400Ormet Circuits, Inc.. . . . . . . . . . . . . . . . . . . . . . . . 711Sanmina-SCI . . . . . . . . . . . . . . . . . . . . . . . . . . . 629Speedline Technologies, Inc. . . . . . . . . . . . . . . . . . 3248Taiyo America, Inc.. . . . . . . . . . . . . . . . . . . . . . . 2307Vistana . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 429XenonCorp. . . . . . . . . . . . . . . . . . . . . . . . . . . . 419
Technical Conference Sessions — see page 33(registrationisrequired)
S36 Printed ElectronicsS37 Advanced Materials for Printed ElectronicsS37 Emerging Technologies and Manufacturing
Processes for printed Electronics
Standards Development Meetings — see page 428-61 Printed Electronics Technology Roadmap
SubcommitteeD-61 Printed Electronics Design SubcommitteeD-62 Printed Electronics Base Material/Substrates
SubcommitteeD-63 Printed Electronics Functional Materials
SubcommitteeD-64 Printed Electronics Final Assembly Subcommittee
From the IPC ChairmanWelcome to San Diego and IPC APEX EXPO 2012! Our newhostcitysetsafresh,idyllicbackdroptoaweekfilledwith our industry’s premier technical programs, courses, standards development meetings and our industry’s largest exhibition in North America — all with information to help inspire new ideas, creative problem solving and the next generation of innovations — and all with countless opportunities to build your network of professional colleagues and pursue the interests of your company.
Tokick-offyourshowexperience,joinyourcolleaguesforanintimateandentertaining visit with William Shatner, our opening keynoter on Tuesday morning, to learn what inspires him to keep boldly going where no man has gone before.
During your time here, don’t miss these free show highlights:
•Wednesday’skeynoteonthefutureindustrygamechangers(seepage16)
•IPCAPEXEXPO’sfirsthandsolderingcompetitionandIPC’sGrandChampionship(seepage20)
•NPLDefectDatabaseClinicandminiseminarsinbooth217(seepage20)
•FreeBUZZSessionsonindustryhottopics(seepage24)
Thisyear’sexhibitionisfilledwithinnovationandhundredsofnewproducts,and includes a new area on printed electronics. Take your time as you visit with exhibitorsandmakesureyoudon’tleaveuntilallyourquestionshavebeenanswered.
Learning, interchange and innovation are critical in our dynamic industry. I trust thatthetimeyouspendatIPCAPEXEXPOwillinspireyouwithanewgenerationof ideas, innovations and success.
Sincerely,
Robert J. Ferguson ExecutiveVicePresident,ElectronicMaterials&NorthAsia Avantor Performance Materials
Meeting Rooms Floor Plans
ACCESS THROUGH
UPPER LEVEL
ACCESS THROUGH
UPPER LEVEL
TO UPPER LEVELMW
MW
TO MEZZANINE LEVEL
Sails Pavilion
T O E X H I B I T H A L L
RESTAURANT INFORMATION CENTER
MAIN ENTRANCEMAIN ENTRANCE
FIRST AID
REGISTRATION
Mezzanine Level
The floor plans for the exhibit halls are on the back pages of this Directory.
Upper Level
San Diego Convention Center
Ground Level
Booths400-999locatedintheSailsPavilion(UpperLevel)•Booths1000+locatedinHallsA–C(GroundLevel)
6SH
OW
SCH
ED
ULE
www.IPCAPEXEXPO.org
All meetings will take place in the San Diego Convention Center.
PD=EducationalCourse•S=ConferenceSession•BZ=BUZZSession
Event Code Time Chairman/Moderator Room Page
Sunday, February 26Event Registration 7:00am–6:00pm Hall AB
Lobby
TermsandDefinitionsCommittee 2-30 8:00am–9:00am Michael Green, Lockheed Martin Space Systems
15A 43
Jisso North America Council (JNAC) 8-51 8:00am–3:00pm Dennis Fritz, MacDermid, Inc. 11B 43
SynergyMeeting—J-STD-001&IPC-A-610TaskGroups 5-22a/ 7-31b
8:00am–3:00pm JenniferDay,CIT,U.S.ArmyAviation&MissileCommand; Constantino Gonzalez, MIT, ACME Training&Consulting;TeresaRowe,CIT,AAICorporation
14B 38
CID Exam 8:30am–3:00pm KateMaureenMayer,CID+ 12 22
CID+Exam 8:30am–3:00pm GaryFerrari,CID+,CIT,FTGCircuits 13 22
Basics of PCB Design PD21 9:00am–12:00pm SusyWebb,CID,FairfieldNodal 5B 35
Best Practices in Electronics Assembly Processes — Part I PD13 9:00am–12:00pm Joseph Belmonte, W. James Hall and Phil Zarrow,ITMConsultingInc.
2 35
BuildingLong-TermReliabilityinPCBs:Materials,PlatingProcessesandInnerlayerTreatmentsforLead-FreeAssemblyRequirements
PD01 9:00am–12:00pm Michael Carano, OMG Electronic Chemicals, LLC
1A 35
Chip Packaging — Materials, Quality and Reliability PD03 9:00am–12:00pm Syed Sajid Ahmad, North Dakota State University
10 35
Cleaning Guidelines for Boards and Assemblies: Developing a SuccessfulProcesswiththeNEWIPC-CH-65B
PD04 9:00am–12:00pm MikeBixenman,DBA,KyzenCorporation 3 35
ConformalCoatings:Types,UsesandSpecifications PD25 9:00am–12:00pm Douglas Pauls, Rockwell Collins 8 35
Counterfeit Components — Causes, Cures and Solutions PD09 9:00am–12:00pm BobWillis,ASKbobwillis.com 7A 35
DesignforFlexibleandRigid-FlexCircuits—PartI PD50 9:00am–12:00pm VernSolberg,SolbergTechnicalConsulting 1B 35
Design for Manufacturing — DFM PD08 9:00am–12:00pm Cheryl Tulkoff, CRE, DfR Solutions 7B 35
PCBFabricationBasics:ProcessandSpecification—PartI PD07 9:00am–12:00pm DonSchmiederIII,andJimVandenHogen,Plexus Corporation
4 35
SignalIntegrityProblemPrevention:High-SpeedRouting&Termination
PD14 9:00am–12:00pm RichardHartley,CID,L-3AvionicsSystemsInc. 11A 35
SMTProcessFundamentalsforTin-LeadandLead-FreeAssembly PD31 9:00am–12:00pm S. Manian Ramkumar, Ph.D., Rochester Institute of Technology
5A 35
JointMeeting—IPC-A-600andRigidPrintedBoardPerformanceSpecificationsTaskGroups
7-31a/ D-33a
9:00am–4:30pm Mark Buechner, BAE Systems 15A 43
Low-HalogenGuidelineTaskGroup 4-33a 10:00am–6:00pm Mark Frimann, Texas Instruments Inc.; John Sharp, TriQuint Semiconductor Inc.
15B 40
IPCAPEXEXPOGolfTournament&Reception 10:00am–9:00pm
Advanced Component Packages and Processes PD40 2:00pm–5:00pm S. Manian Ramkumar, Ph.D., Rochester Institute of Technology
5A 35
Best Practices in Electronics Assembly Processes — Part II PD17 2:00pm–5:00pm Joseph Belmonte, W. James Hall and Phil Zarrow,ITMConsultingInc.
2 35
Controlling Moisture Content in Boards: Best Practices PD19 2:00pm–5:00pm BhanuSood,Ph.D.,UniversityofMaryland 10 35
DesignforFlexibleandRigid-FlexCircuits—PartII PD35 2:00pm–5:00pm VernSolberg,SolbergTechnicalConsulting 1B 35
Design of Experiment for SMT Processes PD18 2:00pm–5:00pm Rita Mohanty, Ph.D., Speedline Technologies, Inc.
8 35
Designing Complex Boards PD43 2:00pm–5:00pm SusyWebb,CID,FairfieldNodal 5B 35
FinalFinishes—CompatibilitywithLead-FreeAssembly PD10 2:00pm–5:00pm Michael Carano, OMG Electronic Chemicals, LLC
1A 35
LGA,QFN,BMCAssembly&Rework PD52 2:00pm–5:00pm BobWillis,ASKbobwillis.com 7A 35
MasteringLead-FreeandTin-LeadSelectiveSoldering PD16 2:00pm–5:00pm BobKlenke,ITMConsultingInc. 7B 35
PCBFabricationBasics:ProcessandSpecification—PartII PD02 2:00pm–5:00pm DonSchmiederIII,andJimVandenHogen,Plexus Corporation
4 35
Show Schedule
7
INFO
RM
ATI
ON
that I
NSP
IRES
INN
OVA
TIO
N
Event Code Time Chairman/Moderator Room Page
Accesstheshowscheduleandexhibitorinformationonyourmobiledeviceatwww.IPCAPEXEXPO.org/morscan
Physics of Failure PD22 2:00pm–5:00pm MichaelOsterman,Ph.D.,UniversityofMaryland
11A 35
Tin Whiskers: Origin, Propensity, Mitigation PD42 2:00pm–5:00pm David Pinsky, Raytheon Company 3 35
Troubleshooting Your Cleaning Process for High Reliability PD20 2:00pm–5:00pm UmutTosun,ZESTRONAmerica 9 35
Assembly&JoiningCommittee 5-20 3:00pm–4:30pm Leo Lambert, MIT, EPTAC Corporation 14B 38
Committee Chairman Council (By Invitation) CCC 4:30pm–6:00pm Peter Bigelow, IMI Inc. 14B 41
IPC Committee Chairmen’s Reception (By Invitation) 6:00pm–7:00pm West Terrace
Monday, February 27Event Registration 7:00am–6:00pm Hall AB
Lobby
ShowOffice 8:00am–5:00pm Sails Pavilion
PressOffice 8:00am–5:00pm 16A
Designers Forum 7:30am–1:30pm 6D 22
EMS Management Council Meeting 7:30am–5:00pm 6C-enterat 6F
23
PCB Executive Management Meeting 7:30am–5:00pm 6E-enterat 6F
23
Product Assurance Committee 7-30 8:00am–9:00am Mel Parrish, STI Electronics, Inc. 14B 42
J-STD-001HandbookTaskGroup 5-22f 8:00am–10:00am DanielFoster,CIT,U.S.ArmyAviation&MissileCommand
8 38
Printed Board Storage and Handling Subcommittee D-35 8:00am–10:00am ThomasKemp,CIT,RockwellCollins 7A 43
ComponentandWireSolderabilitySpecificationTaskGroup 5-23b 8:00am–12:00pm David Hillman, Rockwell Collins 11B 38
Laminate/PrepregMaterialsSubcommittee 3-11 8:00am–12:00pm Antonio Senese, Panasonic Electric Works 12 38
Supplier Declaration Subcommittee 2-18 8:00am–12:00pm KristaCrotty,AlberiEcoTech;JørgenVos 15A 39
Introduction to the EMS Industry and Program Management 8:00am–5:00pm SusanMucha,Powell-MuchaConsulting 13 23
Potting and Encapsulation Task Group 5-33f 8:00am–5:00pm Barry Ritchie, Dow Corning Corporation 14A 39
Ball Grid Array (BGA): Principles and Practice PD30 9:00am–12:00pm Ray Prasad, Ray Prasad Consultancy Group 3 36
ConformalCoatingApplications,Inspection,Rework&QualityControl
PD33 9:00am–12:00pm BobWillis,ASKbobwillis.com 9 36
DFMforManufacturing:WhenaSixSigmaProcessIsNotSufficienttoAchieveaHigh-YieldManufacturingProcess
PD29 9:00am–12:00pm Dale Lee, Plexus Corp. 5B 36
Failure Analysis: Lessons Learned PD23 9:00am–12:00pm MartinAnselm,UniversalInstrumentsCorporation
1A 36
Lead-FreefortheExemptee:SurvivinginaLead-FreeWorld PD46 9:00am–12:00pm Joseph Belmonte, W. James Hall, and Phil Zarrow,ITMConsultingInc
2 36
OptimizingX-RayInspection:Equipment,ProcessesandProcedures PD27 9:00am–12:00pm BobKlenke,ITMConsultingInc. 10 36
PoP and BTC Assembly — Material, Process and Reliability PD26 9:00am–12:00pm JennieHwang,Ph.D.,Sc.D.,H-TechnologiesGroup
1B 36
Testability Strategies: Optimizing the Mix PD49 9:00am–12:00pm LouisUngar,A.T.E.(AdvancedTestEngineering) 11A 36
TroubleshootingSMT:PartI—DefiningtheProblem,Determiningthe Cause
PD05 9:00am–12:00pm S. Manian Ramkumar, Ph.D., Rochester Institute of Technology
5A 36
Wire Harness Acceptability Task Group 7-31f 9:00am–5:00pm T.JohnLaser,MIT,L-3Communications; BrettMiller,USAHarness,Inc.
14B 42
Marking,SymbolsandLabelsforIdentificationofAssemblies,Components and Devices Task Group
4-34b 10:00am–12:00pm Jasbir Bath, Christopher Associates Inc.; Jack McCullen, Intel Corporation; Lee Wilmot, TTM Technologies, Inc.
15B 40
Solder Stencil Task Group 5-21e 10:00am–12:00pm William Coleman, Ph.D., Photo Stencil Inc.; George Oxx Jr., Jabil Circuit, Inc. (HQ)
8 38
HighSpeed/HighFrequencyCommittee D-20 10:15am–12:00pm Edward Sandor, Taconic Advanced Dielectric Div.
7A 40
8SH
OW
SCH
ED
ULE
www.IPCAPEXEXPO.org
Event Code Time Chairman/Moderator Room Page
All meetings will take place in the San Diego Convention Center.
PD=EducationalCourse•S=ConferenceSession•BZ=BUZZSession
Printed Board Process Capability, Quality and Relative Reliability Benchmark Test Subcommittee
D-36 10:15am–12:00pm Gary Long, Intel Corporation 7B 43
Event Awards Luncheon 12:00pm–1:30pm 6A 19
SMTComponentPlacementEquipmentSubcommittee 5-41 1:30pm–3:00pm Michael Cieslinski, Panasonic Factory Solutions Company of America
8 38
Test Coupon and Artwork Generation Task Group 1-10c 1:30pm–3:00pm Timothy Estes, Conductor Analysis Technologies 7B 42
Woven Glass Reinforcement Task Group 3-12d 1:30pm–3:00pm Patricia Goldman, P. J. Goldman Consulting 12 39
Electronic Documentation Technology Committee 2-40 1:30pm–3:15pm KarenMcConnell,CID,NorthropGrummanCorp. 15A 39
IPC Printed Electronics Management Council Steering Committee (By Invitation)
1:30pm–5:00pm DonBanfield,ConductiveCompounds 18 41
Materials Declaration Task Group 2-18b 1:30pm–5:00pm Mark Frimann, Texas Instruments Inc.; AidanTurnbull,Ph.D.,EnvironUKLtd.
15B 39
PrintedCircuitBoardSolderabilitySpecificationsTaskGroup 5-23a 1:30pm–5:00pm GerardO’Brien,SolderabilityTesting&Solutions
11B 38
SIR and Electrochemical Migration Task Group 5-32b 1:30pm–5:00pm Chris Mahanna, Robisan Laboratory Inc. 7A 39
Control of EMI Coupling Mechanisms PD36 2:00pm–5:00pm RichardHartley,CID,L-3AvionicsSystemsInc. 2 36
Design and Assembly Challenges of Ball Grid Arrays (BGAs) and Bottom Termination Components
PD39 2:00pm–5:00pm Ray Prasad, Ray Prasad Consultancy Group 3 36
Designing PCB Stackups to Balance Signal Integrity Against Manufacturability
PD41 2:00pm–5:00pm Lee Ritchey, Speeding Edge 10 36
Designing with Flex in Mind: Next Generation PD11 2:00pm–5:00pm Mark Finstad, CID, Flexible Circuit Technologies; Jamin Taylor, CID, Minco Products, Inc.
1A 36
DFX:ProjectSetuptoMeasurementDefinitionandAdvancedAnalysis
PD38 2:00pm–5:00pm Dale Lee, Plexus Corp. 5B 36
HDI: Introduction to Processes and Products PD34 2:00pm–5:00pm ChristopherRyder,AT&SAustriaTechnologie&Systemtechnik AG
11A 36
Lead-FreeAssemblyforHighYieldsandReliability PD37 2:00pm–5:00pm Ronald Lasky, Ph.D., PE, Indium Corporation of America
4 36
Package on Package (PoP), Design Assembly, Rework and Inspection PD44 2:00pm–5:00pm BobWillis,ASKbobwillis.com 9 36
Preventing Production Defects and Failures PD15 2:00pm–5:00pm JennieHwang,Ph.D.,Sc.D.,H-TechnologiesGroup
1B 36
Troubleshooting SMT: Part II — Finding the Fix and Preventive Action
PD06 2:00pm–5:00pm S. Manian Ramkumar, Ph.D., Rochester Institute of Technology
5A 36
Base Materials Roundtable Task Group 3-12e 3:15pm–5:00pm EdwardKelley,IsolaGroupSARL 12 39
ProductDataDescription(LaminarView)Subcommittee 2-16 3:15pm–5:00pm KarenMcConnell,CID,NorthropGrummanCorp. 15A 39
Technical Activities Executive Committee (By Invitation) TAEC 5:00pm–6:30pm Mel Parrish, STI Electronics, Inc. 14B 41
FREE! International Reception 5:30pm–6:30pm West Terrace
19
Tuesday, February 28Event Registration 7:00am–6:00pm Hall AB
Lobby
ShowOffice 8:00am–6:00pm Sails Pavilion
PressOffice 8:00am–5:00pm 16A
Speaker Ready Room 7:30am–5:00pm 1A
Exhibits Open — Halls A, B & C and Sails Pavilion 10:00am–6:00pm
FREE! First-Timers’WelcomeBreakfast 7:30am–8:30am 4 19
Introduction to the EMS Industry and Program Management 8:00am–1:00pm SusanMucha,Powell-MuchaConsulting 13 23
Joint Meeting — Plastic Chip Carrier Cracking Task Group and JEDECJC-14.1
B-10a/JEDEC
8:00am–5:00pm Steven Martell, Sonoscan Inc. 11B 41
FREE! TechnicalPostersViewing 8:00am–5:00pm 6A 27
FREE!OpeningKeynote:BoldlyGoingWhereNoManHasGoneBefore
8:30am–9:30am William Shatner 6A 16
Ribbon Cutting Ceremony 9:45am–10:00am Sails Pavilion Entrance
9
INFO
RM
ATI
ON
that I
NSP
IRES
INN
OVA
TIO
N
Event Code Time Chairman/Moderator Room Page
Accesstheshowscheduleandexhibitorinformationonyourmobiledeviceatwww.IPCAPEXEXPO.org/morscan
William Shatner Book Signing 10:00am Sails Pavilion
16
IPC PCB Management Council Steering Committee (By Invitation) V9-20 10:00am–11:30am Peter Bigelow, IMI Inc. 14A
Assembly and Joining Handbook Subcommittee 7-35 10:00am–12:00pm MaryMuller,CraneAerospace&Electronics 11A 38
Ball Grid Array Task Group 5-21f 10:00am–12:00pm Ray Prasad, Ray Prasad Consultancy Group 15B 38
Cleaning and Alternatives Subcommittee 5-31 10:00am–12:00pm MikeBixenmanDBA,KyzenCorporation 15A 39
CRANE-EC CRANE-EC
10:00am–12:00pm Jason Ferguson, NSWC Crane 7A 40
Laboratory Report Declaration Task Group 2-18j 10:00am–12:00pm William Haas, Seagate Technology 7B 40
Metallic Foil Task Group 3-12a 10:00am–12:00pm Rolland Savage, High Performance Copper Foil Inc.
9 39
Plated-ThroughViaReliability-AcceleratedTestMethodsTaskGroup 6-10c 10:00am–12:00pm RandyReed,ViasystemsGroup,Inc. 5B 43
Solder Alloy Task Group 5-24c 10:00am–12:00pm JennieHwang,Ph.D.,Sc.D.,H-TechnologiesGroup
10 38
TDR Test Methods Task Group D-24a 10:00am–12:00pm Don DeGroot, CCNi 5A 41
Wire Harness Acceptability Task Group 7-31f 10:00am–5:00pm T.JohnLaser,MIT,L-3Communications; BrettMiller,USAHarness,Inc.
14B 42
FREE! IPC Government Relations Committee Open Forum 11:00am–12:00pm Mikel Williams, DDi Corp. 8 43
EventLuncheon&IPCAnnualMeeting 12:00pm–1:30pm 6A 19
Conductive Anodic Filament (CAF) Task Group 5-32e 1:30pm–3:00pm KarlSauter,OracleAmerica,Inc. 9 39
Environmental Compliance S01 1:30pm–3:00pm Susan Landry, Albemarle Corporation 1B 28
FluxSpecificationsTaskGroup 5-24a 1:30pm–3:00pm Renee Michalkiewicz, MIT, Trace Laboratories -Baltimore
11A 38
PCB Design S05 1:30pm–3:00pm Patricia Goldman, P. J. Goldman Consulting 6C 29
Propagation Loss Test Method Task Group D-24b 1:30pm–3:00pm Richard Mellitz, Intel Corporation 5A 41
SMT Attachment Reliability Test Methods Task Group 6-10d 1:30pm–3:00pm Reza Ghaffarian, Ph.D., Jet Propulsion Laboratory
5B 43
Test I: In Circuit Test S03 1:30pm–3:00pm Lars-OlofWallin,IPCEuropeanOffice 2 28
Tin Whiskers S02 1:30pm–3:00pm James Carrigan, Premier Semiconductor Services
6D 28
FREE! Tin Whiskers, Delamination, Copper Dissolution, CAF, Coating Adhesion
BZ1 1:30pm–3:00pm Christopher Hunt, Ph.D., and Bob Willis, National Physical Laboratory
6F 24
VoidingI:ProcessandTest S04 1:30pm–3:00pm Jianbiao(John)Pan,CalPolyStateUniversity 3 28
Conformal Coating Handbook Task Group 5-33c 1:30pm–5:00pm Amy Hagnauer, Raytheon Company; JasonKeeping,Celestica
10 39
Embedded Devices Process Implementation Subcommittee D-55 1:30pm–5:00pm Richard Snogren, CID, Bristlecone LLC; VernSolberg,SolbergTechnicalConsulting
15A 40
Environment,Health&SafetySteeringCommittee 4-30 1:30pm–5:00pm Lee Wilmot, TTM Technologies, Inc. 7B 40
IPCSolderProductsValueCouncil SPVC 1:30pm–5:00pm 18
IPC-2221/2222TaskGroup D-31b 1:30pm–5:00pm GaryFerrari,CID+,CIT,FTGCircuits 7A 42
Printed Board Process Effects Handbook Subcommittee 7-24 1:30pm–5:00pm Dennis Fritz, MacDermid, Inc. 15B 42
IPC PCB New Technology Subcommittee Meeting (By Invitation) V9-40D 3:00pm–4:00pm KennethParent,Insulectro 14A
FREE!2012IPCInternationalTechnologyRoadmap BZ2 3:15pm–4:45pm John Fisher, Interconnect Technology Analysis, Inc.
6F 24
AOI Test S08 3:15pm–4:45pm KristaCrotty,AlberiEcoTech 2 29
PCB Materials S10 3:15pm–4:45pm Patricia Goldman, P. J. Goldman Consulting 6C 29
Printing I S06 3:15pm–4:45pm RussellNowland,Alcatel-Lucent 1B 29
Signal Integrity I S07 3:15pm–4:45pm Louis Hart, Ph.D., Compunetics Inc. 6D 29
VoidingII:ComponentEffects S09 3:15pm–4:45pm Jianbiao(John)Pan,CalPolyStateUniversity 3 29
HighFrequencyTestMethodsTaskGroup:Frequency-DomainMethods
D-24c 3:15pm–5:00pm Michael Janezic, Ph.D., NIST 5A 41
10SH
OW
SCH
ED
ULE
www.IPCAPEXEXPO.org
Event Code Time Chairman/Moderator Room Page
All meetings will take place in the San Diego Convention Center.
PD=EducationalCourse•S=ConferenceSession•BZ=BUZZSession
Test Methods Subcommittee 7-11 3:15pm–5:00pm Joseph Russeau, Precision Analytical Laboratory
5B 43
UL/CSATaskGroup 3-11f 3:15pm–5:00pm DouglasSober,KanekaTexasCorporation 9 38
IPC EMS Management Council Steering Committee (By Invitation) V9-10A 4:00pm–5:00pm Stephen Pudles, Spectral Response, LLC 14A
ExecutiveMarket&TechnologySteeringCommittee(ByInvitation) V-EMTSC 6:00pm–9:00pm Don Schroeder, CTS Corporation 14A 41
Meet&Eat 6:30pm
Wednesday, February 29Event Registration 7:00am–6:00pm Hall AB
Lobby
ShowOffice 9:00am–4:00pm Sails Pavilion
PressOffice 8:00am–5:00pm 16A
Speaker Ready Room 7:30am–5:00pm 1A
Exhibits Open — Halls A, B & C and Sails Pavilion 10:00am–6:00pm
SMEMA Statistical Subcommittee (By Invitation) 7:00am–8:00am KarenMoore-Watts,DEKUK 14A 41
FREE! Women in Electronics Networking Meeting 7:30am–8:30am Barbara Pauls, MidAmerica Taping and Reeling Inc.
4 19
FREE!Keynote:GazingintotheCrystalBall 8:00am–9:30am Phil Plonski, Prismark Partners; Cary Wood, Sparton; Mikel Williams, DDi Corp.; JanVardaman,TechSearchInternationalInc.and Bolaji Ojo, EBN
6A 16
Conformal Coating Task Group 5-33a 8:00am–10:00am John Waryold, HumiSeal Division of Chase Corp.
5A 39
Electrical Continuity Testing Task Group 7-32c 8:00am–10:00am Michael Hill, Colonial Circuits Inc. 11A 43
Flexible Circuits Test Methods Subcommittee D-15 8:00am–10:00am Rocky Hilburn, Insulectro; Duane Mahnke, DBMahnke Consulting
10 40
HighSpeed/HighFrequencyBoardPerformanceSubcommittee D-22 8:00am–10:00am MichaelLuke,CID+ 9 41
Assembly Process Effects Handbook Subcommittee 7-23 8:00am–12:00pm Greg Hurst, BAE Systems 15B 42
Declaration of Batteries and Battery Materials Task Group 2-18g 8:00am–12:00pm Aimee Siegler, Benchmark Electronics Inc.; KellySt.Andre,PTC
7B 40
Repair Training Technical Task Group 7-34t 8:00am–12:00pm Teresa Rowe, CIT, AAI Corporation 15A 43
FREE!TechnicalPostersViewing 8:00am–5:00pm 6A 27
IPC-A-630RequirementsforStructuralEnclosureTaskGroup 7-31j 8:00am–5:00pm Eddie Hofer, Rockwell Collins; Richard Rumas, CIT, Honeywell Canada
5B 42
SpaceElectronicAssembliesIPC/WHMA-A-620Addendum Task Group
7-31fs 8:00am–5:00pm Garry McGuire, CIT, NASA Marshall Space Flight Center
14B 42
BIST/BoundaryScan S13 9:00am–10:00am KristaCrotty,AlberiEcoTech 1B 30
Cleaning S14 9:00am–10:00am SalSparacino,ZESTRONAmerica 2 30
FREE! Embedded: Emerging Technologies BZ3 9:00am–10:00am MarkBeesley,AT&SAustriaTechnologie&Systemtechnik AG; VernSolberg,SolbergTechnicalConsulting
6F 24
Flux S12 9:00am–10:00am Michael Szuch, Nordson Asymtek 6C 29
PCB Testing S15 9:00am–10:00am Paul Reid, PWB Interconnect Solutions Inc. 3 30
Printed Electronics S36 9:00am–10:00am Daniel Gamota, Printovate Technologies, Inc. 6E 33
Solder Joint Morphology S11 9:00am–10:00am R.Johnson,Ph.D.,AuburnUniversity 6D 29
Advanced Materials for Printed Electronics S37 10:15am–11:45am Daniel Gamota, Printovate Technologies, Inc. 6E 33
FREE! Are Conflict Minerals the New RoHS? BZ4 10:15am–11:45am Fern Abrams, IPC 6F 24
iNEMIHalogen-Free S20 10:15am–11:45am LameckBanda,Ph.D.,DowChemicalUSA 3 30
Lead-FreeAlloys S16 10:15am–11:45am CarolHandwerker,Sc.D.,PurdueUniversity 6D 30
Packaging S18 10:15am–11:45am R.Johnson,Ph.D.,AuburnUniversity 1B 30
PCB Hole Fill S19 10:15am–11:45am Beverley Christian, Ph.D., Research In Motion Ltd.
2 30
Solder Assembly S17 10:15am–11:45am Alan Rae, Ph.D., Nanomaterial Innovation Center
6C 30
11
INFO
RM
ATI
ON
that I
NSP
IRES
INN
OVA
TIO
N
Event Code Time Chairman/Moderator Room Page
Accesstheshowscheduleandexhibitorinformationonyourmobiledeviceatwww.IPCAPEXEXPO.org/morscan
Conformal Coating Handbook Task Group 5-33c 10:15am–12:00pm Amy Hagnauer, Raytheon Company; JasonKeeping,Celestica
5A 39
FlexibleCircuitsSpecificationsSubcommittee D-12 10:15am–12:00pm NickKoop,CID,MincoProducts,Inc. 10 40
HighSpeed/HighFrequencyBaseMaterialsSubcommittee D-23 10:15am–12:00pm Edward Sandor, Taconic Advanced Dielectric Div.
9 41
Plating Processes Subcommittee 4-14 10:15am–12:00pm GeorgeMilad,UyemuraInternationalCorp.;GerardO’Brien,SolderabilityTesting&Solutions
14A 40
Solder Paste Task Group 5-24b 10:15am–12:00pm Brian Toleno, Ph.D., Henkel Corporation 8 38
Process Consumables Statistical Subcommittee (By Invitation) V9-40B 10:30am–12:00pm Michael Carano, OMG Electronic Chemicals, LLC
12 41
Event Awards Luncheon 12:00pm–1:30pm 6A 19
Surface Contamination S25A 1:30pm–2:30pm Greg Papandrew, Bare Board Group 3 31
Embedded Devices Test Methods Subcommittee D-54 1:30pm–3:00pm Jason Ferguson, NSWC Crane; Jan Obrzut, Ph.D., NIST
14A 40
EMS IP Subcommittee E-21 1:30pm–3:00pm Ben Lee, Cisco Systems Inc. 8 41
Flexible Circuits Design Subcommittee D-11 1:30pm–3:00pm William Ortloff Sr., Raytheon Company 10 40
IonChromatography/IonicConductivityTaskGroup 5-32a 1:30pm–3:00pm JohnRadman,TraceLaboratories-Denver 11A 39
Emerging Technologies and Manufacturing Processes for Printed Electronics
S38 1:30pm–3:30pm Steve Tomas, Flexcon Company 6E 33
Signal Integrity II: High Speed S24 1:30pm–3:30pm GaryFerrari,CID+,CIT,FTGCircuits 2 31
FREE!SolarStandardforElectronicsAssemblers—IPC-8701, The Next Generation of Standardization
BZ5 1:30pm–3:30pm Dongkai Shangguan, Ph.D. Flextronics International
6F 24
Solder Joint Testing and Performance S21 1:30pm–3:30pm Jasbir Bath, Christopher Associates Inc. 6D 31
Surface Insulation Resistance S22 1:30pm–3:30pm LameckBanda,Ph.D.,DowChemicalUSA 6C 31
TestProcessandSpecification S23 1:30pm–3:30pm LelandWoodall,KeihinCarolinaSystemTechnology
1B 31
A-620TechnicalTrainingTaskGroup 7-31ft 1:30pm–5:00pm Debbie Wade, MIT, Advanced Rework Technology-A.R.T
15A 42
Declaration of Shipping, Packing and Packaging Materials Task Group
2-18f 1:30pm–5:00pm John Ciba Jr., Brady Corporation; Lee Wilmot, TTM Technologies, Inc.
7B 39
Laminate Declaration Task Group 2-18c 1:30pm–5:00pm DouglasSober,KanekaTexasCorporation 15B 39
Microsection Subcommittee 7-12 1:30pm–5:00pm Russell Shepherd, MIT, Microtek Laboratories 9 43
UnderfillAdhesivesforFlipChipApplications 5-24f 1:30pm–5:00pm Brian Toleno, Ph.D., Henkel Corporation 7A 38
Coating S25B 2:30pm–3:30pm PhilKinner,PVA 3 31
Laminate Statistical Committee (Open meeting) V-LAM 3:00pm–4:00pm 5A 41
Bare Board Cleanliness Assessment Task Group 5-32c 3:15pm–5:00pm Douglas Pauls, Rockwell Collins 11A 39
Flexible Circuits Base Materials Subcommittee D-13 3:15pm–5:00pm Clark Webster, ALL Flex LLC 10 40
Intellectual Property Standard Committee E-20 3:15pm–5:00pm RajeshKumar,DDiCorp.; Michael Moisan, TTM Technologies
8 41
FREE! Technical Posters Presentations 3:30pm–4:30pm 6A 27
FREE!ShowFloorReception—HallsA,B&CandSailsPavilion 4:00pm–6:00pm 19
Meet&Eat 6:30pm
Thursday, March 1Event Registration 7:00am–2:00pm Hall AB
Lobby
ShowOffice 6:00am–1:00pm Sails Pavilion
PressOffice 8:00am–3:00pm 16A
Speaker Ready Room 7:30am–5:00pm 1A
Exhibits Open — Halls A, B & C and Sails Pavilion 10:00am–2:00pm
12SH
OW
SCH
ED
ULE
www.IPCAPEXEXPO.org
All meetings will take place in the San Diego Convention Center.
PD=EducationalCourse•S=ConferenceSession•BZ=BUZZSession
Event Code Time Chairman/Moderator Room Page
SMEMA Council (By Invitation) 7:00am–9:00am LeoVandeVall,AssembléonAmerica,Inc. 14B
PCB Suppliers Council Steering Committee (By Invitation) V9-40 8:00am–9:30am DonaldWalsh,UyemuraInternationalCorp. 14A
Corrosion of Metal Finishes Task Group 3-11g 8:00am–10:00am Beverley Christian, Ph.D., Research In Motion Ltd.
5B 38
Printed Electronics Design Subcommittee D-61 8:00am–10:00am Daniel Gamota, Printovate Technologies, Inc.; JieZhang,InstituteofMaterialsResearch&Engineering (IMRE)
7A 42
Conflict Minerals Due Diligence Committee E-30 8:00am–12:00pm John Ciba Jr., Brady Corp.; JoelSilverman,KEMETElectronicsCorp.
7B 41
Wire Harness Design Task Group 7-31k 8:00am–12:00pm Robert Cooke, CIT, NASA Johnson Space Center 15B 43
EMS Leadership Training 8:00am–5:00pm Don Turner, DWT Management 13 23
EMSProgramManagerTrainingandCertificationII 8:00am–5:00pm 12 23
FREE! Best International Academic Papers BZ6 8:30am–10:00am CarolHandwerker,Sc.D.,PurdueUniversity 6F 24
Design for Test (DFT) S28 9:00am–10:00am Lars-OlofWallin,IPCEuropeanOffice 1B 32
Printing II S27 9:00am–10:00am Anurag Bansal, Ph.D., Cisco Systems Inc. 6C 32
Signal Integrity III: Flex and Rigid S30 9:00am–10:00am Dennis Fritz, MacDermid, Inc. 3 32
Solder Paste S26 9:00am–10:00am Mario Scalzo III, Indium Corporation of America 6D 31
Surface Finishes I S29 9:00am–10:00am RajeshKumar,DDiCorp. 2 32
Contracting With the Customer: What the EMS Manager Needs to Know—PartI
PD47 9:00am–12:00pm Allen Anderson J.D., CPCM, and Jeffrey Roth, Fees&Burgess,P.C.
8 36
Design and Packaging for Space Hardware and Other High-ReliabilityApplications
PD12 9:00am–12:00pm Daniel DiTuro, Honeywell International 11A 36
Front-EndEngineeringPerspectiveonDesignIssues PD45 9:00am–12:00pm Mike Tucker, Colonial Circuits Inc. 9 36
Lean:10ThingsEveryManagerShouldKnowforaCompetitiveAdvantage
PD32 9:00am–12:00pm Steven Williams, Williams Consulting 11B 36
Practical Tips for Rework of Advanced Packages — Reballing BGAs, Leadless Device Rework
PD51 9:00am–12:00pm Norman Mier Jr., MIT, and Robert Wettermann, MIT, BEST Inc.
10 36
IndustryAdvisoryGroup(IAG)forUL UL-IAG 10:00am–12:00pm OvidiuMunteanu,UnderwritersLaboratories 5A 43
PrintedElectronicsBaseMaterial/SubstratesSubcommittee D-62 10:00am–12:00pm Daniel Gamota, Printovate Technologies, Inc.; James Williams, Polyonics, Inc.
7A 42
BGA Reliability S32 10:15am–11:45am RussellNowland,Alcatel-Lucent 6D 32
Halogen-Free S35 10:15am–11:45am Dennis Fritz, MacDermid, Inc. 3 33
Pad Cratering S31 10:15am–11:45am Cheryl Tulkoff, CRE, DfR Solutions 6C 32
PCB Warpage S33 10:15am–11:45am Greg Papandrew, Bare Board Group 1B 32
FREE! Supply Line Issues BZ7 10:15am–11:45am James Carrigan, Premier Semi Conductor Svcs; Michael Ford, Mentor Graphics; Rick Stanton, CIT, ProSkill Training Group
6F 24
Surface Finishes II S34 10:15am–11:45am RajeshKumar,DDiCorp. 2 32
Printed Electronics Functional Materials Subcommittee D-63 1:00pm–3:00pm Daniel Gamota, Printovate Technologies, Inc.; Markus Riester, maris TechCon
7A 42
Conflict Minerals Data Exchange Task Group 2-18h 1:30pm–5:00pm 7B 40
IPC-HDBK-620HandbookTaskGroup 7-31h 1:30pm–5:00pm Randy McNutt, Northrop Grumman Corp.; BrettMiller,USAHarness,Inc.
15B 42
Contracting With the Customer: What the EMS Manager Needs to Know—PartII
PD48 2:00pm–5:00pm Allen Anderson J.D., CPCM, and Jeffrey Roth, Fees&Burgess,P.C.
8 36
Printed Electronics Final Assembly Subcommittee D-64 3:00pm–5:00pm Daniel Gamota, Printovate Technologies, Inc. 7A 42
Friday, March 2Printed Electronics Technology Roadmap Subcommittee 8-61 8:00am–12:00pm Daniel Gamota, Printovate Technologies, Inc. 5B 42
Supplier Declaration Subcommittee 2-18 8:00am–12:00pm KristaCrotty,AlberiEcoTech;JørgenVos 7B 39
EMS Leadership Training 8:00am–5:00pm Don Turner, DWT Management 13 23
EMSProgramManagerTrainingandCertificationII 8:00am–5:00pm 12 23
Saturday, March 3EMSProgramManagerTrainingandCertificationExam 8:00am–12:00pm 12 23
SMEMA Council (By Invitation) 7:00am–9:00am LeoVandeVall,AssembléonAmerica,Inc. 14B
PCB Suppliers Council Steering Committee (By Invitation) V9-40 8:00am–9:30am DonaldWalsh,UyemuraInternationalCorp. 14A
Corrosion of Metal Finishes Task Group 3-11g 8:00am–10:00am Beverley Christian, Ph.D., Research In Motion Ltd.
5B 38
Printed Electronics Design Subcommittee D-61 8:00am–10:00am Daniel Gamota, Printovate Technologies, Inc.; JieZhang,InstituteofMaterialsResearch&Engineering (IMRE)
7A 42
Conflict Minerals Due Diligence Committee E-30 8:00am–12:00pm John Ciba Jr., Brady Corp.; JoelSilverman,KEMETElectronicsCorp.
7B 41
Wire Harness Design Task Group 7-31k 8:00am–12:00pm Robert Cooke, CIT, NASA Johnson Space Center 15B 43
EMS Leadership Training 8:00am–5:00pm Don Turner, DWT Management 13 23
EMSProgramManagerTrainingandCertificationII 8:00am–5:00pm 12 23
FREE! Best International Academic Papers BZ6 8:30am–10:00am CarolHandwerker,Sc.D.,PurdueUniversity 6F 24
Design for Test (DFT) S28 9:00am–10:00am Lars-OlofWallin,IPCEuropeanOffice 1B 32
Printing II S27 9:00am–10:00am Anurag Bansal, Ph.D., Cisco Systems Inc. 6C 32
Signal Integrity III: Flex and Rigid S30 9:00am–10:00am Dennis Fritz, MacDermid, Inc. 3 32
Solder Paste S26 9:00am–10:00am Mario Scalzo III, Indium Corporation of America 6D 31
Surface Finishes I S29 9:00am–10:00am RajeshKumar,DDiCorp. 2 32
Contracting With the Customer: What the EMS Manager Needs to Know—PartI
PD47 9:00am–12:00pm Allen Anderson J.D., CPCM, and Jeffrey Roth, Fees&Burgess,P.C.
8 36
Design and Packaging for Space Hardware and Other High-ReliabilityApplications
PD12 9:00am–12:00pm Daniel DiTuro, Honeywell International 11A 36
Front-EndEngineeringPerspectiveonDesignIssues PD45 9:00am–12:00pm Mike Tucker, Colonial Circuits Inc. 9 36
Lean:10ThingsEveryManagerShouldKnowforaCompetitiveAdvantage
PD32 9:00am–12:00pm Steven Williams, Williams Consulting 11B 36
Practical Tips for Rework of Advanced Packages — Reballing BGAs, Leadless Device Rework
PD51 9:00am–12:00pm Norman Mier Jr., MIT, and Robert Wettermann, MIT, BEST Inc.
10 36
IndustryAdvisoryGroup(IAG)forUL UL-IAG 10:00am–12:00pm OvidiuMunteanu,UnderwritersLaboratories 5A 43
PrintedElectronicsBaseMaterial/SubstratesSubcommittee D-62 10:00am–12:00pm Daniel Gamota, Printovate Technologies, Inc.; James Williams, Polyonics, Inc.
7A 42
BGA Reliability S32 10:15am–11:45am RussellNowland,Alcatel-Lucent 6D 32
Halogen-Free S35 10:15am–11:45am Dennis Fritz, MacDermid, Inc. 3 33
Pad Cratering S31 10:15am–11:45am Cheryl Tulkoff, CRE, DfR Solutions 6C 32
PCB Warpage S33 10:15am–11:45am Greg Papandrew, Bare Board Group 1B 32
FREE! Supply Line Issues BZ7 10:15am–11:45am James Carrigan, Premier Semi Conductor Svcs; Michael Ford, Mentor Graphics; Rick Stanton, CIT, ProSkill Training Group
6F 24
Surface Finishes II S34 10:15am–11:45am RajeshKumar,DDiCorp. 2 32
Printed Electronics Functional Materials Subcommittee D-63 1:00pm–3:00pm Daniel Gamota, Printovate Technologies, Inc.; Markus Riester, maris TechCon
7A 42
Conflict Minerals Data Exchange Task Group 2-18h 1:30pm–5:00pm 7B 40
IPC-HDBK-620HandbookTaskGroup 7-31h 1:30pm–5:00pm Randy McNutt, Northrop Grumman Corp.; BrettMiller,USAHarness,Inc.
15B 42
Contracting With the Customer: What the EMS Manager Needs to Know—PartII
PD48 2:00pm–5:00pm Allen Anderson J.D., CPCM, and Jeffrey Roth, Fees&Burgess,P.C.
8 36
Printed Electronics Final Assembly Subcommittee D-64 3:00pm–5:00pm Daniel Gamota, Printovate Technologies, Inc. 7A 42
Friday, March 2Printed Electronics Technology Roadmap Subcommittee 8-61 8:00am–12:00pm Daniel Gamota, Printovate Technologies, Inc. 5B 42
Supplier Declaration Subcommittee 2-18 8:00am–12:00pm KristaCrotty,AlberiEcoTech;JørgenVos 7B 39
EMS Leadership Training 8:00am–5:00pm Don Turner, DWT Management 13 23
EMSProgramManagerTrainingandCertificationII 8:00am–5:00pm 12 23
Saturday, March 3EMSProgramManagerTrainingandCertificationExam 8:00am–12:00pm 12 23
Your Industry Trade Association Connecting you to information and expertise on manufacturing and management best practices and solutions, new technologies, industry standards, government relations and environment, health, and safety.
®
Association Connecting Electronics Industries
Stop by IPC booth 635 in the Sails Pavilion (Upper Level Exhibit Hall) to learn more about IPC’s information and knowledge resources.
ONLINE INFORMATION NEW! IPC OutlookIPC Outlook, the Knowledge and Know-how Connection, is a weekly e-newsletter and website for multimedia information about critical issues and technologies. IPC Outlook has more than 750 technical programs for viewing or downloading and includes a comprehensive directory featuring more than 1,300 industry suppliers. Take a look or subscribe today at www.IPCOutlook.org.
Sponsors welcome! Stop by IPC Booth 635 for a media kit and learn how you can advertise cost-effectively to 100,000+ subscribers and 200,000 website visitors.
Online Peer NetworkingFind IPC expertise online at Technet, LinkedIn, Facebook, YouTube, and Twitter!
• www.ipc.org/technet• www.ipc.org/linkedin• www.ipc.org/facebook• www.ipc.org/youtube• www.ipc.org/twitter
Face-to-Face and Online EducationIPC Conference on Electronics Assembly March 20-22 Budapest, Hungary
IPC Tin Whiskers Conference April 17–19 Ft. Worth, Texas
IPC Test and Inspection Conference May 15–17 Orange County, California
IPC International Conference on Flexible Circuits June 12–14 Irvine, California
IPC Executive Summit August 22–23 Schaumburg (Chicago), Illinois
IPC Midwest Conference & Exhibition August 22–23 Schaumburg (Chicago), Illinois
IPC International Conference on HDI October 24–25 El Segundo, California
IPC-SMTA Cleaning and Conformal Coating Conference November 13–15 Chicago, Illinois
Summer and Fall Webinars June–December
Visit www.IPC.org/events today!
LEGOTRONIC
123 456 789 00
@
15General Information
Registration Hall AB LobbySunday,February26–Wednesday,February29 7:00am–6:00pm Thursday,March1 7:00am–2:00pm
Help Desk Sails Pavilion LobbySunday,February26–Thursday,March1 8:00am–5:00pm
Official HotelsFor assistance with an existing reservation, visit the housing desk in the ShowOfficeintheSailsPavilion.
San Diego Marriott Marquis & Marina 333WestHarborDrive +1619-234-1500
Hilton San Diego Gaslamp Quarter401KStreet+1619-231-4040
The Hard Rock Hotel San Diego 2075thAvenue +1619-702-3000
Omni San Diego 675LStreet +1619-231-6664
San Diego Marriott Gaslamp Quarter 660KStreet +1619-696-0234
Residence Inn San Diego Downtown/Gaslamp Quarter 3566thAvenue,SanDiego +1619-487-1200
Embassy Suites San Diego Bay - Downtown 601PacificHighway +1619-239-2400
Westin San Diego 400W.Broadway +1619-239-4500
Getting AroundTaxis & ShuttlesTaxis and shuttles are abundant and easily accessible from the Center, airport, major hotels and downtown locations.
Public TransportationThe Metropolitan Transit System (MTS) offers an online trip planner at www.sdmts.com/tripplanner.asptohelpyougetaroundthecity.MTSalsooperatestheSanDiegoTrolleywww.sdmts.com/trolley/trolley.asp— an inexpensive and fun way to see the sites. Link to the schedule fromtheIPCAPEXEXPOmobilesite,www.IPCAPEXEXPO.org/morpickup a schedule at the Restaurant and Information desk located on the Ground Level outside of Hall B.
Business Services & ResourcesBusiness Center/FedEx Office Hall D LobbyMonday–Friday 8:00am–5:00pm Saturday–Sunday 9:00am–5:00pm
TheFedExOfficeistheon-sitebusinessservicecenterforshipping,mailing,faxing,andphotocopying.Contact:+1619-525-5450.
FREE Wireless Internet AccessFreeWi-FiserviceisavailableintheIPCmeetingsarea—Rooms1–19,locatedontheUpper&MezzanineLevels.Thenetworkisunsecuredand does not use WEP encryption.
Concessions/StarbucksStarbucks is located in the lobby area of Hall A and Hall C. Concessions are also available in the Sails Pavilion lobby and at the rear of Hall C.
FREE Connection Zone — Booth913 Internet Kiosks and Phone Charging StationsFREE access to computers and outlets to charge your phone will be available in a convenient spot in the hall.
Twitter AnnouncementsGetup-to-the-minuteshowannouncements.FindusatTwitter.com/IPCShow. Don’t forget to use #IPCShow in your tweets.
More Information You Should KnowEvent Luncheons (registration required) Room 6AMonday,February27–Wednesday,February29 12:00pm–1:30pmIfnotincludedinyourpackage,luncheonsmaybepurchasedfor$40/day.
Speaker Ready Room Room 1A
Tuesday,February28–Thursday,March1 6:30am–5:00pm Speakers and instructors may use this room to prepare for their presentations. Personal belongings should not be left in this room.
Press Office Room 16AAfinalpressconferencescheduleisavailableinthepressoffice.
Photo and Video Recording Still photography and video recording of any exhibit or function is prohibited within the exhibit halls, meeting rooms and lobbies. This applies to both exhibitors and attendees. Show Management, the officialshowphotographerandaccreditedmembersofthe press are exempt from this rule. Attendees may take photographs of a booth, if they are accompanied by a badged exhibitor for that booth.
PoliciesAnyfunctionthatisnotpartofthe“officialprogram”isprohibited,fromthefirstmeetingtothecloseoftheevent. IPC does not permit solicitation from nonexhibiting companies. Any individual observed soliciting or selling products to attendees or exhibitors without having a booth (known as suitcasing) will be asked to leave immediately and will be banned from future IPC APEXEXPOevents.PleasereportsuitcasingactivitiestoIPCShowManagement immediately.
First AidFirstAidislocatedinBoxOfficeAacrossfromRegistration.
Restaurant and Information DeskLocated on the Ground Level outside of Hall B.
San Diego 2013 — February 19-21Get a jump on next year’s reservations and secure the hotel you want. No worries — there’s no contract, and no deposit will not be charged untilJanuary2013!Visitwww.IPCAPEXEXPO.org/hotel-2013orstopbythehousingdeskintheShowOfficeintheSailsPavilion.
San Diego Marriott Marquis & Marina $249 Cityview/ $259 Bayview
Hilton San Diego Gaslamp Quarter $199The Hard Rock Hotel San Diego $219Omni San Diego $175San Diego Marriott Gaslamp Quarter $209Residence Inn San Diego Downtown/Gaslamp Quarter $169Embassy Suites San Diego Bay – Downtown $169
GE
NE
RA
L IN
FO
RM
ATI
ON
16
www.IPCAPEXEXPO.orgKE
YN
OTE
SE
SSIO
NS
William Shatner Book SigningTuesday,February28•10:00am SailsPavilion(UpperLevelExhibitHall)
Beam on up to the Sails Pavilion and meet William Shatner in person. He’ll be signing copies of his latest book, Shatner Rules: Your Guide to Understanding the Shatnerverse and the World at Large. Copies are available for purchaseon-sitefor$20(cashonly).
Special Events
FREE! Keynote SessionsOpening Keynote
Captain’s Log — Boldly going where no man has gone before...
William ShatnerTuesday,February28•8:30am–9:30am Room6A
OneofHollywood’smostrecognizablefigures,WilliamShatnerhascultivatedacareerspanningmorethan50years.Perhapsrecognizedbestasanactor,andmorespecificallyasCaptainJamesT.Kirk,Shatnerhasembraced roles as a director, producer, recording artist, horseman, major philanthropist and an author of nearly 30best-sellersinboththefictionandnonfictiongenres.Ironically,Shatner’sreal-lifemissionresonateswithanall-too-familiarprologueto“seekoutnewlife.”Andatthetenderageof80,hecontinuestodojustthat.
Shatner’s autobiography, Up Till Now,wasaNewYorkTimesbest-seller.InShatner’slatestbook,Shatner Rules: Your Guide to Understanding the Shatnerverse and the World at Large, he provides a glimpse of what makes himuniquelyBillandhepresentsanumberofrulesthat,hesays,likehislifeare,“suitablyunique,strangeandworthyofsomemeasureofwonder.”
Join your colleagues for an intimate and amusing visit with this illustrious American icon as he shares his life’s explorations, inspires uswithsomerulestoliveby,andsparksourdriveto“explorestrangenewworlds.”
Wednesday Keynote: Gazing into the Crystal Ball Wednesday,February29•8:00am–9:30am Room6APanelists:
What will the game changers be for the printed circuit board and electronics assembly industries?
Isitprintedelectronics,nanotechnology,environmentalregulationsornewqualityandreliabilitydrivers?Ourpanelofindustryexpertswill look into the future and predict the shocks to our industry … and opportunities.
Cary Wood President and CEO Sparton Electronics Inc.
Mikel Williams President&CEO DDi Corp.
Phil Plonski Managing Partner Prismark Partners
JanVardaman President TechSearch International Inc.
Bolaji Ojo Editor-in-chief EBN
Volume ProductsHalogen FreeProducts
New ProductsLaunching 2012
Isola has been driving technology forward for 100 years.Our legacy continues with global R&D pushing our product line to the forefront as the base solution for design requirements across an array of industries.
Isola laminates and prepregs are in more products than ever before. No matter where you are in the world, or what your design needs may be — however unique — Isola supplies the base for innovation.
Isola Corp., 3100 West Ray Rd., Suite 301, Chandler, AZ 85226, (480) 893-6527, www.isola-group.com
The data, while believed to be accurate and based on analytical methods considered to be reliable, is for information purposes only. Any sales of these materials will be governed by the terms and conditions of the agreement under which they are sold.
Supplying the base for innovation
www.isola-group.com
185HRTg >170, Df - 0.020
FR406HRTg 180, Df - 0.019
IS415 200 TgMid Dk/Df
I-Speed™Tg 200, Df - 0.0065
FR408HRISLow Dk Glass
IS572NHalogen Free No Flow
I-Tera™Dk<3.45 Df -0.0028-0.0035
IS415 200 TgMid Dk/Df
A N N IVERSARY
1912-2012
Y E A R
Please come see us in booth #2019 @ IPC APEX EXPO
IPC2012 Show Directory Ad 1-9-12 Prepared by The Fox Shop - Full page ad 8” x 10.875”
19
Meet the People Who Move the IndustryFREE! International ReceptionMonday,February27•5:30pm–6:30pm WestTerrace(UpperLevel)
Our international friends are invited to relax, have a bite to eat, and meet key IPC volunteers.
FREE! First-Timers’ Welcome BreakfastTuesday,February28•7:30am–8:30am Room4
Enjoy a continental breakfast while your colleagues share the ins and outs of IPC and this event. Learn how to put IPC’s resources to use foryouandyourcompany.Evenifyou’renotafirst-timer,joinusforarefresher course on IPC programs and activities.
FREE! Women in Electronics Networking Breakfast Wednesday,February29•7:30am–8:30am Room4 BarbaraPauls,President&CEO,MidAmericaTaping&ReelingInc.
From engineering to sales and marketing to executive management, women are making a greater impact
in all areas of the electronic interconnect industry. How has being a woman affected your career? Share your experiences with your peers and build your industry network for your future career
success. There is no charge to attend, but please stopbyregistrationtoRSVPforthismeeting.
FREE! Show Floor ReceptionWednesday,February29•4:00pm–6:00pm ExhibitHalls
Take a couple of hours to kick back with your colleagues for our very own happy hour. Catch up with old friends and make a few more along the way. Take a casual stroll through the exhibition, scope out all the goodies the exhibitors have to offer and munch on a few goodies from IPC.
FREE! Government Relations Committee Open ForumTuesday,February28•11:00am–12:00pm Room8 Mikel Williams, DDi Corp.
This meeting will provide you with an update on IPC’s efforts to protect printed circuit board designs for military products under ITAR. The latest information on conflict minerals regulation and the expected impact on your business will also be shared. After the overview, there will be an open discussion regarding future issues for the committee to address.
Luncheons Room 6ARegistrationisrequired.
IPC Event Awards Luncheons Monday,February27•12:00pm–1:30pm Wednesday,February29•12:00pm–1:30pm
IPC Annual Meeting and Luncheon Tuesday,February28•12:00pm–1:30pm
Meet & Eat Tuesday,February28•6:30pm Wednesday,February29•6:30pm
Needdinnerplans?Don’tgosolo!JoinotherIPCAPEXEXPOparticipantsandmakenewfriendswhileyouenjoy some good food and good conversation. Select dining venues are within walking distance of the convention center. Sign up for dinner reservations at the Restaurant Information Center in the convention
centerorsignuponlinebyscanningtheQRcode.Bonappétit!
3o Search for companies by keyword, category; will their product(s) meet our needs?
3o Schedule appointments with potential new suppliers
3o Create my personal itinerary for the event; add in sessions that I’ll attend
3o Review list of other attendees that have similar interests as me; schedule coffee with them or meet them at a networking event — add it to my calendar
3o Download my itinerary to Outlook®
Another Way to Connect …IPC’s NEW My APEX EXPO — Your show tool for BEFORE, DURING and AFTER the show!
Nowthattheshowhasbegun,youcanstillaccessMyAPEXEXPOtolearnaboutexhibitors’products,scheduleappointmentsandaddactivities to your itinerary (Internet access is available in the exhibit hall and on the conference level of the convention center). Reach out to attendees who have similar interests as you; even if you can’t meet up at the show, you can keep in touch throughout the year andhopefullymeetface-to-facenextyearinSanDiego.
Forsixmonthsaftertheshow,youcanaccessMyAPEXEXPOtoreferencepotentialsuppliersforanewprojectorneed.Allexhibitorinformation,includingproductdetails,photos,andcontactinformationwillbeavailableatyourfingertips.
www.IPCAPEXEXPO.org/My-Show SPE
CIA
L E
VE
NTS
Special Events
20
www.IPCAPEXEXPO.org
New Product Zone Booth 402View cutting-edge products and services in the new, New Product Zone located in the Sails Pavilion. Get a sneak preview of the equipment, materials and services that are breaking new ground in our industry.
NPL Defect Database Clinic Live Booth 533Get your toughest challenges resolved! Take advantage of the Defect Database Clinic on the show floor in the Sails Pavilion and get free, unbiased help from international consultant and IPC course instructor Bob Willis on all of your process-related issues. Bring board assemblies for examination or process problems for discussion. Inspection equipment will assist in understanding the process problem and suggested solutions.
NEW THIS YEAR … Mini seminars! February 28–29 — 11:00 am, 1:00 pm and 3:00 pm March 1 — 11:00 am and 1:00 pm
✓ How to conduct dye & pry on area array packages ✓ How to test circuit boards for outgassing for FREE ✓ How to test component solderability for a few dollars✓ How to monitor PCB solderability for FREE in production
The clinic is organized by IPC & National Physical Laboratory (NPL).
Sponsor:
Show Floor ReceptionWednesday, February 29 4:00 pm–6:00 pm
Kick back with your colleagues at IPC’s very own happy hour. Walk both floors of the exhibition, scope out all the new exhibitor offerings, and catch up with colleagues.
IPC Bookstore Booth 635Resources to enhance your work, help train your staff and support your company’s strategic planning efforts are waiting for you in the IPC bookstore.
• Browse industry standards on design, board fabrication and assembly.• Check out IPC training and certification programs.• Review IPC’s catalog of multimedia training resources, including
DVDs, interactive CD-ROMs, online video resources, training and reference guides, wall posters and image archives.
• Learn about IPC’s management programs, market research reports and technology roadmaps. Member prices will be extended to all attendees on-site, even if you aren’t one! While you’re at the bookstore, pick up an IPC publications catalog.
FREE Connection Zone Booth 913Internet Kiosks and Phone Charging StationsFREE access to computers and outlets to charge your phone are available in booth 913 in the Sails Pavilion.
ON
TH
E S
HO
W F
LOO
RSpecial Events
FREE Activities On the Show FloorIPC APEX EXPO Hand Soldering Competition and IPC GRAND CHAMPIONSHIPFebruary 28–29 and March 1 Sails Pavilion, Booth 539Competition Times: 1:00 pm, 1:40 pm, 2:20 pm and 3:00 pm
Who’s the Best-of-the-Best?Come cheer ‘em on and let’s find out who will win the title of the Best-of-the-Best at IPC APEX EXPO! Held over two days, this competition will pit competitors against each other to build a functional electronics assembly within a half-hour time limit. Assemblies will be judged on soldering in accordance with IPC-A-610E Class 3 criteria, the speed at which assembly was produced
and overall electrical functionality of assembly. IPC-A-610E Master Instructors will serve as the judges.
Registered competitors are from• AER Technologies • Amphenol• Artisan Electronics Inc.• Ball Aerospace • DoD• Ericsson Katrineholm• I/O Controls Corporation
• Information Network Security Agency• Lockheed Martin Space Systems• MEC Northwest• Moog• Northrop Grunman• NSWC Crane• Plantronics
• S and Y Industries• Sandia National Labs Albuquerque• Slot Tech Magazine• Transmex International, S.A.
(list as of February 8)
Premier Sponsor: Sponsors:
Cash prizes of $500, $250 and $100 will be awarded by IPC to the top three finalists at 4:30 pm on Wednesday, February 29.
IPC HAND SOLDERING GRAND CHAMPIONSHIPOn Thursday, March 1, the IPC APEX EXPO winner will take on the Best Hand-Soldering Technician in the Midwest, Nichole DeVries, CIT, Raven Industries, Sioux Falls, S.D. (from the IPC Midwest 2011 championship). At noon, the IPC HAND SOLDERING GRAND CHAMPION will be announced and the $1,000 grand prize will be awarded.
Visit Alpha at APEX and see how a TechnologyExchange with us can help maximize the value of your process.
Let us tell you about the value creation potential of:
• ALPHA® SACX Plus® Solder Alloy Family
• ALPHA® Exactalloy® Tape & Reel Solder Preforms
• Alpha’s Low Temperature Soldering Technology
• ALPHA® Solder Paste Technology
Win with Alpha Enabling Technologies!
*One winner will be drawn each day at the Alpha Booth #3024 (Feb. 28-29; Mar.1)
Worldwide/Americas Headquarters109 Corporate Boulevard • South Plainfield, NJ 07080 • USA +1-814-946-1611 – Dial 0 • www.alpha.cooksonelectronics.com European Headquarters • Forsyth Road • Sheerwater Woking GU215RZ • United Kingdom • +44-1483-758-400Asia-Pacific Headquarters • 1/F, Block A • 21 Tung Yuen Street Yau Tong Bay • Kowloon, Hong Kong • +852-3190-3100© 2012 Cookson Electronics
apex_challenge_full_page_ad_1_challenge_12x18.qxp 1/17/12 2:41 PM Page 1
22
Designers ForumMonday,February27•7:30am–1:30pm Room6D (Registrationisrequired)
This program of education and networking is for all individuals with an interest in design. Registrationisrequiredandincludesanetworking boxed lunch following the program.
Agenda 7:30am Networking Breakfast
8:00am The Next Level of Information Exchange Dieter Bergman, IPC Director of Technology Transfer
8:45 am Documentation Paradigm Shift: Drawings to Data KarenMcConnell,CID,ManagerofElectricalDesign
Automation, Northrop Grumman
10:00am Optimal Design Starts in the CAD Library TomHausherr,CID+,President,PCBLibrariesInc.
11:00am Flexible Circuit Applications and Design Standards VernSolberg,Principal,SolbergConsulting
12:00pm Tough Choices: Cost/Quality Trade-Offs RickHartley,CID,SeniorEngineer,L-3Communications
1:00pm Lunch
1:30pm Adjourn
IPC Designer Certification (CID and CID+)(Registrationisrequired)
This program provides objective evaluation of core competencies, based upon industry standards. Courses enhance and assess knowledge: how to transform an electrical circuit description into a PCB design that can be manufactured, assembled, tested.
PCB Designer Certification Workshop (CID) Room 12Friday,February24 8:30am–5:00pm Saturday,February25 8:30am–5:00pm
Advanced PCB Designer Certification Room13 Workshop (CID+)Friday,February24 8:30am–5:00pm Saturday,February25 8:30am–5:00pm
CID Exam Room 12Sunday,February26•8:30am–3:00pm
CID+ Exam Room13Sunday,February26•8:30am–3:00pm
SPE
CIA
L E
VE
NTS
Programs for Designers
23
PCB Executive Management MeetingMonday,February27•7:30am–5:00pm Room6E(enterat6F) (Registrationisrequired.)
Agenda7:30 am Networking Breakfast
8:00 am Welcoming Remarks
8:15 am Political and Environmental Issues Impacting the Industry Fern Abrams, Director, GovernmentRelations&EnvironmentalPolicy,IPC
9:00 am Partnering for Success in the New Economy: Managing Increased Expectations in a Budget Constrained Environment Andrew Hamelynck,VicePresidentofMissionAssurance,L-3CommunicationsTelemetry-West
10:00 am Break
10:30 am Market Update Shawn DuBravac, Chief Economist, Consumer Electronics Association
11:15 am Shoring Trends: What North American Manufacturers Can Do Joel Yocom, Reshore America
12:00 pm Lunch
1:30 pm International Panel: A Global Perspective of the PCB Industry Walter Moser,CSOIndustrial&AutomotiveSolutions,AT&SAustriaTechnologie&SystemtechnikAG George Dudnikov,CTOandGM,ZhuhaiFounderPCBDevelopment Limited Steve Lach,VP/GeneralManagerNAOperations,ViasystemsGroup,Inc.
3:00 pm Break
3:30 pm Roundtable Discussions
5:00 pm Adjournment
EMS Management Council MeetingMonday,February27•7:30am–5:00pm Room6C(enterat6F)(Registrationisrequired.)
Agenda7:30 am Networking Breakfast
8:00 am Welcoming Remarks
8:15 am International Panel: Trends in the EMS Industry — A Global Perspective Tony Zhou,President,RayVal(Suzhou)TechnologiesCo.Ltd. Roger Engle, President, AESCO Electronics Gary Barnier, Senior Executive, Centum Electronics Ltd
10:00 am Break
10:30 am Trends in Distribution Dave Doherty,VicePresident,GlobalSupplierandProductOperations,Digi-KeyCorporation
11:15 am Partnering for Success in the New Economy: Managing Increased Expectations in a Budget Constrained Environment Andrew Hamelynck,VicePresidentofMissionAssurance,L-3CommunicationsTelemetry-West
12:00 pm Lunch
1:30 pm ERP Systems and Cloud Computing Marty Bentley, CIO, EPIC
2:15 pm Environmental Update: Conflict Minerals and RoHS Fern Abrams,Director,GovernmentRelations&Environmental Policy, IPC
3:00 pm Break
3:30 pm Roundtable Discussions
5:00 pm Adjournment
Programs for Executives
Introduction to the EMS Industry . . . . . . . . . . . . . . . . Room 13 and Program Management Monday,February27. . . . . . . . . . . . . . . . . . . . . . . . . .8:00am–5:00pm Tuesday, February 28 . . . . . . . . . . . . . . . . . . . . . . . . .8:00am–1:00pm
EMS Program Manager Training . . . . . . . . . . . . . . . .Room 12 and Certification II Thursday, March 1. . . . . . . . . . . . . . . . . . . . . . . . . . . .8:00am–5:00pm Friday, March 2 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .8:00am–5:00pm
EMS Leadership Training . . . . . . . . . . . . . . . . . . . . . . .Room 13 Thursday, March 1. . . . . . . . . . . . . . . . . . . . . . . . . . . .8:00am–5:00pm Friday, March 2 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .8:00am–5:00pm
EMS Program Manager Training . . . . . . . . . . . . . . . .Room 12 and Certification Exam Saturday,March3 . . . . . . . . . . . . . . . . . . . . . . . . . .8:00am–12:00pm
The IPC EMS Program Manager Training and Certification Program (Registrationisrequired)Thisprogramisafour-partcoursethattailorstopicssuchasoperationsmanagement,financemanagement,contractmanagementand leadership skills to the EMS industry.
It’s Not Just For Program Managers!
IPC Certified EMS Program Managers include:Industrial and Senior Project Engineers, Quality and Materials Managers, Operations Directors, Marketing and Business DevelopmentManagers,ExecutiveandSeniorVPsandPresidents&CEOs.
“ My focus is on sales, and it really helped me to see how operations, legal, accounting, and customer service all come together to support our customers. As a result, I have a much clearer understanding of how I can better assist my team members and coordinate resources in support of our customers goals.”
Paul Forker, Vice President of Sales Quality Production Ltd.
SPE
CIA
L E
VE
NTS
24TE
CH
NIC
AL
PR
OG
RA
MS
www.IPCAPEXEXPO.org
Tuesday, February 28
BZ1 Tin Whiskers, Delamination, Copper Dissolution, CAF, Coating Adhesion
1:30 pm–3:00 pm Christopher Hunt, Ph .D . and Bob Willis, National Physical LaboratoryWhiskers,delamination,dissolution,CAFandcoatingsareallquestionsthat engineers need answers to. This session will give you the latest results, projects results, documented reports and an insight into current industry projects. Hunt and Willis will give a joint presentation on some of the most interesting and innovative research work conducted at NPL in the last couple of years. Participants can receive copies of the NPL research reports free of charge.
BZ2 2012 IPC International Technology Roadmap3:15 pm–4:45 pm John Fisher, Interconnect Technology Analysis, Inc .; Joe Fjelstad, Verdant Electronics; Dieter Bergman, IPC; Marc Carter, IPCLearnhowyoucanusethecriticalinformationcontainedinthe2012IPCInternational Technology Roadmap as your company’s own GPS to help youmakestrategicplanningdecisions.KeyfiguresintheRoadmap’sdevelopment, the speakers will explain how it can be used to develop business and market strategies and to validate and justify capital investment or to guide development activities.
Wednesday, February 29
BZ3 Embedded: Emerging Technologies9:00 am–10:00 am Mark Beesley, AT&S Austria Technologie & Systemtechnik AG; Vern Solberg, Solberg Technical ConsultingIn the past, the PCB served as an interconnection platform for device mounting. With the demand for greater functionality however, the PCB ismorphingintoa“component”initsownrightandisnowmovingtoward miniaturization through the embedding of both active and passive devices. This session brings together two renowned experts in embedded technology who will provide a comparative analysis of the reliabilityofembeddedversusSMTandgiveyouanin-depthlookatthecurrent trends for embedding components.
BZ4 Are Conflict Minerals the New RoHS?10:15 am–11:45 am Moderator: Fern Abrams, IPC Government Relations Panelists: Steven McEuen, EPIC Technologies, LLC;
Christopher Schwarz, Canyon Snow Consulting LLC; John Plyler, Research In Motion
UnderSection1502oftheDodd-FrankAct,publiclytradedcompanieswill be burdened with submitting detailed reports to the SEC if their products which contain the conflict minerals tin, tantalum, gold, or tungstencannotbeproventobe“conflict-free.”Althoughthereportingrequirementsapplyonlytopubliclytradedcompanies,itisexpectedthattherequirementswillrapidlyflowthroughtheentiresupplychainin a manner similar to RoHS. Our expert panel will provide the latest information on the SEC regulations, guidance, and industry tools to help youmeetlegalandcustomerrequirements.
BZ5 Solar Standard for Electronics Assemblies — IPC-8701, The Next Generation of Standardization
1:30 pm–3:30 pm Moderator: Dongkai Shangguan, Ph .D ., Flextronics International Panelists: Thomas Cipielewski, Jabil Circuit, Inc . (HQ);
Jim Garner, 2BG Solar; David Torp, IPC; Dennis Willie, Flextronics International
Followingtwoyearsindevelopment,adraftoftheindustry’sfirststandardontheassemblyofsolarpanels,IPC-8701,Visual Acceptance Criteria for Solar Panels – Final Module Assembly, was released for industry comment. Members of the IPC committee which developed thedraftwillprovideanoverviewofIPC-8701anditsapplicationinmanufacturing operations. The panel will also discuss how suppliers canusethedocumentforspecificationpurposesandtheimportanceofindustryadoptionofIPC-8701.
Thursday, March 1
BZ6 Best International Academic Papers8:30 am–10:00 am Moderator: Carol Handwerker, Sc .D ., Purdue UniversityWhat’s hot in assembly and fab research in academia? Let this free BUZZsessionshowyouthebest!Theauthorsofthetopthreepapersfrom the IPC International Academic Paper Competition will present the best in academic research. Meet the university research stars and learn about their important work. Low Temperature Lead-Free Assembly Via Transient Liquid Phase Sintering JosephFlanagan,PurdueUniversity
Measurement Study for Cross Section Versus X-ray Inspection LocNguyen,SanJoseStateUniversity
Solder Fillet Height Workmanship Criteria for Castellated Solder Joints TimPearson,IowaStateUniversity
BZ7 Supply Line Issues10:15 am–11:45 am James Carrigan, Premier Semiconductor Services, LLC; Michael Ford, Mentor Graphics; Rick Stanton, CIT, ProSkill Training GroupIn today’s rapidly changing market, your supply can make or break your business.Iftheissuesofprice,qualityanddeliveryweren’tenoughtomanage, you must now, because of rapid changes in technology, deal withobsolescence,qualityandcomplianceofyourpartsandcounterfeitpartsinthesupplychain.Thisthree-speakersessionwillprovideexpertviewsonhowtodealwiththesesupplychainissues.Joinusforin-depth discussion of how to make the supply chain work for you.
FREE BUZZ SessionsWhat’s the BUZZ all about? Don’t miss these FREE sessions in Room 6F and find out what has people buzz’n .
To compete in today’s economy, you can’t afford traffic jams. With over 45 years of experience in factory automation, Simplimatic keeps your automation and conveyor systems moving with innovative machinery, efficient layout and maximum productivity.
Rely on us for full-service layout, installation and support of the best high-performance automation systems… all with competitive pricing and the flexibility to shift gears quickly.
Call 434-385-9181 today for superior automation systems across a variety of industries:
WE KEEP YOUMoving.
• Electronics• Semiconductor• Chemicals• Pharmaceutical• Automotive• Medical
• Industrial• Blow Molding• Food• Beverage• Personal Care• And More
T: 434-385-9181 • Simplimatic.com • Email: [email protected]
Make Your Marketing Dollars
Global SMT & Packaging has developed a whole range of free new marketing tools to give your campaigns maximum impact and take your marketing messages to a whole new level. Visit the link below for more information.
http://digital.trafalgarmedia.com
Go Further
make_your_marketing-SMT_for IPC APEX Expo 2012.indd 1 12/19/11 2:02 PM
27
P-01 Mag Pac PCB Research Presentation Jianmou Qiu, Pulse Engineering
P-02 Mag Pac (Magnetic Package) PCB Research and Development
Jianmou Qiu, Pulse Engineering
P-04 Embedded vs. SMT: A Comparative Analysis of Reliability — Part II
Mark Beesley, MB Manufacturing
P-05 Solutions Against ESD (Electrostatic Discharge) in a Production Line (SMT) — Today and in the Future — International ESD and Semiconductor Roadmap
Hartmut Berndt, B .E .STAT European ESD competence centre
P-06 Pad Cratering Jim Griffin, Integral Technology
P-10 The Research of Pad Adhesive on Different Lead-Free and Halogen-Free Materials
Kevin Ye, Guangdong Shengyi Sci .Tech Co . Ltd .
P-11 A Perspective on Failure Analysis of Electronic Assemblies and the Tools of Trade
Jeramie Winch, IBM Corporation
P-15 PCB Housings for Industrial Applications Mike Nager, Phoenix Contact
P-17 Impact of Tin Grain Aspect Ratios on the Whiskering of Plated Films
David Lee, Ph .D ., Johns Hopkins University
P-18 Step Stencil Applications William Coleman, Ph .D ., Photo Stencil Inc .
P-19 Embedded Magnetics Technology Overview Jim Quilici, Radial Electronics
P-20 Frequency and Time Domain Analysis of Thin Flexible and Rigid Copper Clad Laminates
Glenn Oliver, DuPont
P-21 How to Improve QFN Solder Quality Through X-Ray Inspection
Jane Feng, Ph .D ., Flextronics
P-23 Any Layer Via Interconnects Using Sintered Paste: Capacity Expansion at Lower Cost
James Haley, Ormet Circuits, Inc .
P-24 Novel Technologies for Mass-Production Test Probes: Design and Challenges
Matthias Zapatka, Ingun
P-25 Three-Dimensional X-Ray Inspection for Void Detection in Power Electronics
Patrick Schuchardt, GOEPEL Electronics LLC
P-26 Hot Nitrogen for Wave Soldering Machines Didier Orlhac, Air Liquide
P-27 Application of Built-In Self-Test in Functional Test of DSL
Ya Jun Gu, Flextronics Tech (Shanghai) Co ., Ltd .
P-28 Production Technologies for Large Area Printed Flexible Electronics
Thomas Kolbusch, Coatema Coating Machinery GmbH
P-29 Improving End-of-the-Line Yield Through Novel Paste Verification Technology
Clive Ashmore, DEK UK
P-31 Indium Surface Whiskers Under Corrosive Gas Conditions
Hans-Peter Tranitz, Ph .D ., Continental Automotive GmbH
P-32 H2O WaterBlock — Moisture Protection from the Inside Out
Blake Stevens, HzO
P-33 Equipping the PCB Design and Supply Chain with 21st Century Data
Richard Almeida, DownStream Technologies, LLC
P-34 Lights Out Printing Comes of Age Clive Ashmore, DEK UK
P-35 Silver Nanoparticle Synthesis and Process Design for Printable Conductive Media
XiaoweiTeng,UniversityofNewHampshire
Technical PostersTechnical posters will be on display Tuesday through Thursday in Room 6A . Authors will be available to answer questions on Wednesday, 3:30 pm–4:30 pm . There is no charge to attend .
TECH
NIC
AL
PR
OG
RA
MS
www.IPCAPEXEXPO.org
28 Technical ConferenceTE
CH
NIC
AL
PR
OG
RA
MS
www.IPCAPEXEXPO.org
(Registration is required .)
Technical Conference AT A GLANCEAssembly Processes for Lead Free and Tin-LeadS04 Voiding IS06 Printing IS09 Voiding IIS11 Solder Joint MorphologyS17 Solder Assembly
S18 PackagingS26 Solder PasteS27 Printing IIS31 Pad Cratering
Cleaning/Coating/Contamination
S14 CleaningS22 Surface Insulation
Resistance
S25A Surface ContaminationS25B Coating
Emerging TechnologiesS02 Tin WhiskersS16 Lead-Free AlloysS20 iNEMI Halogen-Free
S38 Emerging Technologies and Manufacturing Processes for Printed Electronics
Environmental Issues and ComplianceS01 Environmental ComplianceS20 iNEMI Halogen-Free
S35 Halogen-Free
PCB Design, Fabrication and Materials S05 PCB DesignS07 Signal Integrity IS10 PCB MaterialsS19 PCB Hole FillS24 Signal Integrity II
S28 Design for TestS29 Surface Finishes IS30 Signal Integrity IIIS34 Surface Finishes II
Printed ElectronicsS36 Printed ElectronicsS37 Advanced Materials for
Printed Electronics
S38 Emerging Technologies and Manufacturing Processes for Printed Electronics
Quality, Reliability and Test
S02 Tin WhiskersS04 Voiding IS08 AOI TestS13 BIST / Boundary ScanS15 PCB TestingS16 Lead-Free AlloysS18 PackagingS21 Solder Joint Testing and
Performance
S22 Surface Insulation Resistance
S23 Test Process and Specification
S28 Design for Test (DFT)S32 BGA ReliabilityS33 PCB Warpage
S01 Environmental ComplianceTuesday, February 28 • 1:30 pm–3:00 pm Room 1BSusan Landry, Albemarle CorporationIn this session, industry experts will step through the regulatory status, the design process to achieve compliance and the reality of regulatory compliance issues in the electronics industry.1:30 pm Environmental Compliance Reporting – Mastering a
Moving Target Peter Robinson, Total Parts Plus2:00 pm New Techniques to Scale the Use of LCA in Product
Development JørgenVos2:30 pm Elemental Compositions of Over Two Dozen Cell Phones Beverley Christian, Ph.D., Research In Motion Limited
S02 Tin WhiskersTuesday, February 28 • 1:30 pm–3:00 pm Room 6DJames Carrigan, Premier Semiconductor Services, LLCIs there an inherent reliability risk every time a pure or almost pure tinfinishisused?Thethreepapersinthissessionexaminetheriskofwhiskers in cable plating, the mechanism of whisker formation and alternativefinishesforminimizingtinwhiskerformation.1:30 pm Whiskers and Alternative Surface Finishes at Press-In
Technology Hans-PeterTranitz,Ph.D.,ContinentalAutomotiveGmbH 2:00 pm An Investigation of Whisker Growth on Tin Coated Wire
and Braid David Hillman, Rockwell Collins;
Thomas Lesniewski, Northrop Grumman Aerospace Systems2:30 pm Effects of Tin and Copper Nanotexturization on Tin
Whisker Formation DavidLee,Ph.D.,JohnsHopkinsUniversity
S03 Test I: In Circuit Test (ICT)Tuesday, February 28 • 1:30 pm–3:00 pm Room 2Lars-Olof Wallin, IPC European Representative OfficeICTisamainstayofelectronicsquality,butitneedstodomorethandiagnoseproblems:itneedstobeefficientandcosteffective.Thepapersin this session analyze strategies for deployment of ICT and the choice of testprobes.FindouthowtomaximizeyourprofitsandimproveyourICT.1:30 pm Integrated Electrical Test Within the Production Line Alan Albee, Teradyne Inc.2:00 pm Effective Test-Probe Assignment on PCB Electrical
Testing Takeo Negishi, Gardien Japan Co. Ltd2:30 pm Novel Probing Concepts for Mass-Production Tests:
Design and Challenges MatthiasZapatka,Ingun
S04 Voiding I: Process and TestTuesday, February 28 • 1:30 pm–3:00 pm Room 3Jianbiao (John) Pan, Cal Poly State UniversityInthisfirstoftwosessionsonvoids,threepapersanalyzewhattechnologies you can use to reduce voiding, the reliability impact of voids in solder and the best methods to detect voids in your products.1:30 pm Reduction of Voids in Solder Joints . An Alternative to
Vacuum Soldering Christian Ott, SEHO Systems GmbH2:00 pm Thermal Cycle Reliability Study of Vapor Phase BGA
Solder Joints Ward Gatza, Agilent Technologies2:30 pm Before and After Reflow Characterization of FCBGA
Voiding Utilizing High Resolution CT Scan, X-Ray (2-D & 3-D) Imaging, and Cross Section with Digital Imaging
GordonO’HaraandMatthewVandiver,Flextronics
29
INFO
RM
ATI
ON
that I
NSP
IRES
INN
OVA
TIO
N
S05 PCB DesignTuesday, February 28 • 1:30 pm–3:00 pm Room 6CPatricia Goldman, P . J . Goldman ConsultingThis session addresses the optimization of the flow from design through manufacturing and the best methods to reduce cost and increase efficiency,andexploresthereal-worldconsequencesofhowdesignimpactsPCBsinahightemperaturelead-freeworld.1:30 pm A Time Dependent Analytical Analysis of Heat Transfer in
a PCB During a Thermal Excursion J. Lee Parker, Ph.D., JLP2:00 pm A New Paradigm for Design Through Manufacture Michael Ford, Mentor Graphics
S06 Printing ITuesday, February 28 • 3:15 pm–4:45 pm Room 1BRussell Nowland, Alcatel-LucentThisfirstsessiononprintingwillcoverthestencildesignandcoatingchoices that are being developed to ensure the printing process stays ahigh-output/zero-defectprocessfortoday’snewpackagesandsmallfootprints.3:15 pm Stencil Printing of Small Apertures William Coleman, Ph.D., Photo Stencil Inc.3:45 pm Solder Paste Deposits and the Precision of Aperture Sizes Ahne Oosterhof4:15 pm Stencil Printing Process Tools for Miniaturization and High
Yield Processing CliveAshmore,DEKUK
S07 Signal Integrity ITuesday, February 28 • 3:15 pm–4:45 pm Room 6DGreg Munie, Ph .D ., IPCEverybody wants more bandwidth in life, work and performance of high speed electronics, but what good is a big data pipe if the validity of the flowing information can’t be guaranteed? This session will address signal integrity starting with board design and moving into test validation. 3:15 pm PCB Trace Impedance: Impact of Localized PCB Copper
Density Gary Brist, Intel Corporation3:45 pm A Study of PCB Insertion Loss Variation in Manufacturing
Using a New Low-Cost Metrology Jerry Chia, Intel Corporation4:15 pm A New Innovation Developed for Wave Soldering
Machines DidierOrlhac,AirLiquide
S08 AOI TestTuesday, February 28 • 3:15 pm–4:45 pm Room 2Krista Crotty, Alberi EcoTechWhat’s the best test strategy to ensure things work as they’re designed? Giventhevarietyoftestsavailable,oneofthefastestisAOI/AXI.LearnthelatestonAOI/AXIandhowtheycanbeintegratedintoyourprocesstoimprovequalityandensureproductsworkasdesigned.3:15 pm TDI Imaging – An Efficient AOI and AXI Tool Yakov Bulayev, Hamamatsu Corporation3:45 pm Analysis of Optical Inspection from AOI and AXI
Machines AdamYin,GardienPacificLtd.4:15 pm Component Misplacement Prevention on the ICOS Tape &
Reel process using TRIZ & Lean Darin Moreira, Intel Microelectronics
S09 Voiding II: Component EffectsTuesday, February 28 • 3:15 pm–4:45 pm Room 3Jianbiao (John) Pan, Cal Poly State UniversityThis second session on voids focuses on the impact of component type onvoidformation.Getanin-depthlookatwhyvoidsforminparticularcomponenttypesandwhatyoucandotoa-voidthem. 3:15 pm Minimizing Voiding in QFN Packages Using Solder
Preforms Ronald Lasky, Ph.D., PE, Indium Corporation of America 3:45 pm Inclusion Voiding in Gull Wing Solder Joints Theron Lewis, IBM Corporation 4:15 pm Three-Dimensional X-Ray Inspection for Void Detection in
Power Electronics Patrick Schuchardt, Goepel Electronics LLC
S10 PCB MaterialsTuesday, February 28 • 3:15 pm–4:45 pm Room 6CPatricia Goldman, P . J . Goldman ConsultingPCB materials are constantly evolving in response to solder process developmentandthepushfor“greener”materialtechnology.Learnthelatest developments in PCB materials to make the best material choices that meet process and regulatory challenges. 3:15 pm Evaluation of Laminates in Lead-Free HASL Process and
Lead-Free Assembly Environment MeiMingKhaw,AgilentTechnologiesMalaysiaSdn.Bhd. 3:45 pm A Novel Material for High Layer Count and High Reliability
Printed Circuit Boards Maggie Man, Guangdong Shengyi Sci.Tech Co. Ltd. 4:15 pm Polyphenylene Ether Macromonomers . XI . Use in Non-
Epoxy Printed Wiring Boards EdwardPeters,Ph.D.,SabicInnovativePlasticsUSALLC
S11 Solder Joint MorphologyWednesday, February 29 • 9:00 am–10:00 am Room 6DR . Johnson, Ph .D ., Auburn UniversityThe solder process is at the very heart of electronics assembly, but all the best parts in the best designs in the world won’t work if they can’t communicatewithoneanother.Thissessiontakesanin-depthlookatthe anatomy of the solder joint in today’s environment and how that “makeup”impactsreliability. 9:00 am The Morphology Evolution and Voiding of Solder Joints on
QFN Central Pads with a Ni/Au Finish Julie Silk, Agilent Technologies 9:30 am Effect of Cooling Rate on the Intermetallic Layer in Solder
Joints KeithSweatman,NihonSuperiorCo.,Ltd.
S12 FluxWednesday, February 29 • 9:00 am–10:00 am Room 6CMichael Szuch, Nordson AsymtekAs solder continues to evolve in response to industry and regulatory pressure, soldering flux is also evolving. This session’s papers focus on no-cleanandVOCfluxesandwillprovideyouwithdetailedinformationon what to look for in a solder flux. 9:00 am No-Clean Flux Residue and Underfill Compatibility Effects
on Electrical Reliability Eric Bastow, Indium Corporation of America 9:30 am VOC-Free Flux Study KarlSeelig,AIM,Inc.
30 Technical ConferenceTE
CH
NIC
AL
PR
OG
RA
MS
www.IPCAPEXEXPO.org
S13 BIST / Boundary ScanWednesday, February 29 • 9:00 am–10:00 am Room 1BKrista Crotty, Alberi EcoTechBuilt-inselftestandboundaryscanaretwoimportanttesttechniquesthat can help you improve test coverage and reduce product failures. Learn how to use these methods to improve your testing process. 9:00 am Application of Built-in Self-Test in Functional Test of
SONET Ya Jun Gu, Flextronics Tech (Shanghai) Co., Ltd. 9:30 am Boundary Scan Advanced Diagnostic Methods Christopher Cain, Agilent Technologies
S14 CleaningWednesday, February 29 • 9:00 am–10:00 am Room 2Sal Sparacino, ZESTRON AmericaThedifferencebetween“clean”and“notquiteclean”canbethedifferencebetween“successfulproduct”and“returnedforrepair.”This session covers cleaning as it applies to high interconnect density electronicsandtheVOCemissionaspectsofdefluxing.9:00 am Cleaning Challenges in an HDI World MikeBixenman,DBA,KyzenCorporation9:30 am Precision Cleaning in the 21st Century: New Solvent with
Low Global Warming Potential Rajat Basu, Ph.D., Honeywell
S15 PCB TestingWednesday, February 29 • 9:00 am–10:00 am Room 3Gary Ferrari, CID+, CIT, FTG CircuitsOn the assembly line, test weeds out the good from the bad and gives feedback to assembly on how to improve. In the long run, product testing provides valuable information on product reliability and detects common failure modes. Learn how test can improve your product’s performance.9:00 am PWB Stress Testing Correlation: Accelerated vs .
Application — The Round Robin Begins Mark Northrup, IEC Electronics Corp.9:30 am An Easy, Low-Cost Approach to Microsectioning
Microvias Greg Munie, IPC
S16 Lead-Free AlloysWednesday, February 29 • 10:15 am–11:45 am Room 6DCarol Handwerker Sc .D ., Purdue UniversityWhile lead free has been a reality for years, there are still struggles withthe“howto”oflead-freeassembly.Toaddressthesechallenges,thissessionisdedicatedtodevelopmentsinlead-freealloys.Learnthelatest research from industry experts on lead free.10:15 am High Melting Lead-Free Mixed BiAgX Solder Paste
System Ning-ChengLee,Ph.D.,IndiumCorporationofAmerica10:45 am An Investigation into Low-Temperature Tin-Bismuth and
Tin-Bismuth-Silver Lead-Free Alloy Solder Pastes for Electronics Manufacturing Applications
Jasbir Bath, Christopher Associates Inc.
S17 Solder AssemblyWednesday, February 29 • 10:15 am–11:45 am Room 6CGary Ferrari, CID+, CIT, FTG CircuitsIs your solder process all reflow solder, all wave solder, or a little of both? Learn about the latest in vapor phase soldering, dealing with bottom side components and what to do with thick, thermally challenging boards. 10:15 am Assembly Challenges on Bottom Terminated Components Jennifer Nguyen, Flextronics International10:45 am Lead-Free Selective Wave Solder Guidelines for
Thermally Challenging PCBs John McMahon, Celestica11:15 am Hot Nitrogen for Wave Soldering LaurentCoudurier,AirLiquide
S18 PackagingWednesday, February 29 • 10:15 am–11:45 am Room 1BR . Johnson, Ph .D ., Auburn UniversityThissessiononpackageinnovationandqualificationwillprovidethelatest on three package types: capacitors, air cavity packages and flip chip ICs.10:15 am Step Stress Testing of Solid Tantalum Capacitors ThomasFritzler,UniversityofMaryland10:45 am Flip Chip Package Qualification of RF-IC Packages Mumtaz Bora, CID, Peregrine Semiconductor
S19 PCB Hole FillWednesday, February 29 • 10:15 am–11:45 am Room 2Beverley Christian, Ph .D ., Research In Motion LimitedThis session will describe the latest in technologies to ensure reliable holefillinPCBfabricationandwillshowthebestwaystoimprovethefabrication process.10:15 am Effect of Chemical and Processing Parameters on Hole
Filling Characteristics of Copper Electroplating Maria Nikolova, MacDermid, Inc.10:45 am New Challenges for Higher Aspect Ratio: Filling Through
Holes and Blind Micro Vias with Copper by Reverse Pulse Plating
MichaelPalazzola,AtotechUSAInc.11:15 am PTH Core-to-Core Interconnect Using Sintered
Conductive Pastes James Haley, Ormet Circuits, Inc.
S20 iNEMI Halogen-FreeWednesday, February 29 • 10:15 am–11:45 am Room 3Lameck Banda, Ph .D ., Dow Chemical USAHalogen-freeisonthewayduetoregulatoryandmarketingpressure.Thissessionwillcoverhalogen-freetechnology’simpactonsignalintegrity,boardreliabilityandissuesinatransitiontoHFR-(halogenatedflameretardant)-free.Getup-to-speedonwhatcanbeexpectedinahalogen-freeworld.10:15 am iNEMI HFR-Free Signal Integrity Project: An Investigation
to Identify Degradation of Electrical Signals in HFR-Free PCB Materials
Stephen Tisdale, Intel Corporation10:45 am iNEMI HFR-Free High Reliability Project: An Investigation
to Identify Technology Readiness, Supply Capability, and Standards Development Opportunities for “Halogen-Free” Alternatives
Stephen Tisdale, Intel Corporation11:15 am iNEMI HFR-Free PCB Materials Project: An Investigation
to Identify Technology Limitations Involved in Transitioning to HFR-Free PCB Materials
John Davignon, Intel Corporation
31
INFO
RM
ATI
ON
that I
NSP
IRES
INN
OVA
TIO
N
S21 Solder Joint Testing and PerformanceWednesday, February 29 • 1:30 pm–3:30 pm Room 6DJasbir Bath, Christopher Associates Inc .Whatarethebestchoicesforlead-freesolderalloys?Howcanyoubesure the alloy is reliable? This session presents the how’s and why’s ofalloychoice,processrequirementsandreliabilitytestingforlead-freesolders.Getthelatestinformationondevelopmentsinlead-freeassembly, testing and performance.1:30 pm Choosing a Low-Cost Alternative to SAC Alloys for PCB Ronald Lasky, Ph.D., PE, Indium Corporation of America2:00 pm Drop Test Performance of BGA Assembly Using Sac 105ti
Solder Sphere Ning-ChengLee,Ph.D.,IndiumCorporationofAmerica2:30 pm Low-Cycle Fatigue Behavior of Multi-Joint Sample in
Mechanical Testing Christopher Hunt, Ph.D., National Physical Laboratory
S22 Surface Insulation Resistance (SIR)Wednesday, February 29 • 1:30 pm–3:30 pm Room 6CLameck Banda, Ph .D ., Dow Chemical USAThis session looks at SIR from the aspects of flux and cleaning processes used in assembly, the relation of SIR to flux testing, coatings to improve SIR performance and methods of investigating conductive anodic failure (CAF) under laboratory test conditions and for product in thefield.1:30 pm An Evaluation of the Insulation Resistance and Surface
Contamination of Printed Circuit Board Assemblies XiaofeiHe,UniversityofMaryland2:00 pm Correlation of SIR Halide Halogen and Copper Mirror
Tests Nicole Palma, Indium Corporation of America2:30 pm Effect of Silicone Conformal Coating on Surface Insulation
Resistance (SIR) for Printed Circuit Board Assemblies Carlos Montemayor, Dow Corning Corporation
S23 Test Process and SpecificationWednesday, February 29 • 1:30 pm–3:30 pm Room 1BLeland Woodall, Keihin Carolina System TechnologyThisfour-papersessionwillcoverawiderangeoftopicsontest.Learnabouttestrequirementsandstandards,especiallyIPCandmilitaryrequirements,designfortestandreliabilityandbalancingtestloadsina variety of production environments.1:30 pm Testing - Understanding the Proper Testing Processes and
Requirements for Electronics, Electronic Components and Printed Circuit Boards
Aaron Robinson, Envirotronics, Inc.2:00 pm Overcoming Logistical, Economic and Technical
Challenges to Implementing Functional Test in High-Mix/High-Volume Production Environments
Craig Pynn, SiFO 2:30 pm IPC-9252A — Electrical Test Considerations . Class I-III
(and the shadowed 3/A) ToddKolmodin,GardienServicesUSA,Inc.
S24 Signal Integrity II: High SpeedWednesday, February 29 • 1:30 pm–3:30 pm Room 2Gary Ferrari, CID+, CIT, FTG CircuitsIn this second session on signal integrity, the issues of high speed and signal loss, as affected by copper foil technologies, will be addressed. Ifyoufindhigh-speedboardmanufactureachallenge,thissessiononfabrication technologies and their effects on signals is a must.1:30 pm Newest ED Copper Foils for High Speed PCBs and for IC-
Packaging Application Raymond Gales, Circuit Foil Luxembourg SARL2:00 pm Determination of Copper Foil Surface Roughness from
Microsection Photographs Scott Hinaga, Cisco Systems Inc.2:30 pm A Designed Experiment for the Influence of Copper Foils
on Impedance, DC Line Resistance and Insertion Loss AlexanderIppich,MultekEuropeGmbH&Co.KG
S25A Surface ContaminationWednesday, February 29 • 1:30 pm–2:30 pm Room 3Greg Papandrew, Bare Board GroupInthefirsttwopapers(25A),theissueofsurfacecontaminationasitimpactsassembliesinmanufacturingandinfielddeploymentwillbecovered. This session is a must if you are wrestling with contamination issues and are looking for solutions.1:30 pm Effect of Silicone Contamination on Assembly Processes Carlyn Smith, Harris Corporation, GCSD2:00 pm Impact of Dust on Printed Circuit Assembly Reliability BoSong,UniversityofMaryland
S25B CoatingWednesday, February 29 • 2:30 pm–3:30 pm Room 3Phil Kinner, PVAIn a continuation from S25A, the topic of coating as protection for assemblies is covered. If you are wrestling with contamination issues, this session will give you the solutions you are looking for.2:30 pm Measurement of Thin Gold and Palladium Layers Using
X-ray Fluorescence Michael Haller, Fischer Technology Inc.3:00 pm Revolutionary Solution for the PCB Industry: Digital Ink Jet
Solder Mask Printing TomerSegev,CamtekUSA,Inc.
S26 Solder PasteThursday, March 1 • 9:00 am–10:00 am Room 6DMario Scalzo III, Indium Corporation of AmericaSolder paste has passed bar wave solder as the primary solder alloy interconnection. Learn about new technologies in flux and powder for solderpastesthatwillmeetsurfacemountreflowneedsinthelead-free/halogen-freeworldoffinerandfinerpitchpackages. 9:00 am Application of the Advanced Activator Technology on
Halogen-Free Lead-Free Solder Paste Development XiangWei,Kester 9:30 am The Effect of Powder Surface Area and Oxidation on the
Voiding Performance of PoP Solder Pastes Brandon Judd, Indium Corporation of America
32 Technical ConferenceTE
CH
NIC
AL
PR
OG
RA
MS
www.IPCAPEXEXPO.org
S27 Printing IIThursday, March 1 • 9:00 am–10:00 am Room 6CAnurag Bansal, Ph .D ., Cisco Systems Inc .In this second session on printing, issues associated with cavity and step stencils will be addressed. If you are facing problems with component mixes that demand new stencil solutions, this session is a must.9:00 am SMT Manufacturability and Reliability in PCB Cavities MarkusLeitgeb,AT&SAustriaTechnologie&SystemtechnikAG9:30 am Challenges for Step Stencils with Design Guidelines for
Solder Paste Printing Carmina Laentzsch, LaserJob GmbH
S28 Design for Test (DFT)Thursday, March 1 • 9:00 am–10:00 am Room 1BLars-Olof Wallin, IPC European RepresentativeInthissession,testdesigntechniquesforboundaryscanofassembliesand chips will be discussed. Learn how to plan your test strategy better by using boundary scan and the latest test standards.9:00 am Virtual Access Technique Augments Test Coverage on
Limited Access PCB Assemblies Anthony Suto, Teradyne Inc.9:30 am Testing DDR Memory — How On-Chip DFT Helps John Pendlebury, Agilent Technologies
S29 Surface Finishes IThursday, March 1 • 9:00 am–10:00 am Room 2Rajesh Kumar, DDi Corp .Thissessionwilladdresstheissuesofsurfacefinishandcorrosionin harsh environments. Both the comparative corrosion resistance of finishesinharshenvironmentsandtheperformanceofvariousfinishesin standardized corrosion tests will be covered. Discover what you need toknowaboutlead-freefinishperformanceinunfriendlyenvironments.9:00 am Corrosion Resistance of Different PCB Surface Finishes in
Harsh Environments Mustafa Oezkoek, Atotech Deutschland GmbH9:30 am The Surface Finish Effect on the Creep Corrosion in PCB CherieChen,IntegratedServiceTechnology-ISTi
S30 Signal Integrity III: Flex and RigidThursday, March 1 • 9:00 am–10:00 am Room 3Dennis Fritz, MacDermid, Inc .Thefinalsessiononsignalintegritywilladdressflexibleandrigidlaminates and their performance in high speed designs. Learn how various transmission line structures perform and how the properties of the laminate affect high speed performance. 9:00 am Detailed Analysis of Impedance and Loss Versus
Frequency for Transmission Lines Made from Flexible Circuit Materials
Glenn Oliver, DuPont9:30 am Thermal Characteristics of PCB Laminates in High
Frequency Applications John Coonrod, Rogers Corporation
S31 Pad CrateringThursday, March 1 • 10:15 am–11:45 am Room 6CCheryl Tulkoff, CRE, DfR SolutionsIn the switch to lead free, one of the side effects of higher temperatures in assembly has been pad cratering. Experts in assembly will discuss tests to predict and diagnose pad cratering. 10:15 am The Application of Spherical Bend Testing to Predict Safe
Working Manufacturing Process Strains John McMahon, Celestica10:45 am Investigation of Pad Cratering in Large Flip-Chip BGA
Using Acoustic Emission Anurag Bansal, Ph.D., Cisco Systems Inc.11:15 am Pad Cratering JimGriffin,IntegralTechnology
S32 BGA ReliabilityThursday, March 1 • 10:15 am–11:45 am Room 6DRussell Nowland, Alcatel-LucentAsarraypackagescontinuetoincreaseinI/O,sodoconcernsaboutreliability.Tohelpyouwithyourcomplex,high-reliabilitydesignsmigratingintoalead-freeworldthissessionwillcoverhigh-reliabilityapplications of large arrays, backwards compatibility and repair. 10:15 am Assembly and Reliability of 1704 I/O FCBGA and FPBGAs Reza Ghaffarian, Ph.D., Jet Propulsion Laboratory10:45 am The Relationship Between Backward Compatible
Assembly and Microstructure on the Thermal Fatigue Reliability of an Extremely Large Ball Grid Array
RichardCoyle,Alcatel-Lucent11:15 am Reliability of BGA Solder Joints After Re-Balling Process MoBiglari,Mat-TechBV
S33 PCB WarpageThursday, March 1 • 10:15 am–11:45 am Room 1BGreg Papandrew, Bare Board GroupInthehightemperatureworldoflead-free,packageandboardwarpagebecome critical issues if solder interconnections are to be formed successfully. Get the latest on strategies for prevention of board warpageandmethodsofco-planarity/warpagemeasurement.10:15 am Warpage Issues and Assembly Challenges Using Coreless
Packaging Substrate Jinho(Paul)Kim,SamsungElectro-MechanicsCo.,Ltd.10:45 am iNEMI Board Co-Planarity in SMT Project: An
Investigation of the Predictability of Room Temperature Co-Planarity Measurements on the Co-Planarity at Lead-Free Assembly Temperatures
John Davignon, Intel Corporation11:15 am Projection Moiré vs . Shadow Moiré for Warpage
Measurement and Failure Analysis of Advanced Packages
JosephThomas,ZNTechnologies
S34 Surface Finishes IIThursday, March 1 • 10:15 am–11:45 am Room 2Rajesh Kumar, DDi Corp .ThesessionwillcoverPd/ENIGfinishesandahotnewtechnologyforprotectingsurfacefinishes.10:15 am Wire Bonding and Soldering on ENEPIG and ENEP
Surface Finishes with Pure Pd-Layers JoeMcGurran,AtotechUSAInc.10:45 am A Plasma Deposited Surface Finish for Printed Circuit
Boards Andrew Brooks, Semblant Ltd.11:15 am Influence of Pd Thickness on Micro-Void Formation of
Solder Joints in ENEPIG Surface Finish YeonseopYu,SamsungElectro-MechanicsCoLtd
33
S35 Halogen-FreeThursday, March 1 • 10:15 am–11:45 am Room 3Dennis Fritz, MacDermid, Inc .Leadfreecameaboutthroughlegislativefiatandhalogenfreeappears as though it may become an industry reality through the same mechanism. This session will cover the status of the regulatory environment,aswellasnewhalogen-freealternatives.10:15 am The Regulatory and Environment Status of
Tetrabromobisphenol-A in Printed Wiring Boards Susan Landry, Albemarle Corporation10:45 am New Halogen-Free & High CTI (Comparative Tracking
Index) RCC Used in Printed Circuit Application Yin Simon, Shengyi Technology Co., Ltd.11:15 am New Developments in PCB Laminates John Coonrod, Rogers Corporation
S36 Printed Electronics PrintedElectronics
Wednesday, February 29 • 9:00 am–10:00 am Room 6EDaniel Gamota, Printovate Technologies, Inc .The adoption of standards can facilitate the growth of the printed electronicsfieldandreducetheburdenplacedonindividualcompaniestodevelopcompany-specificcompliancedocumentation.Thissessionwill highlight the various opportunities for standards development along the printed electronics supply chain as well as the progress of the four IPC-initiatedstandardsactivities:1)basematerial,2)additivematerialstandard,3)standarddesignguideline,and4)finalassemblystandard.9:00 am IPC Standards and Printed Electronics Monetization Daniel Gamota, Printovate Technologies, Inc.
S37 Advanced Materials for PrintedElectronics
Printed ElectronicsWednesday, February 29 • 10:15 am–11:45 am Room 6EDaniel Gamota, Printovate Technologies, Inc .An often overlooked design parameter for printed electronics based products is the selection of an appropriate substrate. Learn about key substrate material properties (e.g. mechanical, electrical, thermal, optical)thatdeterminehighyieldmanufacturingaswellasin-fieldproduct performance. Experts will also discuss advanced substrate development efforts underway to meet the needs of designers in the finalstagesofnewproductintroductionprograms.10:15 am Performance Requirements for Substrates for Printed
Electronics Neil Bolding, MacDermid Autotype Inc.11:00 am Advances in Conductive Inks Across Multiple
Applications and Deposition Platforms Scott Gordon, DuPont
S38 Emerging Technologies and PrintedElectronics
Manufacturing Processes for Printed ElectronicsWednesday, February 29 • 1:30 pm–3:30 pm Room 6ESteve Tomas, Flexcon CompanyPrinted electronics applications using advanced functional printing techniquesandnewinktechnologycontinuetoexpandworldwide.Learn how to leverage the technical capabilities and experience of your suppliers as well as customers in order to stay abreast of the rapid changes and new opportunities that are available in printed electronics.1:30 pm New and Emerging Technologies in Printed Electronics DonBanfield,ConductiveCompounds2:30 pm Printable Materials and Devices FrankEgitto,VoyaMarkovichandMarkPoliks,Ph.D.,Endicott
Interconnect Technologies Inc.
So m
uch
mor
e tha
n a p
ublic
atio
n...
downloadable white papers...
video journalism...
social media...
webinar host...
industry resource...
lead generator...
thought leader...
the global source for the electronic manufacturing industry
the global source for the electronic manufacturing industry
35
INFO
RM
ATI
ON
that I
NSP
IRES
INN
OVA
TIO
N
9:00 am–12:00 pm
PD01 Building Long-Term Reliability in PCBs: Room 1A Materials, Plating Processes and Innerlayer Treatments for Lead-Free Assembly Requirements
Michael Carano, OMG Electronic Chemicals, LLC
PD03 Chip Packaging - Materials, Quality and Room 10 Reliability
Syed Sajid Ahmad, North Dakota State University
PD04 Cleaning Guidelines for Boards and Room 3 Assemblies: Developing a Successful Process with the NEW IPC-CH-65B
Mike Bixenman, DBA, Kyzen Corporation
PD07 PCB Fabrication Basics: Process and Room 4 Specification — Part I
Don Schmieder III, and Jim Vanden Hogen, Plexus Corporation
PD08 Design for Manufacturing — DFM Room 7B Cheryl Tulkoff, CRE, DfR Solutions
PD09 Counterfeit Components — Causes, Cures Room 7A and Solutions
Bob Willis, ASKbobwillis .com
PD13 Best Practices in Electronics Assembly Room 2 Processes — Part I
Joseph Belmonte, W . James Hall and Phil Zarrow, ITM Consulting Inc .
PD14 Signal Integrity Problem Prevention: Room 11A High-Speed Routing & Termination
Richard Hartley, CID, L-3 Avionics Systems Inc .
PD21 Basics of PCB Design Room 5B Susy Webb, CID, FairfieldNodal
PD25 Conformal Coatings: Types, Uses and Room 8 Specifications
Douglas Pauls, Rockwell Collins
PD31 SMT Process Fundamentals for Tin-Lead Room 5A and Lead-Free Assembly
S . Manian Ramkumar, Ph .D ., Rochester Institute of Technology
PD50 Design for Flexible and Rigid-Flex Room 1B Circuits — Part I
Vern Solberg, Solberg Technical Consulting
2:00 pm–5:00 pm
PD02 PCB Fabrication Basics: Process and Room 4 Specification — Part II
Don Schmieder III, and Jim Vanden Hogen, Plexus Corporation
PD10 Final Finishes — Compatibility with Room 1A Lead-Free Assembly
Michael Carano, OMG Electronic Chemicals, LLC
PD16 Mastering Lead-Free and Tin-Lead Room 7B Selective Soldering
Bob Klenke, ITM Consulting Inc .
PD17 Best Practices in Electronics Assembly Room 2 Processes — Part II
Joseph Belmonte, W . James Hall and Phil Zarrow, ITM Consulting Inc .
PD18 Design of Experiment for SMT Processes Room 8 Rita Mohanty, Ph .D ., Speedline Technologies, Inc .
PD19 Controlling Moisture Content in Boards: Room 10 Best Practices Bhanu Sood, Ph .D ., University of Maryland
PD20 Troubleshooting Your Cleaning Process for Room 9 High Reliability
Umut Tosun, ZESTRON America
PD22 Physics of Failure Room 11A Michael Osterman, Ph .D ., University of Maryland
PD35 Design for Flexible and Rigid-Flex Room 1B Circuits — Part II
Vern Solberg, Solberg Technical Consulting
PD40 Advanced Component Packages and Room 5A Processes
S . Manian Ramkumar, Ph .D ., Rochester Institute of Technology
PD42 Tin Whiskers: Origin, Propensity, Mitigation Room 3 David Pinsky, Raytheon Company
PD43 Designing Complex Boards Room 5B Susy Webb, CID, FairfieldNodal
PD52 LGA, QFN, BMC Assembly & Rework Room 7A Bob Willis, ASKbobwillis .com
TECH
NIC
AL
PR
OG
RA
MS
Professional Development CoursesRegistration is required for each course . Course descriptions are available at www .IPCAPEXEXPO .org/courses .
Sunday, February 26
www.IPCAPEXEXPO.org
Professional Development Courses36TE
CH
NIC
AL
PR
OG
RA
MS
www.IPCAPEXEXPO.org
Monday, February 279:00 am–12:00 pm
PD05 Troubleshooting SMT: Part I — Defining Room 5A the Problem, Determining the Cause
S . Manian Ramkumar, Ph .D ., Rochester Institute of Technology
PD23 Failure Analysis: Lessons Learned Room 1A Martin Anselm, Universal Instruments Corporation
PD26 PoP and BTC Assembly — Material, Room 1B Process and Reliability
Jennie Hwang, Ph .D ., Sc .D ., H-Technologies Group
PD27 Optimizing X-Ray Inspection: Equipment, Room 10 Processes and Procedures
Bob Klenke, ITM Consulting Inc .
PD29 DFM for Manufacturing: When a Six Sigma Room 5B Process Is Not Sufficient to Achieve a High-Yield Manufacturing Process
Dale Lee, Plexus Corp .
PD30 Ball Grid Array (BGA): Principles and Room 3 Practice
Ray Prasad, Ray Prasad Consultancy Group
PD33 Conformal Coating Applications, Inspection, Room 9 Rework & Quality Control
Bob Willis, ASKbobwillis .com
PD46 Lead-Free for the Exemptee: Surviving in a Room 2 Lead-Free World
Joseph Belmonte, W . James Hall and Phil Zarrow, ITM Consulting Inc .
PD49 Testability Strategies: Optimizing the Mix Room 11A Louis Ungar, A .T .E . (Advanced Test Engineering)
2:00 pm–5:00 pm
PD06 Troubleshooting SMT: Part II — Finding Room 5A the Fix and Preventive Action
S . Manian Ramkumar, Ph .D ., Rochester Institute of Technology
PD11 Designing with Flex in Mind: Next Generation Room 1A Mark Finstad, CID, Flexible Circuit Technologies, Inc .;
Jamin Taylor, CID, Minco Products, Inc .
PD15 Preventing Production Defects and Failures Room 1B Jennie Hwang, Ph .D ., Sc .D ., H-Technologies Group
PD34 HDI: Introduction to Processes and Products Room 11A Christopher Ryder, AT&S Austria Technologie &
Systemtechnik AG
PD36 Control of EMI Coupling Mechanisms Room 2 Richard Hartley, CID, L-3 Avionics Systems Inc .
PD37 Lead-Free Assembly for High Yields and Room 4 Reliability
Ronald Lasky, Ph .D ., PE, Indium Corporation of America
PD38 DFX: Project Setup to Measurement Room 5B Definition and Advanced Analysis
Dale Lee, Plexus Corp .
PD39 Design and Assembly Challenges of Ball Room 3 Grid Arrays (BGAs) and Bottom Termination Components
Ray Prasad, Ray Prasad Consultancy Group
PD41 Designing PCB Stackups to Balance Signal Room 10 Integrity Against Manufacturability
Lee Ritchey, Speeding Edge
PD44 Package on Package (PoP), Design Room 9 Assembly, Rework and Inspection
Bob Willis, ASKbobwillis .com
Thursday, March 1 9:00 am–12:00 pm
PD12 Design and Packaging for Space Hardware Room 11A and Other High-Reliability Applications
Daniel DiTuro, Honeywell International
PD32 Lean: 10 Things Every Manager Should Room 11B Know for a Competitive Advantage
Steven Williams, Williams Consulting
PD45 Front-End Engineering Perspective on Room 9 Design Issues
Mike Tucker, Colonial Circuits Inc .
PD47 Contracting With the Customer: What the Room 8 EMS Manager Needs to Know — Part I
Allen Anderson J .D ., CPCM, and Jeffrey Roth, Fees & Burgess, P .C .
PD51 Practical Tips for Rework of Advanced Room 10 Packages — Reballing BGAs, Leadless Device Rework
Norman Mier Jr ., MIT, and Robert Wettermann, MIT, BEST Inc .
2:00 pm–5:00 pm
PD48 Contracting With the Customer: What the Room 8 EMS Manager Needs to Know — Part II
Allen Anderson J .D ., CPCM, and Jeffrey Roth, Fees & Burgess, P .C .
Are your customers asking for Environmental Materials Declarations?
> Component research service> BOM scrubbing and obsolescence management>
Product Features: > Environmental Compliance Reports for RoHS and REACH > IPC-1752A reporting format > Con�ict Minerals reporting > XML data interface > Obsolescence management of electronic components
>> Visit us at booth 814 to �nd out what Total Parts Plus can do for you.
TECH
NIC
AL
PR
OG
RA
MS
38
www.IPCAPEXEXPO.org
Standards Development Meetings(Registration is required)
Assembly and Joining
5-20 Assembly & Joining CommitteeSunday, February 26 • 3:00 pm–4:30 pm Room 14BLeo Lambert, MIT, EPTAC CorporationThis is a planning meeting for the task group and subcommittee leaders of the Assembly and Joining Processes Committee.
5-21e Solder Stencil Task GroupMonday, February 27 • 10:00 am–12:00 pm Room 8William Coleman, Ph .D ., Photo Stencil Inc .; George Oxx, Jr ., Jabil Circuit, Inc . (HQ)ThisgroupiscelebratingthepublicationofrevisionBofIPC-7525. This guide assists users in selecting stencil apertures for solder paste printing,includingsupportforusewithlead-freealloys.
5-21f Ball Grid Array Task GroupTuesday, February 28 • 10:00 am–12:00 pm Room 15BRay Prasad, Ray Prasad Consultancy GroupThisgroupisworkingonrevisionCofIPC-7095todealwithcrateringanomalies and new termination types. The new revision considers mechanical stress testing for area array assemblies. The document is in ballot.
5-22a J-STD-001 Task GroupSaturday, February 25 • 1:00 pm–5:00 pm Room 14BTeresa Rowe, CIT, AAI CorporationThistaskgroupisdevelopingrevisionFofJ-STD-001,Requirements for Soldered Electrical and Electronic Assemblies.
5-22a/ Synergy Meeting — J-STD-001 & IPC-A-6107-31b Task GroupsSunday, February 26 • 8:00 am–3:00 pm Room 14BJennifer Day, CIT, U .S . Army Aviation & Missile Command; Constantino Gonzalez, MIT, ACME Training & Consulting; Teresa Rowe, CIT, AAI CorporationTheJ-STD-001andIPC-A-610taskgroupswillworktogethertoresolvecomments common to both standards.
5-22f J-STD-001 Handbook Task GroupMonday, February 27 • 8:00 am–10:00 am Room 8Daniel Foster, CIT, U .S . Army Aviation & Missile CommandThistaskgroupwillbecelebratingpublicationofrevisionEofIPC-HDBK-001,Handbook and Guide to Supplement J-STD-001.
5-23a Printed Circuit Board Solderability Specifications Task Group
Monday, February 27 • 1:30 pm–5:00 pm Room 11BGerard O’Brien, Solderability Testing & Solutions, Inc .ThisgroupisupdatingIPCJ-STD-003toitsCrevision.Thisdocumentwill address more wetting balance data generation and provide improved solder float test and solder spread test protocols.
5-23b Component and Wire Solderability Specification Task Group
Monday, February 27 • 8:00 am–12:00 pm Room 11BDavid Hillman, Rockwell CollinsThe group will discuss results of the ballot forJ-STD-002DwhichconsolidatesIPC/ECAJ-STD-002C withJESD22-B102(JEDECdocument on same topic).
5-24a Flux Specifications Task GroupTuesday, February 28 • 1:30 pm–3:00 pm Room 11ARenee Michalkiewicz, MIT, Trace Laboratories - BaltimoreThisgroupiscelebratingthepublicationJ-STD-004BAmendment1,Requirements for Soldering Fluxes.
5-24b Solder Paste Task GroupWednesday, February 29 • 10:15 am–12:00 pm Room 8Brian Toleno, Ph .D ., Henkel CorporationThisgroupiscelebratingthepublicationofrevisionAofJ-STD-005,andwillopenIPC-HDBK-005forrevision.
5-24c Solder Alloy Task GroupTuesday, February 28 • 10:00 am–12:00 pm Room 10Jennie Hwang, Ph .D ., Sc .D ., H-Technologies GroupThisgroupisworkingonrevisionCofJ-STD-006,Requirements for Electronic Grade Solder Alloys and Fluxed and Non-Fluxed Solid Solders for Electronic Soldering Applications.
5-24f Underfill Adhesives for Flip Chip ApplicationsWednesday, February 29 • 1:30 pm–5:00 pm Room 7ABrian Toleno, Ph .D ., Henkel CorporationThisgroupisupdatingJ-STD-030,througharevisionAandare-titleof the document to Design, Selection and Process Implementation for Underfill Materials that allows the document to be less constrained on topicandserveasbothaspecificationandaguideline.
7-35 Assembly and Joining Handbook SubcommitteeTuesday, February 28 • 10:00 am–12:00 pm Room 11AMary Muller, Crane Aerospace & ElectronicsThis subcommittee is celebrating the publication of revision A of IPC-AJ-820,thatnowincorporatesthebestpartsofIPC-HDBK-001andIPC-PE-740documents,plusIPC-HDBK-830,IPC-CM–770andDRM–18.
Assembly Equipment
5-41 SMT Component Placement Equipment SubcommitteeMonday, February 27 • 1:30 pm–3:00 pm Room 8Michael Cieslinski, Panasonic Factory Solutions Company of AmericaThiscommitteeiscelebratingthereleaseofrevisionAofIPC-9850.
Base Materials
3-11 Laminate/Prepreg Materials SubcommitteeMonday, February 27 • 8:00 am–12:00 pm Room 12Antonio Senese, Panasonic Electric WorksThissubcommitteeisupdatingIPC-4101C. Amendment 1 work includes: determining a statistically relevant fracture toughness test method; reducingthenumberofspecificationsheets;andusingDMA,aswellasDSC and TMA thermal analysis test methods to set a value of Tg.
3-11f UL/CSA Task GroupTuesday, February 28 • 3:15 pm–5:00 pm Room 9Douglas Sober, Kaneka Texas CorporationThistaskgroupaddressesissuesrelativetoUL’sstandardsonrigidlaminates(UL-746E)andrigidprintedboards(UL-796). Technical issues willfeedintotheULSTPmeeting.
3-11g Corrosion of Metal Finishes Task GroupThursday, March 1 • 8:00 am–10:00 am Room 5BBeverley Christian, Ph .D ., Research In Motion LimitedThis group is gathering data on the effects of corrosion on surface finishesthroughtheuseofmixedflowinggas(MFG)testing.
39
INFO
RM
ATI
ON
that I
NSP
IRES
INN
OVA
TIO
N
3-12a Metallic Foil Task GroupTuesday, February 28 • 10:00 am–12:00 pm Room 9Rolland Savage, High Performance Copper Foil Inc .This group is generating a noncontact test method and is gathering data on copper foil surface roughness measurements for possible inclusion in revisionBofIPC-4562,Metal Foil for Printed Board Applications.
3-12d Woven Glass Reinforcement Task GroupMonday, February 27 • 1:30 pm–3:00 pm Room 12Patricia Goldman, P . J . Goldman ConsultingThistaskgroupisworkingontheBrevisionofIPC-4412,which is anticipatedtobeconcludedin2012.
3-12e Base Materials Roundtable Task GroupMonday, February 27 • 3:15 pm–5:00 pm Room 12Edward Kelley, Isola Group SARLThisgroupwillexploreneededspecificationsandcharacterizationmethods for materials used to manufacture laminates and prepregs. Reinforcements,resins,fillersandmetalfoilswillbediscussed.
Cleaning and Coating
5-31 Cleaning and Alternatives SubcommitteeTuesday, February 28 • 10:00 am–12:00 pm Room 15AMike Bixenman, DBA, Kyzen CorporationThesubcommitteewillreviewchapter13ofIPC-CH-65Bforpossibleamendment and consider committee responses to hot topics in regulatory developments or other issues.
5-32a Ion Chromatography/Ionic Conductivity Task GroupWednesday, February 29 • 1:30 pm–3:00 pm Room 11AJohn Radman, Trace Laboratories - DenverThis task group is reviewing comments to test methods for ionic cleanliness testing.
5-32b SIR and Electrochemical Migration Task GroupMonday, February 27 • 1:30 pm–5:00 pm Room 7AChris Mahanna, Robisan Laboratory Inc .ThistaskgroupisworkingtocompleteIPC-9203,User Guideline for the IPC B-52 SIR Test Board.
5-32c Bare Board Cleanliness Assessment Task GroupWednesday, February 29 • 3:15 pm–5:00 pm Room 11ADouglas Pauls, Rockwell CollinsThistaskgroupisdevelopingIPC-5703,acleanlinessguidelineforprinted board fabricators.
5-32e Conductive Anodic Filament (CAF) Task GroupTuesday, February 28 • 1:30 pm–3:00 pm Room 9Karl Sauter, Oracle America, Inc .This group has completed the Final Draft of the A revision of Test Method2.6.25andprovidedittothe7-11TestMethodsSubcommitteefor comments and suggested changes. The group will also continue workontheBrevisionofIPC-9691.
5-33a Conformal Coating Task GroupWednesday, February 29 • 8:00 am–10:00 am Room 5AJohn Waryold, HumiSeal Division of Chase CorporationThistaskgroupisinitiatingrevisionCoftheIPC-CC-830conformalcoatingspecificationtoaddressnewconformalcoatingmaterials.
5-33c Conformal Coating Handbook Task GroupTuesday, February 28 • 1:30 pm–5:00 pm Room 10Wednesday, February 29 • 10:15 am–12:00 pm Room 5AAmy Hagnauer, Raytheon Company; Jason Keeping, CelesticaThistaskgroupisrevisingtheIPC-HDBK-830conformalcoatinghandbook.
5-33f Potting and Encapsulation Task GroupMonday, February 27 • 8:00 am–5:00 pm Room 14ABarry Ritchie, Dow Corning CorporationThis task group will address comments received from industry review of theIPC-HDBK-850,ahandbookonpottingandencapsulationmaterials,applications and processes, in preparation for ballot.
Electronic Documentation Technology
2-40 Electronic Documentation Technology CommitteeMonday, February 27 • 1:30 pm–3:15 pm Room 15AKaren McConnell, CID, Northrop Grumman CorporationThiscommitteewillcontinuedevelopmentofIPC-2616onassemblyandIPC-2617ontesting.
Electronic Product Data Description
2-16 Product Data Description (Laminar View) Subcommittee
Monday, February 27 • 3:15 pm–5:00 pm Room 15AKaren McConnell, CID, Northrop Grumman CorporationThiscommitteewillmeettocontinueworkonrevisionAofIPC-2581, Generic Requirements for Printed Board Assembly Products Manufacturing Description Data and Transfer Methodology.
2-18 Supplier Declaration SubcommitteeMonday, February 27 • 8:00 am–12:00 pm Room 15AFriday, March 2 • 8:00 am–12:00 pm Room 7BKrista Crotty, Alberi EcoTech; Jørgen VosThissubcommitteewillreviewtheXMLschemaforallsupplierdeclarationstandardsanddiscussproposedrevisionstoIPC-1751A.
2-18b Materials Declaration Task GroupMonday, February 27 • 1:30 pm–5:00 pm Room 15BMark Frimann, Texas Instruments Inc .; Aidan Turnbull, Ph .D ., Environ UK LtdThisgroupwilldiscussenhancementstotheIPC-1752Amaterialsdeclaration standard and how to improve its widespread adoption. The group will discuss revising the standard.
2-18c Laminate Declaration Task GroupWednesday, February 29 • 1:30 pm–5:00 pm Room 15BDouglas Sober, Kaneka Texas CorporationThis group is developing a data exchange standard for laminate materials.ThestandardisexpectedtobebasedontheXMLschemainthe175xfamily.
2-18f Declaration of Shipping, Packing and Packaging Materials Task Group
Wednesday, February 29 • 1:30 pm–5:00 pm Room 7BJohn Ciba, Jr ., Brady Corporation; Lee Wilmot, TTM Technologies, Inc .ThisgrouphaspublishedIPC-1758, Declaration Requirements for Shipping, Pack & Packing Materials.
TECH
NIC
AL
PR
OG
RA
MS
40
www.IPCAPEXEXPO.org
Standards Development Meetings2-18g Declaration of Batteries and Battery Materials Task
GroupWednesday, February 29 • 8:00 am–12:00 pm Room 7BAimee Siegler, Benchmark Electronics Inc .; Kelly St . Andre, PTCThis group is in the beginning stages of developing a new IPC standard for the declaration of batteries and battery materials. The standard will facilitate the exchange of information on compliance and conformance withrequirementspertainingtobatterychemistry,weightandcategory.ThisstandardwillbebasedontheXMLschemaintheIPC-175xseriesof standards. It will not address recycling and reclamation of batteries.
2-18h Conflict Minerals Data Exchange Task GroupThursday, March 1 • 1:30 pm–5:00 pm Room 7BThis group is developing a standard for the exchange of supply chain datanecessaryforcompliancewithDodd-Frankconflictmineralsregulations. ThedatastandardwillbeapartoftheIPC-175xdeclarationfamilyandwillincorporatetheEICC/GeSItemplate.
2-18j Laboratory Report Declaration Task GroupTuesday, February 28 • 10:00 am–12:00 pm Room 7BWilliam Haas, Seagate TechnologyThis new group will work on a project that will facilitate the exchange of laboratory chemical analysis reports between supply chain members by having a standardized lab report format and method to exchange the information. Companies are being asked to provide laboratory analytic data to show compliance with the RoHS Directive and other customer requirements,suchashalogen-free.
Embedded Devices
CRANE-EC CRANE-EC (By Invitation)Tuesday, February 28 • 10:00 am–12:00 pm Room 7AJason Ferguson, NSWC CraneNAVSEACranewillshareresultsofvariousongoingprojectsorthoseinplanning.Pastprojectshaveinvolvedembeddedcomponents,lead-freeissues, and other topics. Participants will also have an opportunity to supply input for future efforts.
D-54 Embedded Devices Test Methods SubcommitteeWednesday, February 29 • 1:30 pm–3:00 pm Room 14AJason Ferguson, NSWC Crane; Jan Obrzut, Ph .D ., NISTThis subcommittee is developing test methods to address design, material and performance issues related to embedded passive devices used in printed boards. Specifically,apowerratingtestmethodforembedded resistors is nearing completion.
D-55 Embedded Devices Process Implementation Subcommittee
Tuesday, February 28 • 1:30 pm–5:00 pm Room 15ARichard Snogren, CID, Bristlecone LLC; Vern Solberg, Solberg Technical ConsultingThissubcommitteewilldiscussIPC-7092,whichdescribesthedesign and assembly challenges for implementing passive and active components in either formed or inserted methodology on a printed board.
Environment, Health & Safety (EHS)
4-30 Environment, Health & Safety Steering CommitteeTuesday, February 28 • 1:30 pm–5:00 pm Room 7BLee Wilmot, TTM Technologies, Inc .The EHS committee is responsible for promoting cleaner and safer electronics manufacturing worldwide and will discuss global legislative and regulation issues affecting the electronics industry.
4-33a Low-Halogen Guideline Task GroupSunday, February 26 • 10:00 am–6:00 pm Room 15BMark Frimann, Texas Instruments Inc .; John Sharp, TriQuint Semiconductor Inc .ThisgroupwillcontinuediscussingthedraftofIPC-4903on defininglow-halogen electronic products, and hear comments from stakeholders.
4-34b Marking, Symbols and Labels for Identification of Assemblies, Components and Devices Task Group
Monday, February 27 • 10:00 am–12:00 pm Room 15BJasbir Bath, Christopher Associates Inc .; Jack McCullen, Intel Corporation; Lee Wilmot, TTM Technologies, Inc .This combined working group of IPC and JEDEC will discuss further enhancementstoIPC/JEDECJ-STD-609A.
Fabrication Processes
4-14 Plating Processes SubcommitteeWednesday, February 29 • 10:15 am–12:00 pm Room 14AGeorge Milad, Uyemura International Corp .; Gerard O’Brien, Solderability Testing & Solutions, Inc .Thissubcommitteedevelopsguidelines,testmethodsandtechniquesfor evaluating process control parameters on electrolytic and electroless/immersionplating.ThegroupwillcontinueworkonIPC-4556andrevisionAofIPC-4552.
Flexible and Rigid-Flex Printed Boards
D-11 Flexible Circuits Design SubcommitteeWednesday, February 29 • 1:30 pm–3:00 pm Room 10William Ortloff, Sr ., Raytheon CompanyThissubcommitteeisinitiatingrevisionDoftheIPC-2223flexibleprinted board design standard.
D-12 Flexible Circuits Specifications SubcommitteeWednesday, February 29 • 10:15 am–12:00 pm Room 10Nick Koop, CID, Minco Products, Inc .ThissubcommitteeisdevelopingrevisionCoftheIPC-6013performancespecification,focusingonupdatestoHDI/microviaacceptancecriteria.
D-13 Flexible Circuits Base Materials SubcommitteeWednesday, February 29 • 3:15 pm–5:00 pm Room 10Clark Webster, ALL Flex LLCThesubcommitteehascompletedrevisionAofIPC-4204,andisnowresumingworkonrevisionAofIPC-4203.
D-15 Flexible Circuits Test Methods SubcommitteeWednesday, February 29 • 8:00 am–10:00 am Room 10Rocky Hilburn, Insulectro; Duane Mahnke, DBMahnke ConsultingThissubcommitteeprovidestestmethodsrequiredbytheothersubcommitteeswithintheD-10FlexibleCircuitsCommittee.IPC-TM–650willbeexaminedindetailforapplicabilityandneedforreplacement or revision andanytestmethodsspecifiedinnewflexiblecircuitry documents will be generated.
High Speed/High Frequency Interconnections
D-20 High Speed/High Frequency CommitteeMonday, February 27 • 10:15 am–12:00 pm Room 7AEdward Sandor, Taconic Advanced Dielectric DivisionThismeetingwilladdressgoalsofthevarioushighspeed/highfrequencysubcommitteesandtaskgroups.
41
INFO
RM
ATI
ON
that I
NSP
IRES
INN
OVA
TIO
N
D-22 High Speed/High Frequency Board Performance Subcommittee
Wednesday, February 29 • 8:00 am–10:00 am Room 9Michael Luke, CID+ ThissubcommitteeisevaluatingHDI/microviaperformancecriteriaforafuturerevisionCofIPC-6018.
D-23 High Speed/High Frequency Base Materials Subcommittee
Wednesday, February 29 • 10:15 am–12:00 pm Room 9Edward Sandor, Taconic Advanced Dielectric DivisionThisgroupisdiscussinggoalsforafutureBrevisionofIPC-4103.
D-24a TDR Test Methods Task GroupTuesday, February 28 • 10:00 am–12:00 pm Room 5ADon DeGroot, CCNiThistaskgroupisdiscussingarevisiontoIPC-TM–650,Method2.5.5.7for impedance testing of lines on printed boards.
D-24b Propagation Loss Test Method Task GroupTuesday, February 28 • 1:30 pm–3:00 pm Room 5ARichard Mellitz, Intel CorporationThistaskgroupisrevisingIPC-TM–650,Method2.5.5.12forpropagation loss, addressing the new SET2DIL methodology.
D-24c High Frequency Test Methods Task Group: Frequency-Domain Methods
Tuesday, February 28 • 3:15 pm–5:00 pm Room 5AMichael Janezic, Ph .D ., NISTThis task group monitors the needs of the microelectronics industry for highfrequencydielectrictestmethods.
Management
8-41 Technology Roadmap SubcommitteeSaturday, February 25 • 8:00 am–5:00 pm Room 15BJohn Fisher, Interconnect Technology Analysis, Inc .Thissubcommitteewillconfirmandimplementthestrategyforthe2013IPCInternationalTechnologyRoadmapexpandinguseofthenewemulator technology drivers and pairing new industry recruits with experiencedparticipantsonindividualsectionstoensurereal-worldapplicability.
CCC Committee Chairman Council (By Invitation)Sunday, February 26 • 4:30 pm–6:00 pm Room 14BPeter Bigelow, IMI Inc .All task group, subcommittee and committee chairs will provide general updates and discuss IPC technical programs.
E-20 Intellectual Property Standard CommitteeWednesday, February 29 • 3:15 pm–5:00 pm Room 8Rajesh Kumar, DDi Corp .; Michael Moisan, TTM TechnologiesThiscommitteewilldiscussdevelopmentofacertificationprogramforIPC-1071,Best Industry Practices for Intellectual Property Protection in Printed Board Manufacturing.
E-21 EMS IP SubcommitteeWednesday, February 29 • 1:30 pm–3:00 pm Room 8Ben Lee, Cisco Systems Inc .This subcommittee is developing a guideline on best practices for intellectual property protection in electronics assembly.
E-30 Conflict Minerals Due Diligence CommitteeThursday, March 1 • 8:00 am–12:00 pm Room 7BJohn Ciba Jr ., Brady Corporation; Joel Sherman, KEMET Electronics CorporationThis new committee will develop a guidance document to assist in complyingwithduediligencerequirementsforconflictminerals.
TAEC Technical Activities Executive Committee (By Invitation)
Monday, February 27 • 5:00 pm–6:30 pm Room 14BMel Parrish, STI Electronics, Inc .This committee comprises leaders of all IPC general committees and oversees IPC’s standardization efforts.
V9-34 SMEMA Statistical Subcommittee (By Invitation)Wednesday, February 29 • 7:00 am–8:00 am Room 14AKaren Moore-Watts, DEK UKThissubcommitteewilldiscussIPC’sassemblyequipmentstatisticalprogram.
V9-40b Process Consumables Statistical Subcommittee (By Invitation)
Wednesday, February 29 • 10:30 am–12:00 pm Room 12Michael Carano, OMG Electronic Chemicals, LLCThis subcommittee will discuss IPC’s process consumables statistical program.
V9-70 IPC Printed Electronics Management Council Steering Committee (By Invitation)
Monday, February 27 • 1:30 pm–5:00 pm Room 18Don Banfield, Conductive CompoundsThis new council initiates and drives an agenda of technical, managerial, andfinancialprogramsthatenhancetheefficiencyoftheinterfacebetween suppliers to the printed electronics industry and their customers.
V-EMTSC Executive Market & Technology Steering Committee (By Invitation)Tuesday, February 28 • 6:00 pm–9:00 pm Room 14ADon Schroeder, CTS CorporationThis steering committee will meet over dinner to discuss IPC’s market research programs and Executive Summit.
V-LAM Laminate Statistical CommitteeWednesday, February 29 • 3:00 pm–4:00 pm Room 5AThis meeting is open to all IPC members in the laminate industry to discuss plans for a major IPC laminate market study and the global laminate statistical program.
Packaged Electronic Components
B-10a/ Joint Meeting — Plastic Chip Carrier Cracking Task JEDEC Group and JEDEC JC-14.1Tuesday, February 28 • 8:00 am–5:00 pm Room 11BSteven Martell, Sonoscan Inc .Duringthisjointmeeting,revisioneffortsonJ-STD-020Dwillbediscussed.
TECH
NIC
AL
PR
OG
RA
MS
42
www.IPCAPEXEXPO.org
Standards Development Meetings
Printed Board Design Technology
1-10c Test Coupon and Artwork Generation Task GroupMonday, February 27 • 1:30 pm–3:00 pm Room 7BTimothy Estes, Conductor Analysis Technologies, Inc .ThisgroupmaintainstestcoupondesignsreferencedinIPC-2221andIPC-6010specifications and is evaluating the need for new coupon designs,includingCAFandmodificationstotheA/B-Rdesign.
D-31b IPC-2221/2222 Task GroupTuesday, February 28 • 1:30 pm–5:00 pm Room 7AGary Ferrari, CID+, CIT, FTG CircuitsThistaskgroupismeetingtopreparetheballotingofIPC-2221B,Generic Standard on Printed Board Design.
Printed Electronics PrintedElectronics
8-61 Printed Electronics Technology Roadmap Subcommittee
Friday, March 2 • 8:00 am–12:00 pm Room 5BDaniel Gamota, Printovate Technologies, Inc .This subcommittee will discuss the strategy for developing a printed electronics technology roadmap.
D-61 Printed Electronics Design SubcommitteeThursday, March 1 • 8:00 am–10:00 am Room 7ADaniel Gamota, Printovate Technologies, Inc .; Jie Zhang, Institute of Materials Research & Engineering (IMRE)ThesubcommitteewillfocusondevelopingadraftofIPC-2291,Design Guidelines for Printed Electronics.
D-62 Printed Electronics Base Material/Substrates Subcommittee
Thursday, March 1 • 10:00 am–12:00 pm Room 7ADaniel Gamota, Printovate Technologies, Inc .; James Williams, Polyonics, Inc .ThesubcommitteewillfocusondevelopingadraftofIPC-4921,Requirements for Printed Electronics Base Materials.
D-63 Printed Electronics Functional Materials Subcommittee
Thursday, March 1 • 1:00 pm–3:00 pm Room 7ADaniel Gamota, Printovate Technologies, Inc .; Markus Riester, maris TechConThesubcommitteewillfocusondevelopingadraftofIPC-4591,Requirements for Printed Electronics Functional Materials.
D-64 Printed Electronics Final Assembly SubcommitteeThursday, March 1 • 3:00 pm–5:00 pm Room 7ADaniel Gamota, Printovate Technologies, Inc .ThesubcommitteewillfocusondevelopingadraftofIPC-6901,Performance Requirements for Printed Electronics Assemblies.
Process Control
7-23 Assembly Process Effects Handbook SubcommitteeWednesday, February 29 • 8:00 am–12:00 pm Room 15BGreg Hurst, BAE SystemsThiscommitteeisdevelopingacompaniondocumenttothemodificationandrepairdocument,IPC-7711/7721.Thenewprocesseffectsortroubleshooting guide will have a similar focus for process effects relatedtotheassembly(IPC-9111).Thehandbookprovidesassemblyanomaly illustrations with possible cause and solution explanations.
7-24 Printed Board Process Effects Handbook Subcommittee
Tuesday, February 28 • 1:30 pm–5:00 pm Room 15BDennis Fritz, MacDermid, Inc .This subcommittee is developing a companion document to the modificationandrepairdocument,IPC-7711/7721.Thenewprocesseffects or troubleshooting guide will have a similar focus for process effectsrelatedtotheprintedboard(newdocumentIPC-9121).Basedonuser input, the new format for the handbook will provide printed board anomaly illustrations with possible cause and solution explanations and willbemorecloselytiedtoIPC-A-600acceptabilitycriteria.
Product Assurance
7-30 Product Assurance CommitteeMonday, February 27 • 8:00 am–9:00 am Room 14BMel Parrish, STI Electronics, Inc .This is a planning meeting for all task group and subcommittee leaders of the Product Assurance Committee.
7-31b IPC-A-610 Task GroupSaturday, February 25 • 8:00 am–12:00 pm Room 14BJennifer Day, CIT, U .S . Army Aviation & Missile Command; Constantino Gonzalez, MIT, ACME Training & ConsultingThistaskgroupisdevelopingrevisionFofIPC-A-610,Acceptability of Electronic Assemblies.
7-31f Wire Harness Acceptability Task GroupMonday, February 27 • 9:00 am–5:00 pm Room 14BTuesday, February 28 • 10:00 am–5:00 pm Room 14BT . John Laser, MIT, L-3 Communications; Brett Miller, USA Harness, Inc .A joint effort with the Wire Harness Manufacturers Assn., this group willbepreparingrevisionBofIPC/WHMA-A-620 for ballot.
7-31fs Space Electronic Assemblies IPC/WHMA-A-620 Addendum Task Group
Wednesday, February 29 • 8:00 am–5:00 pm Room 14BGarry McGuire, CIT, NASA Marshall Space Flight CenterThis task group is starting a space hardware addendum for revision B of IPC/WHMA-A-620.
7-31ft A-620 Technical Training Task GroupWednesday, February 29 • 1:30 pm–5:00 pm Room 15ADebbie Wade, MIT, Advanced Rework Technology-A .R .TThistaskgroupwillbeginupdatingtheIPC/WHMA-A-620trainingprogram for revision B.
7-31h IPC-HDBK-620 Handbook Task GroupThursday, March 1 • 1:30 pm–5:00 pm Room 15BRandy McNutt, Northrop Grumman Corp .; Brett Miller, USA Harness, Inc .ThistaskgroupisdevelopingahandbooktosupportusersofIPC/WHMA-A-620.
7-31j IPC-A-630 Requirements for Structural Enclosure Task Group
Wednesday, February 29 • 8:00 am–5:00 pm Room 5BEddie Hofer, Rockwell Collins; Richard Rumas, CIT, Honeywell CanadaThis group is developing a handbook for box level assembly of electronic enclosures for use in military and aerospace applications.
43
INFO
RM
ATI
ON
that I
NSP
IRES
INN
OVA
TIO
N
7-31k Wire Harness Design Task GroupThursday, March 1 • 8:00 am–12:00 pm Room 15BRobert Cooke, CIT, NASA Johnson Space CenterThis task group is developing a cable and wire harness design standard.
7-32c Electrical Continuity Testing Task GroupWednesday, February 29 • 8:00 am–10:00 am Room 11AMichael Hill, Colonial Circuits Inc .ThisgroupwilldiscussgoalsforaBrevisiontoIPC-9252andwilladdressdefaulttestvoltagesandequipmentcalibrationtolerancesforvoltage, isolation and continuity resistance.
7-34t Repair Training Technical Task GroupWednesday, February 29 • 8:00 am–12:00 pm Room 15ATeresa Rowe, CIT, AAI CorporationThis training technical task group will review comments and suggestions for updating the IPC rework and repair course.
Product Reliability
6-10c Plated-Through Via Reliability-Accelerated Test Methods Task Group
Tuesday, February 28 • 10:00 am–12:00 pm Room 5BRandy Reed, Viasystems Group, Inc .ThistaskgroupisrevisingIPC-TM–650,Method2.6.26,forDCCurrentInduced Thermal Cycling, addressing IST and CITC test procedures.
6-10d SMT Attachment Reliability Test Methods Task GroupTuesday, February 28 • 1:30 pm–3:00 pm Room 5BReza Ghaffarian, Ph .D ., Jet Propulsion LaboratoryThis group is addressing acoustic emission for detecting pad cratering in PCBbendtestwithintheIPC-9700reliabilityseries.
Rigid Printed Boards
7-31a/ Joint Meeting - IPC-A-600 and Rigid Printed BoardD-33a Performance Specifications Task GroupsSunday, February 26 • 9:00 am–4:30 pm Room 15AMark Buechner, BAE SystemsThesetaskgroupsareaddressinginitialworkingdraftsofIPC-A-600JandIPC-6012D.ThefocusofthemeetingistheadditionofcriteriaforHDI/microviatechnologyandanamendmenttoIPC-6012CthataddresseslotfrequencytestingwithnewIPCtestcoupons.
D-35 Printed Board Storage and Handling SubcommitteeMonday, February 27 • 8:00 am–10:00 am Room 7AThomas Kemp, CIT, Rockwell CollinsThissubcommitteeisreviewingcontentforafutureArevisiontoIPC-1601,Printed Board Handling and Storage Guidelines.
D-36 Printed Board Process Capability, Quality and Relative Reliability Benchmark Test Subcommittee
Monday, February 27 • 10:15 am–12:00 pm Room 7BGary Long, Intel CorporationThis group has developed a database for benchmarking printed board fabricationcapability,qualityandrelativereliability and maintains a family of process capability panel designs and standards.
Terms and Definitions
2-30 Terms and Definitions CommitteeSunday, February 26 • 8:00 am–9:00 am Room 15AMichael Green, Lockheed Martin Space Systems CompanyThiscommitteeisworkingonrevisionKoftheIPC-T-50termsanddefinitionsstandard.
Testing
7-11 Test Methods SubcommitteeTuesday, February 28 • 3:15 pm–5:00 pm Room 5BJoseph Russeau, Precision Analytical Laboratory, Inc .This subcommittee is developing a test method development outline for thecreationandvalidationofnewIPC-TM–650TestMethods.
7-12 Microsection SubcommitteeWednesday, February 29 • 1:30 pm–5:00 pm Room 9Russell Shepherd, MIT, Microtek LaboratoriesThistaskgroupisrevisingIPC-TM–650Methods2.1.1and2.1.1.2formicrosection preparation and evaluation, addressing blind and buried via structures.
UL-IAG Industry Advisory Group (IAG) for ULThursday, March 1 • 10:00 am–12:00 pm Room 5AOvidiu Munteanu, Underwriters LaboratoriesThisopenmeetingrunbyULwilladdressnontechnicaldevelopmentsrelatedtoUnderwriterLaboratoriesdocumentsUL-746E,UL-796,UL-746FandUL-796F.
Xtras
8-51 Jisso North America Council (JNAC)Sunday, February 26 • 8:00 am–3:00 pm Room 11BDennis Fritz, MacDermid, Inc .JNAC provides input to the global Jisso International Council (JIC). The JIC focuses on the Total Packaging Solution. This meeting will focus on thecompletionofprojectsidentifiedduringJIC12heldinMay2011.EffortwillalsobemadetofinalizeplansforJIC13in2012.
GR IPC Government Relations Committee Open ForumTuesday, February 28 • 11:00 am–12:00 pm Room 8Mikel Williams, DDi Corp .This meeting will provide you with an update on IPC’s efforts to protect printed circuit board designs for military products under ITAR. The latest information on conflict minerals regulation and the expected impact on your business will also be shared. After the overview, there will be an open discussion regarding future issues for the committee to address.
IPC STANDARDS — EVERYTHING YOU NEED FROM START TO FINISH
End-Product
SolderabilityJ-STD-002J-STD-003
Acceptability of Printed BoardsIPC-A-600
Qualifications for Printed BoardsIPC-6011, 6012, 6013, 6017
Base Materials for Printed BoardsIPC-4101, 4104, 4202, 4203, & 4204
Design & Land PatternsIPC-2220 series + 7351
RepairIPC-7711/21
Assembly MaterialsJ-STD-004J-STD-005
IPC-HDBK-005J-STD-006
IPC-SM-817IPC-CC-830HDBK-830
Copper FoilsIPC-4562
Requirements for SolderedElectronic Assemblies
J-STD-001
Acceptability of Electronic Assemblies
IPC-A-610
Requirements and Acceptance for Cable and Wire Harness Assemblies
IPC-A-620
Solder MaskIPC-SM-840
Stencil DesignGuidelines
IPC-7525
MORE IPC STANDARDS AVAILABLE ATwww.ipc.org/SpecTree (.pdf format)
®
Association Connecting Electronics Industries
High Speed/FrequencyIPC-2141IPC-2251
Data Transfer and Electronic Product Documentation
IPC-2581 Series, IPC-2610 Series
Marking andLabeling
J-STD-609
MaterialsDeclaration
IPC-1751IPC-1752
Surface Treatments
IPC-4552IPC-4553IPC-4554
Electrical TestIPC-9252
Test MethodsIPC-TM-650
IPC-9691
ComponentsJ-STD-020J-STD-033J-STD-075IPC-1601
BGA, CSP, HDIFlip Chip, BTC
J-STD-030IPC-7093IPC-7094IPC-7095
45
Booths400-999locatedintheSailsPavilion(UpperLevel)•Booths1000+locatedinHallsA–C(GroundLevel)
A.I. Technology, Inc. . . . . . . . . . . . . . . . . . . . . . . . . .2818•COOL-SILVER3G
AccuAssembly . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1112•EssegiIntelligentStockSystem
ACE Production Technologies . . . . . . . . . . . . . . . .1636•KISS-205SelectiveSolderingSystem
Advanced Electronic Technology HK Limited . .2115•10layersRigidFlexboard•2layersflexboardwithstiffener•24layersRigidboard•10layerrigidboardwithpluggedvias•1layeraluminiumboard•20layershighTGboard•2layersTelfonboard•Singlesidecarbonrigidboard•1layerflexibleboardwith3Msticker•6LayersRogersRigidBoard
Advanced Mechatronics Solutions, Inc. . . . . . . . . 819•TCM45A•ECO99C
AIM . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .2804•NC259SolderPaste
AIR-VAC Engineering Company . . . . . . . . . . . . . .1529•ONYX500-E
Akrometrix . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 502•AXP
ALT Dynachem . . . . . . . . . . . . . . . . . . . . . . . . . . . . .2152•AutomaticVacuumlaminationline
Aqueous Technologies. . . . . . . . . . . . . . . . . . . . . .3029•TridentXLD•Zero-IonG3•StencilWasher•TridentHighYieldAutomatic Defluxing and Cleanliness Testing Systems
ASC International . . . . . . . . . . . . . . . . . . . . . . . . . . .2529•AV862-AOI/SPI
Ash Technologies Ltd. . . . . . . . . . . . . . . . . . . . . . . . 716•InspexHD
Assembléon America . . . . . . . . . . . . . . . . . . . . . . .1407•iFlex
Aster Technologies . . . . . . . . . . . . . . . . . . . . . . . . .3414•TestwayExpress
ASYS Group Americas Inc. . . . . . . . . . . . . . . . . . . .3035•XACT4SCREENPRINTER
BPM Microsystems . . . . . . . . . . . . . . . . . . . . . . . . .3702•3800•2800
Brock Electronics . . . . . . . . . . . . . . . . . . . . . . . . . . .3741•Z-Check100PasteInspection
BTU International, Inc. . . . . . . . . . . . . . . . . . . . . . . .3409•HEFluxManagementforthePYRAMAXTM Solder Reflow Oven
Caltex Scientific . . . . . . . . . . . . . . . . . . . . . . . . . . . .2905•SPI-3000•CX-3000
Christopher Associates, Inc. . . . . . . . . . . . . . . . . . .2801•MAGNUSHDTREND
Cincinnati Sub-Zero . . . . . . . . . . . . . . . . . . . . . . . . .3018•CSZnowOffersHALT&HASSTestChambers
Circuit Automation, Inc. . . . . . . . . . . . . . . . . . . . . . . . 810•DP-VDM
Circuit Foil Luxembourg . . . . . . . . . . . . . . . . . . . . .1807•BF-TZA•BF-HFZ•BF-HFI-LP2•DTH-TZA
Circuits Assembly . . . . . . . . . . . . . . . . . . . . . . . . . . . . 434•TheCIRCUITSASSEMBLYDirectoryofEMSCompanies
Coatema Coating Machinery GmbH . . . . . . . . . . . 418•Smartcoater
Cobar Solder Products Inc. . . . . . . . . . . . . . . . . . . .1709•CobarOT2SolderPaste
Cogiscan Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1232•LabelScan•NewProductFlowController(PFC+)
Count On Tools . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1436•StripFeederTrays•LEDNozzleSeries
Crystal Mark, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . .3416•ConformalCoatingRemovalWorkCell
CyberOptics Corporation. . . . . . . . . . . . . . . . . . . . .2429•QX100
Data I/O Corporation . . . . . . . . . . . . . . . . . . . . . . .3744•RoadRunner3•FactoryIntegrationSoftware
DIS Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .2244•DirectOpticalRegistrationSystem
DMI . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1332•PCBassemblylinealignmenttool•ParallelGaugeTool
Easy Braid Co. . . . . . . . . . . . . . . . . . . . . . . . . . . . . .3443•EB-5000S
ECD . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .2721•SuperM.O.L.E.®Gold2ThermalProfiler
Electra Polymers Ltd. . . . . . . . . . . . . . . . . . . . . . . . .2049•EMP110DIRECTIMAGESOLDERMASK•EMP110SUPERWHITELEDSOLDERMASK
EPTAC Corporation . . . . . . . . . . . . . . . . . . . . . . . . .2547New West Coast Training Partners!
ESSEMTEC USA . . . . . . . . . . . . . . . . . . . . . . . . . . . .1617•Fino•Cobra8C•Paraquda4C
Excellon Automation . . . . . . . . . . . . . . . . . . . . . . . .2121•Model#136L
Fancort Industries, Inc. . . . . . . . . . . . . . . . . . . . . . .1146•PCBDepanelingRouter
Finetech (parent co. of Martin) . . . . . . . . . . . . . . .3020•Expert10.6IVmodelwithcellphone/smallboardconfiguration
Fisnar Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .3400•F5200NUNITOPDispensingRobot
FLEXcon . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 420•THERMLfilm® HT™ for printed circuit board labeling•BarrierFilmsforElectronicsDisplays
Fuji America Corporation . . . . . . . . . . . . . . . . . . . .3228•AIMEX•IH3
Gardien Services USA Inc. . . . . . . . . . . . . . . . . . . . . 813•QualityAssuranceServices
GE Measurement & Control . . . . . . . . . . . . . . . . . . . 829•phoenixx|aminer
Global PCB Marketplace . . . . . . . . . . . . . . . . . . . . . . Bin•www.purchasepcb.com
Global SMT & Packaging . . . . . . . . . . . . . . . . . . . . . 507•GlobalLEDs/OLEDsMagazine
GOEPEL Electronics . . . . . . . . . . . . . . . . . . . . . . . . .2450•SCANFLEXSFX-TAP16/G•OptiConTHT-Line E
XH
IBIT
OR
S
New Products Listings
EX
HIB
ITO
RS
46
www.IPCAPEXEXPO.org
New Product ListingsHIROX-USA, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . .3406•KH-8700•MXG-2500REZ
Huntron Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 619•AccessDH•AccessandAccess2Probers
Indium Corporation . . . . . . . . . . . . . . . . . . . . . . . . .3415•Indium8.9SolderPastes
Inovaxe Corporation . . . . . . . . . . . . . . . . . . . . . . . .2847•InoKit
IPC-Association Connecting Electronics . . . . . . . . 635 Industries•IPC-7525BStencil Design Guidelines •IPC-T-50J,Terms and Definitions for Interconnecting and Packaging Electronic Circuits •IPC-9202,Material & Process Test Protocol for Assessing Electrochemical Performance •UpdatetoDVD-24C/HandlinginElectronicsAssembly•IPC-2223C, Sectional Design Standard for Flexible Printed Boards•IPC-6018B,Qualification and Performance Specification for High Frequency (Microwave) Printed Boards•IPC/JEDEC-9707,SphericalBendTestMethodforCharacterizationofBoardLevelInterconnects•IPC-4103A,SpecificationsforBaseMaterialsforHighSpeed/HighFrequencyApplications•DVD-111C,Video Training on Advanced Hand Soldering Techniques •IPC-9850A,Surface Mount Placement Equipment Characterization • J-STD-033C, Handling, Packing, Shipping and Use of Moisture/Reflow and/or Process Sensitive Components • IPC/JEDEC-9704A, Printed Circuit Assembly Stain Gage Test Guideline • IPC Wage Rate & Salary Study for the North American EMS Industry 2010-2011
ITC Intercircuit . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .2001•VFS100SelectivePluggingMachine
JTech Solutions Inc. . . . . . . . . . . . . . . . . . . . . . . . . .1148•MixedFlowingGasTestSystem
KEYENCE Corporation . . . . . . . . . . . . . . . . . . . . . . . . 518•VK-X2003DLaserScanningMicroscope•VW-9000High-speedMicroscope•DigitalMicroscope-VHX-1000
KM USA LLC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1138•PiFlux•SMCrimp1000
Koh Young Technology, Inc. . . . . . . . . . . . . . . . . .1401•Zenith
Lackwerke Peters GmbH + Co KG . . . . . . . . . . . . . 720•ELPEGUARD®SL1307FLZ/2conformalcoatingfamily•ConformalcoatingsELPEGUARD®SL1397,whiteandELPEGUARD®SL1347,black•ELPEGUARD®TWIN-CURE®thickfilmlacquersDSL1600E-FLZ
LPKF Laser & Electronics. . . . . . . . . . . . . . . . . . . .2335•MicroLine1120P•LPKFZelFlexProtect-ReusableSMTStencilFrame
Magenta Systems . . . . . . . . . . . . . . . . . . . . . . . . . .3001•NewALeaderALD700AOIMachine•NewExmoreVS-500IIVaporPhase
Malcomtech International. . . . . . . . . . . . . . . . . . . .2518•PC-10AViscometer•MalcomSolderPasteMixer•MALCOMSWB-2WETTINGBALANCETESTER•MalcomRDT-250Tabletopreflowoven•MalcomSRS-2ReflowSimulator
MET Associates . . . . . . . . . . . . . . . . . . . . . . . . . . . .2423•Nano-ProTek
Microscan Systems Inc. . . . . . . . . . . . . . . . . . . . . .2707•VisionMINISmartCamera
MicroScreen, LLC . . . . . . . . . . . . . . . . . . . . . . . . . . .3315•MicroWeldStencils
Microtek Labs . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1800•CounterfeitComponentInspection
mta automation inc. . . . . . . . . . . . . . . . . . . . . . . . . .3016•BR300BottomsideSolderingRobot
Nihon Superior Co., Ltd. . . . . . . . . . . . . . . . . . . . . .3044•SN100C(551CT)Flux-coredWire
Nikon Metrology, Inc. . . . . . . . . . . . . . . . . . . . . . . .3615•X-rayProducts•NexivVMA•ShuttlePix•BenchtopNeoScope
Nordson DAGE . . . . . . . . . . . . . . . . . . . . . . . . . . . . .3208•X-Plane™
Nordson YESTECH . . . . . . . . . . . . . . . . . . . . . . . . . .3209•FXSLAOI
North Star Imaging, Inc. . . . . . . . . . . . . . . . . . . . . . .3342•X253DX-rayComputedTomographySystem
OMG Electronic Chemicals, LLC . . . . . . . . . . . . . . .2251•UltraGuard4600•OMNiGuard•GlicoatSMDF3
Orpro Vision . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .3449•Insite-B
PDR . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 514•XT5Professional•XT2EntryLevelReworkStation
Pemtron Technology . . . . . . . . . . . . . . . . . . . . . . . .1321•TROI2200•TROI5700
Pentagon EMS . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1120•ComplexMechanicalAssemblies
Pillarhouse USA Inc. . . . . . . . . . . . . . . . . . . . . . . . .3001•Jade-Dualsolderbath•JadePro/DuplexSeries•QuickChangeWarmingStation
Polar Instruments, Inc. . . . . . . . . . . . . . . . . . . . . . . .2214•SpeedflexHDI
Precision Placement Machines . . . . . . . . . . . . . . .1221•Quad4000C(w/WindowsXP)Pick&Place•PPMCutTapeFeederforQuadPick&Place•WindowsXPUpgradefortheQuadC-Series•Quad/Tyco8x2mm0201&0402Feeder•PCBDepaneling:SmartRouterSingulation•PCBSingulation:WandPress
PROMATION, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . .1228•TT-400SolderingRobot•EACHandAssemblyStation
PVA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .2451•PVAInspectionOption•DPCCFluidDeliverySystemforConformalCoating•VPX100VolumetricPump
Qualitek International, Inc. . . . . . . . . . . . . . . . . . . .2820•DSP825HFNo-CleanSolderPasteLeadFree,HalogenFreeFormulation
Quasys AG . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1315•JTF2JEDECTrayStacker•JTF3RandomAccessFeeder
Quik-Tool, LLC . . . . . . . . . . . . . . . . . . . . . . . . . . . . .3335•Z-Max
RC Precision Engineering Sdn Bhd . . . . . . . . . . . . 620•ServoPress
RNS International, Inc. . . . . . . . . . . . . . . . . . . . . . . . . 715•LEDDigitalAnalyzer•HighFrequency-RFProbes
ScanCAD International, Inc. . . . . . . . . . . . . . . . . . .2422•ScanINSPECTBGA
Scienscope International . . . . . . . . . . . . . . . . . . . .1537•Xspection6000•Xscope1800
SEHO North America, Inc. . . . . . . . . . . . . . . . . . . . .3521•AOISystemtobeembeddedinaSelectiveSolderingMachine
47
Semblant . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .2151•SPF-SemblantPlasmaFinish•SPFProVIA
Semco Packaging & Applications Systems . . .2945•Semco® Solder Paste Jars
Shenzhen Kunqi Xinhua Technology Co., Ltd. .2917•Fountainwavesolderingmachine
Siemens PLM Software. . . . . . . . . . . . . . . . . . . . . .1108•UnicamTestExpertv9.2•UnicamFXv9.2•MJSLMult-JobSetupandRecipeOptimization•MESforElectronicsIndustry(Mechatronics)
SmtXtra LTD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1104•ContractElectronicsManufacturingServices•SMTMachinerental•Machineservicing
Sono-Tek Corporation . . . . . . . . . . . . . . . . . . . . . . .3700•SonoFluxServoWSUltrasonicSprayFluxingSystem
SPEA America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1429•4060FlyingProbeTester•4030FlyingProbeTester
Taiwan Union Technology Corporation . . . . . . . .1906•TU-872LK•TU-872SLK•TU-862HF•TU-322
TAMURA H.A./EUNIL H.A. . . . . . . . . . . . . . . . . . . . . . 630•EunilCoatingMaster
Technic Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .2236•TechnicENAT5600
Test Research USA, Inc. . . . . . . . . . . . . . . . . . . . . .1441•TR5001InlineICT
TopLine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1301•eWLP-EmbeddedDie•DaisyChainSiliconDie•QFPLeadStraighteningTool•SolderableSMTSpacers•WLPCSP0.3mmand0.4mmPITCH
Total Parts Plus . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 814•ComplianceManagementModule•IPC-1752AGenerator
Totech Super Dry . . . . . . . . . . . . . . . . . . . . . . . . . . . . 506•Oxidation-freeDryingandStorageofMSDs
Transition Automation Inc. . . . . . . . . . . . . . . . . . . .2703•PrinTEKIMP-1818
Unicomp Technology USA . . . . . . . . . . . . . . . . . . . . 801•UT-R600C•UT-900B•AX-8200HR•SC-P2StencilCleaner
Universal Instruments Corporation . . . . . . . . . . . .2737•GenesisSeries2,GX-37D
V-TEK, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1307•I3SMDIn-TapeInspectionStation
Vi TECHNOLOGY . . . . . . . . . . . . . . . . . . . . . . . . . . . .2749•2KSPECTRO•5KSPECTRO
Vision Engineering . . . . . . . . . . . . . . . . . . . . . . . . .3735•KestrelElite•Swift/SwiftDuo•MASCOT
ViTrox Technologies Sdn Bhd . . . . . . . . . . . . . . . .1351•V810In-Line3DAutomatedX-RayInspectionSystem(AXI)
Wise srl . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .2100•Clevestar
YJ Link America, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . 807•YJLINK-ScreenPrinter(AXP-Series)•YJLINK-LASERMARKINGMACHINE(ALMC-Series)•YJLINK-CONVEYOR(ACC-Series)
Member
®
49
Booths400-999locatedintheSailsPavilion(UpperLevel)•Booths1000+locatedinHallsA–C(GroundLevel)
Adhesives 3MElectronicSolutionsDivision. . . . . . . . . . . . . . . . . . . . . . . . 3709A.I. Technology, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2818AIM. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2804Alltemated Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3305ApexylEnterprisesLtd./JiuJiangFlexCo.,Ltd. . . . . . . . . . . . . . 2202Christopher Associates, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2801Conductive Compounds Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 421ELANTAS PDG, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2545ERSA North America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1101FLEXcon . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 420Henkel Electronic Materials LLC . . . . . . . . . . . . . . . . . . . . . . . . 2711Heraeus Materials Technology . . . . . . . . . . . . . . . . . . . . . . . . . 3444Hisco. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2011Indium Corporation. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3415Insulectro . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2037INVENTECPerformanceChemicals . . . . . . . . . . . . . . . . . . . . . . 2611MidAmericaTaping&Reel . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1129Nordson EFD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3300SemcoPackaging&ApplicationsSystems . . . . . . . . . . . . . . . . 2945Shin-EtsuSiliconesofAmerica,Inc. . . . . . . . . . . . . . . . . . . . . . . 611Smart Sonic Stencil Cleaning Systems . . . . . . . . . . . . . . . . . . . 1320SMTS LTD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3050Tapco Circuit Supply. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2209WorldEquipmentSourceOwnedBy:R-1Source,Inc. . . . . . . . 1414Zymet . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 521
Analytical/Laboratory Equipment & Supplies Akrometrix . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 502CaltexScientific . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2905Creative Electron . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 828Easy Braid Co. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3443EquipmentTechnologies,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2303FEASA. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3705Fischer Technology, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1703HIROX-USA,Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3406KEYENCECorporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 518MetrohmUSA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2108Microtek Labs. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1800Nikon Metrology, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3615OEM Press Systems, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2107Oxford Instruments. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 708RNS International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 715Specialty Coating Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2635YXLON . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2629ZESTRON . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3621
Artwork Generation/Phototooling C. A. Picard Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1921Dow Electronic Materials . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1837EastmanKodakCompany. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1801Exopack Advanced Coatings . . . . . . . . . . . . . . . . . . . . . . . . . . . 2323HitachiViaMechanics(USA),Inc. . . . . . . . . . . . . . . . . . . . . . . . 2241KuperTechnologies . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1907Orbotech. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1829ScanCAD International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2422Tapco Circuit Supply. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2209UcamcoUSA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2110
Assembly Equipment: Chip Placement AIR-VACEngineeringCompany . . . . . . . . . . . . . . . . . . . . . . . . . 1529
Alpha 1 Technologies. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1317Amistar Automation, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1601ASM Assembly Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1111AssembléonAmerica . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1407Besi North America, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3706CCI . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2903Count On Tools . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1436DDM Novastar, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2551ESSEMTECUSA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1617Europlacer North America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3015Finetech (parent co. of Martin) . . . . . . . . . . . . . . . . . . . . . . . . . 3020Fuji America Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3228Hitachi High Technologies America, Inc. . . . . . . . . . . . . . . . . . . 2440Hover-Davis,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2737IBESMTEquipment . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2717JMW Enterprises . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2901JOT Automation Ltd. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3351Juki Automation Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1137Manncorp . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2907Mirae Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1609MYDATA automation Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3429Panasonic Factory Solutions Company of America . . . . . . . . . . 2829PDR. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 514Pentagon EMS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1120Precision Placement Machines . . . . . . . . . . . . . . . . . . . . . . . . . 1221Production Solutions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1400Q Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3002Qualectron Systems Corporation . . . . . . . . . . . . . . . . . . . . . . . . 2412Quik-Tool,LLC. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3335Samsung/Dynatech . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1629ScanCAD International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2422SMTHybridPackaging2012 . . . . . . . . . . . . . . . . . . . . . . . . . . . 3743SMTS LTD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3050TopLine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1301Toshi Technology Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3729UniversalInstrumentsCorporation . . . . . . . . . . . . . . . . . . . . . . 2737V-TEK,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1307VirtualIndustries,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 628WorldEquipmentSourceOwnedBy:R-1Source,Inc. . . . . . . . 1414Yamaha Motor IM America, Inc. . . . . . . . . . . . . . . . . . . . . . . . . 1747
Assembly Equipment: Component Insertion Alpha 1 Technologies. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1317Amistar Automation, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1601Ascentec Engineering . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 500ASM Assembly Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1111AssembléonAmerica . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1407Chad Industries . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2520Conveyor Technologies of Sanford, NC, Inc. . . . . . . . . . . . . . . . 1421Count On Tools . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1436DDM Novastar, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2551ESSEMTECUSA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1617FKNSystek . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2919Hitachi High Technologies America, Inc. . . . . . . . . . . . . . . . . . . 2440IBESMTEquipment . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2717JMW Enterprises . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2901JOT Automation Ltd. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3351Juki Automation Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1137KMUSALLC. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1138Manncorp . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2907MYDATA automation Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3429
EX
HIB
ITO
RS
Index of Exhibitors by Product Category
EX
HIB
ITO
RS
50
www.IPCAPEXEXPO.org
Index of Exhibitors by Product CategoryPanasonic Factory Solutions Company of America . . . . . . . . . . 2829Pentagon EMS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1120Precision Placement Machines . . . . . . . . . . . . . . . . . . . . . . . . . 1221Production Solutions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1400Qualectron Systems Corporation . . . . . . . . . . . . . . . . . . . . . . . . 2412RC Precision Engineering Sdn Bhd. . . . . . . . . . . . . . . . . . . . . . . . 620ScanCAD International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2422SMTS LTD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3050Stone Mountain Tool . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 536TopLine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1301Toshi Technology Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3729UniversalInstrumentsCorporation . . . . . . . . . . . . . . . . . . . . . . 2737V-TEK,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1307VirtualIndustries,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 628WorldEquipmentSourceOwnedBy:R-1Source,Inc. . . . . . . . 1414
Assembly Equipment: Feeding Systems-Bulk AccuAssembly . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1112Alpha 1 Technologies. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1317ASM Assembly Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1111AssembléonAmerica . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1407Chad Industries . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2520Europlacer North America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3015Hitachi High Technologies America, Inc. . . . . . . . . . . . . . . . . . . 2440IBESMTEquipment . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2717Juki Automation Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1137Precision Placement Machines . . . . . . . . . . . . . . . . . . . . . . . . . 1221Qualectron Systems Corporation . . . . . . . . . . . . . . . . . . . . . . . . 2412Quasys AG . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1315RC Precision Engineering Sdn Bhd. . . . . . . . . . . . . . . . . . . . . . . . 620Schleuniger, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1132TopLine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1301Toshi Technology Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3729UniversalInstrumentsCorporation . . . . . . . . . . . . . . . . . . . . . . 2737V-TEK,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1307WorldEquipmentSourceOwnedBy:R-1Source,Inc. . . . . . . . 1414
Assembly Equipment: Fine-Pitch Placement AIR-VACEngineeringCompany . . . . . . . . . . . . . . . . . . . . . . . . . 1529Alpha 1 Technologies. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1317Amistar Automation, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1601ASM Assembly Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1111AssembléonAmerica . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1407Besi North America, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3706CaltexScientific . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2905Chad Industries . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2520Count On Tools . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1436DDM Novastar, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2551ESSEMTECUSA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1617Europlacer North America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3015Finetech (parent co. of Martin) . . . . . . . . . . . . . . . . . . . . . . . . . 3020Fuji America Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3228Hitachi High Technologies America, Inc. . . . . . . . . . . . . . . . . . . 2440Hover-Davis,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2737IBESMTEquipment . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2717JMW Enterprises . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2901Juki Automation Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1137Magenta Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3001Manncorp . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2907Mirae Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1609MYDATA automation Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3429
Panasonic Factory Solutions Company of America . . . . . . . . . . 2829Precision Placement Machines . . . . . . . . . . . . . . . . . . . . . . . . . 1221Production Solutions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1400Q Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3002Qualectron Systems Corporation . . . . . . . . . . . . . . . . . . . . . . . . 2412Quik-Tool,LLC. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3335Samsung/Dynatech . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1629ScanCAD International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2422Smart Sonic Stencil Cleaning Systems . . . . . . . . . . . . . . . . . . . 1320SMTS LTD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3050TopLine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1301Toshi Technology Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3729UniversalInstrumentsCorporation . . . . . . . . . . . . . . . . . . . . . . 2737V-TEK,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1307WorldEquipmentSourceOwnedBy:R-1Source,Inc. . . . . . . . 1414Yamaha Motor IM America, Inc. . . . . . . . . . . . . . . . . . . . . . . . . 1747
Assembly Equipment: Flip-Chip Technology AIR-VACEngineeringCompany . . . . . . . . . . . . . . . . . . . . . . . . . 1529ASM Assembly Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1111AssembléonAmerica . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1407Besi North America, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3706DDM Novastar, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2551ESSEMTECUSA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1617Finetech (parent co. of Martin) . . . . . . . . . . . . . . . . . . . . . . . . . 3020Fuji America Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3228Heller Industries. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3218Hitachi High Technologies America, Inc. . . . . . . . . . . . . . . . . . . 2440Hover-Davis,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2737Juki Automation Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1137MYDATA automation Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3429NordsonASYMTEK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3200Panasonic Factory Solutions Company of America . . . . . . . . . . 2829Precision Placement Machines . . . . . . . . . . . . . . . . . . . . . . . . . 1221PVA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2451Qualectron Systems Corporation . . . . . . . . . . . . . . . . . . . . . . . . 2412RC Precision Engineering Sdn Bhd. . . . . . . . . . . . . . . . . . . . . . . . 620Samsung/Dynatech . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1629ScanCAD International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2422Smart Sonic Stencil Cleaning Systems . . . . . . . . . . . . . . . . . . . 1320SMTS LTD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3050TopLine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1301Toshi Technology Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3729Transition Automation Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2703UniversalInstrumentsCorporation . . . . . . . . . . . . . . . . . . . . . . 2737Yamaha Motor IM America, Inc. . . . . . . . . . . . . . . . . . . . . . . . . 1747
Assembly Equipment: Multifunctional Placement AIR-VACEngineeringCompany . . . . . . . . . . . . . . . . . . . . . . . . . 1529Alpha 1 Technologies. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1317Amistar Automation, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1601ASM Assembly Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1111AssembléonAmerica . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1407Besi North America, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3706Chad Industries . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2520Conveyor Technologies of Sanford, NC, Inc. . . . . . . . . . . . . . . . 1421Count On Tools . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1436DDM Novastar, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2551ESSEMTECUSA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1617Europlacer North America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3015Finetech (parent co. of Martin) . . . . . . . . . . . . . . . . . . . . . . . . . 3020
51
INFO
RM
ATI
ON
that I
NSP
IRES
INN
OVA
TIO
N
Booths400-999locatedintheSailsPavilion(UpperLevel)•Booths1000+locatedinHallsA–C(GroundLevel)
Fuji America Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3228Hitachi High Technologies America, Inc. . . . . . . . . . . . . . . . . . . 2440Hover-Davis,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2737IBESMTEquipment . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2717JMW Enterprises . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2901Juki Automation Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1137Manncorp . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2907Mirae Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1609MYDATA automation Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3429Panasonic Factory Solutions Company of America . . . . . . . . . . 2829Precision Placement Machines . . . . . . . . . . . . . . . . . . . . . . . . . 1221Production Solutions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1400Q Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3002Qualectron Systems Corporation . . . . . . . . . . . . . . . . . . . . . . . . 2412Quik-Tool,LLC. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3335RC Precision Engineering Sdn Bhd. . . . . . . . . . . . . . . . . . . . . . . . 620Samsung/Dynatech . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1629ScanCAD International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2422SMTS LTD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3050TopLine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1301Toshi Technology Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3729UniversalInstrumentsCorporation . . . . . . . . . . . . . . . . . . . . . . 2737V-TEK,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1307Yamaha Motor IM America, Inc. . . . . . . . . . . . . . . . . . . . . . . . . 1747
Assembly Equipment: Odd Form AIR-VACEngineeringCompany . . . . . . . . . . . . . . . . . . . . . . . . . 1529Alpha 1 Technologies. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1317Amistar Automation, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1601ASM Assembly Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1111AssembléonAmerica . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1407Cencorp Americas LLC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1329Chad Industries . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2520Conveyor Technologies of Sanford, NC, Inc. . . . . . . . . . . . . . . . 1421Count On Tools . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1436DDM Novastar, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2551ESSEMTECUSA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1617Europlacer North America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3015Fuji America Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3228GPD Global, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2535Hitachi High Technologies America, Inc. . . . . . . . . . . . . . . . . . . 2440IBESMTEquipment . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2717JOT Automation Ltd. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3351Juki Automation Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1137Magenta Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3001Manncorp . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2907MidAmericaTaping&Reel . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1129Mirae Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1609MYDATA automation Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3429Panasonic Factory Solutions Company of America . . . . . . . . . . 2829Precision Placement Machines . . . . . . . . . . . . . . . . . . . . . . . . . 1221Production Solutions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1400PROMATION, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1228Samsung/Dynatech . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1629ScanCAD International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2422SMTS LTD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3050Stone Mountain Tool . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 536TopLine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1301Toshi Technology Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3729UniversalInstrumentsCorporation . . . . . . . . . . . . . . . . . . . . . . 2737V-TEK,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1307
Yamaha Motor IM America, Inc. . . . . . . . . . . . . . . . . . . . . . . . . 1747
Associations/Societies & Government Agencies China Printed Circuit Association (CPCA) . . . . . . . . . . . . . . . . . . 741EIPC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 739HongKongPrintedCircuitAssociation(HKPCA) . . . . . . . . . . . . . 735IPC-AssociationConnectingElectronicsIndustries . . . . . . . . . . . 635Taiwan Printed Circuit Association (TPCA) . . . . . . . . . . . . . . . . . 737
Ball Placement Systems & Equipment AIR-VACEngineeringCompany . . . . . . . . . . . . . . . . . . . . . . . . . 1529DEKInternational . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2600Europlacer North America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3015HEPCO, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2644Hitachi High Technologies America, Inc. . . . . . . . . . . . . . . . . . . 2440IBESMTEquipment . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2717LaserJob Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3404OLAMEFUSA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3746PACTECHUSA,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3715PDR. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 514Qualectron Systems Corporation . . . . . . . . . . . . . . . . . . . . . . . . 2412ScanCAD International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2422SMTS LTD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3050TopLine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1301Toshi Technology Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3729
Barcode Printers & Readers AccuAssembly . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1112ASYS Group Americas Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3035cab Technology, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2951Cencorp Americas LLC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1329Cogiscan Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1232Control Micro Systems, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2800Magenta Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3001Microscan Systems Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2707MYDATA automation Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3429Omron Inspection Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2649PillarhouseUSAInc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3001UniversalInstrumentsCorporation . . . . . . . . . . . . . . . . . . . . . . 2737WorldEquipmentSourceOwnedBy:R-1Source,Inc. . . . . . . . 1414
Board Handling Equipment (Conveyors & Depanelizers) ALT Dynachem . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2152Amistar Automation, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1601AssembléonAmerica . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1407ASYS Group Americas Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3035cab Technology, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2951CCI . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2903Cencorp Americas LLC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1329Chad Industries . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2520Control Micro Systems, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2800Conveyor Technologies of Sanford, NC, Inc. . . . . . . . . . . . . . . . 1421EquipmentTechnologies,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2303ESSEMTECUSA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1617Europlacer North America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3015Fancort Industries, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1146FKNSystek . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2919FlexLink Systems, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2445Fuji America Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3228HEPCO, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2644ITC Intercircuit . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2001
EX
HIB
ITO
RS
52
www.IPCAPEXEXPO.org
Index of Exhibitors by Product CategoryJMW Enterprises . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2901JOT Automation Ltd. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3351Magenta Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3001Mirae Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1609MYDATA automation Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3429Nutek Americas Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3421OLAMEFUSA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3746Precision Placement Machines . . . . . . . . . . . . . . . . . . . . . . . . . 1221PROMATION, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1228PVA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2451Qualectron Systems Corporation . . . . . . . . . . . . . . . . . . . . . . . . 2412Samsung/Dynatech . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1629SEHO North America, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3521Seika Machinery, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2401Simplimatic Automation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1220SMTS LTD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3050TAMURAH.A./EUNILH.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 630Tapco Circuit Supply. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2209Toshi Technology Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3729UniversalInstrumentsCorporation . . . . . . . . . . . . . . . . . . . . . . 2737WorldEquipmentSourceOwnedBy:R-1Source,Inc. . . . . . . . 1414
Box Build ACD . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1814Arc-Tronics,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 622Bliss Industries, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1402Computrol Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2851Digicom Electronics, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3717Quality Systems Integrated Corp. . . . . . . . . . . . . . . . . . . . . . . . . 706Sanmina-SCI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 629STI Electronics, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2921
Brushes EquipmentTechnologies,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2303Gordon Brush Mfg. Co., Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 1701Hisco. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2011STI Electronics, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2921Tapco Circuit Supply. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2209
Cable & Wire Harness Arc-Tronics,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 622atg-LM . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2050Chad Industries . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2520Cirris Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1136Computrol Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2851ICAPE Group . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1951MidAmericaTaping&Reel . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1129Omni Training . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 529Quality Systems Integrated Corp. . . . . . . . . . . . . . . . . . . . . . . . . 706RNS International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 715Sanmina-SCI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 629Schleuniger, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1132SMTS LTD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3050STI Electronics, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2921V-TEK,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1307
Carts/Racks & Accessories AccuAssembly . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1112Advanced Mechatronics Solutions, Inc. . . . . . . . . . . . . . . . . . . . 819Bliss Industries, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1402cab Technology, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2951CCI . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2903
Conveyor Technologies of Sanford, NC, Inc. . . . . . . . . . . . . . . . 1421Fancort Industries, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1146FKNSystek . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2919Hisco. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2011IBESMTEquipment . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2717Inovaxe Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2847Lista International . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1345NIXOFAMERICA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1721Omni Training . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 529PillarhouseUSAInc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3001RNS International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 715Sanmina-SCI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 629Seika Machinery, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2401Simplimatic Automation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1220SMTS LTD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3050Stone Mountain Tool . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 536TDI International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 820Toshi Technology Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3729
Chemical Processing A.I. Technology, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2818AtotechUSA,Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1913ELANTAS PDG, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2545Hisco. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2011Insulectro . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2037KuperTechnologies . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1907MacDermid Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2321MetrohmUSA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2108OMG Electronic Chemicals, LLC. . . . . . . . . . . . . . . . . . . . . . . . . 2251PACTECHUSA,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3715RBP Chemical Technology, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . 1900SMTHybridPackaging2012 . . . . . . . . . . . . . . . . . . . . . . . . . . . 3743Tapco Circuit Supply. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2209Wise srl . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2100WorldEquipmentSourceOwnedBy:R-1Source,Inc. . . . . . . . 1414
Cleaning Agents/Solvents 3MElectronicSolutionsDivision. . . . . . . . . . . . . . . . . . . . . . . . 3709A.I. Technology, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2818AIM. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2804Air Products . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1707Alpha-CooksonElectronics . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3045AqueousTechnologies . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3029AtotechUSA,Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1913Christopher Associates, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2801Cobar Solder Products Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1709DEKInternational . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2600Dow Electronic Materials . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1837Hisco. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2011HumiSeal, Chase Electronic Coatings . . . . . . . . . . . . . . . . . . . . 1813Insulectro . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2037INVENTECPerformanceChemicals . . . . . . . . . . . . . . . . . . . . . . 2611JNJ Industries . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3742KyzenCorporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3242MacDermid Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2321MicroCare Corporation. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 601Qualitek International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2820RBP Chemical Technology, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . 1900Seika Machinery, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2401Smart Sonic Stencil Cleaning Systems . . . . . . . . . . . . . . . . . . . 1320Stellar Technical Products . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 523STI Electronics, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2921
EX
HIB
ITO
RS
54
www.IPCAPEXEXPO.org
Index of Exhibitors by Product CategoryTapco Circuit Supply. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2209UnicompTechnologyUSA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 801UyemuraInternationalCorporation . . . . . . . . . . . . . . . . . . . . . . 1901WorldEquipmentSourceOwnedBy:R-1Source,Inc. . . . . . . . 1414ZESTRON . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3621
Cleaning Equipment/Systems 3MElectronicSolutionsDivision. . . . . . . . . . . . . . . . . . . . . . . . 3709Advanced Mechatronics Solutions, Inc. . . . . . . . . . . . . . . . . . . . 819Advanced West . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2329AqueousTechnologies . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3029Ascentech-GEN3 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 617AtotechUSA,Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1913Austin American Technology Corporation . . . . . . . . . . . . . . . . . 1328CHEMCUTCorporation. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1819Christopher Associates, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2801Crystal Mark, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3416Easy Braid Co. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3443EquipmentTechnologies,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2303Gordon Brush Mfg. Co., Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 1701GSC. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1715IBESMTEquipment . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2717Integrated Process Systems. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2018JMW Enterprises . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2901JNJ Industries . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3742KyzenCorporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3242MacDermid Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2321Magenta Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3001Malcomtech International . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2518MicroCare Corporation. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 601NIXOFAMERICA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1721PDQ Precision Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 712Plasma Etch, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2040Qualectron Systems Corporation . . . . . . . . . . . . . . . . . . . . . . . . 2412SchmidSystemsInc.USA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2029Seika Machinery, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2401Smart Sonic Stencil Cleaning Systems . . . . . . . . . . . . . . . . . . . 1320SMTHybridPackaging2012 . . . . . . . . . . . . . . . . . . . . . . . . . . . 3743SMTS LTD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3050Speedline Technologies, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . 3248Stoelting. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2418Tapco Circuit Supply. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2209Technic Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2236Technical Devices Company. . . . . . . . . . . . . . . . . . . . . . . . . . . . 3723Toshi Technology Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3729Wise srl . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2100WorldEquipmentSourceOwnedBy:R-1Source,Inc. . . . . . . . 1414ZESTRON . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3621
Coating Equipment/Systems Advanced West . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2329all4-PCB(NorthAmerica)Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2235Ascentec Engineering . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 500Burkle North America, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2201Circuit Automation, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 810Coatema Coating Machinery GmbH . . . . . . . . . . . . . . . . . . . . . . 418Conveyor Technologies of Sanford, NC, Inc. . . . . . . . . . . . . . . . 1421EquipmentTechnologies,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2303ESSEMTECUSA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1617Fisnar Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3400IBESMTEquipment . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2717
Integrated Process Systems. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2018ITC Intercircuit . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2001KuperTechnologies . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1907MacDermid Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2321NordsonASYMTEK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3200Novagard Solutions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 428Para Tech Coating, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3703Pentagon EMS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1120PillarhouseUSAInc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3001PVA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2451Quality Systems Integrated Corp. . . . . . . . . . . . . . . . . . . . . . . . . 706ScanCAD International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2422Seika Machinery, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2401Semblant . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2151SMTHybridPackaging2012 . . . . . . . . . . . . . . . . . . . . . . . . . . . 3743SMT North America, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2641SMTS LTD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3050Sono-TekCorporation. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3700Specialty Coating Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2635TAMURAH.A./EUNILH.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 630Toshi Technology Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3729UNICOTE-HalcoLLC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2319WorldEquipmentSourceOwnedBy:R-1Source,Inc. . . . . . . . 1414
Coatings (Conformal etc.) Advanced Mechatronics Solutions, Inc. . . . . . . . . . . . . . . . . . . . 819Christopher Associates, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2801Conductive Compounds Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 421Conveyor Technologies of Sanford, NC, Inc. . . . . . . . . . . . . . . . 1421Crystal Mark, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3416ELANTAS PDG, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2545Exopack Advanced Coatings . . . . . . . . . . . . . . . . . . . . . . . . . . . 2323Gordon Brush Mfg. Co., Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 1701Henkel Electronic Materials LLC . . . . . . . . . . . . . . . . . . . . . . . . 2711HumiSeal, Chase Electronic Coatings . . . . . . . . . . . . . . . . . . . . 1813Insulectro . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2037INVENTECPerformanceChemicals . . . . . . . . . . . . . . . . . . . . . . 2611LackwerkePetersGmbH+CoKG . . . . . . . . . . . . . . . . . . . . . . . . 720Magenta Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3001Novagard Solutions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 428Para Tech Coating, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3703PillarhouseUSAInc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3001PVA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2451Quality Systems Integrated Corp. . . . . . . . . . . . . . . . . . . . . . . . . 706Semblant . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2151Shin-EtsuSiliconesofAmerica,Inc. . . . . . . . . . . . . . . . . . . . . . . 611SMT North America, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2641Specialty Coating Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2635Toshi Technology Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3729WorldEquipmentSourceOwnedBy:R-1Source,Inc. . . . . . . . 1414Zymet . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 521
Component Packaging Products Fancort Industries, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1146ProEx Device Programming . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3408RC Precision Engineering Sdn Bhd. . . . . . . . . . . . . . . . . . . . . . . . 620Sanmina-SCI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 629SMTHybridPackaging2012 . . . . . . . . . . . . . . . . . . . . . . . . . . . 3743TopLine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1301
55
INFO
RM
ATI
ON
that I
NSP
IRES
INN
OVA
TIO
N
Component Preparation 3MElectronicSolutionsDivision. . . . . . . . . . . . . . . . . . . . . . . . 3709ACE Production Technologies . . . . . . . . . . . . . . . . . . . . . . . . . . 1636Alltemated Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3305Count On Tools . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1436DataI/OCorporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3744Fancort Industries, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1146FKNSystek . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2919GPD Global, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2535HEPCO, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2644Hitachi High Technologies America, Inc. . . . . . . . . . . . . . . . . . . 2440MacDermid Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2321Manncorp . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2907MidAmericaTaping&Reel . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1129OLAMEFUSA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3746Pentagon EMS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1120ProEx Device Programming . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3408Sanmina-SCI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 629ScanCAD International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2422Seika Machinery, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2401Tintronics Industries. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 528Totech Super Dry . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 506V-TEK,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1307WAGO Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3721
Components Hisco. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2011ICAPE Group . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1951Magenta Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3001Omni Training . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 529Quality Systems Integrated Corp. . . . . . . . . . . . . . . . . . . . . . . . . 706RNS International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 715SMTHybridPackaging2012 . . . . . . . . . . . . . . . . . . . . . . . . . . . 3743TopLine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1301UL(UnderwritersLaboratories) . . . . . . . . . . . . . . . . . . . . . . . . . . 607WAGO Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3721
Connectors/Fasteners & Hardware Advanced Mechatronics Solutions, Inc. . . . . . . . . . . . . . . . . . . . 819atg-LM . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2050FKNSystek . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2919Hisco. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2011ICAPE Group . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1951Interconnect Systems, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 401MacDermid Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2321NIXOFAMERICA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1721QA Technology Company, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2822Quality Systems Integrated Corp. . . . . . . . . . . . . . . . . . . . . . . . . 706RNS International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 715WAGO Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3721
Consulting Services Acculogic Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3321Air Products . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1707Akrometrix . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 502Amtech-AdvancedSMTSolderProducts . . . . . . . . . . . . . . . . 2434ApexylEnterprisesLtd./JiuJiangFlexCo.,Ltd. . . . . . . . . . . . . . 2202ASM Assembly Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1111AssembléonAmerica . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1407Blackfox Training Institute, LLC . . . . . . . . . . . . . . . . . . . . . . . . . 3000Bliss Industries, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1402Custer Consulting Group . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2009
DDM Novastar, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2551Digicom Electronics, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3717Divsys International, LLC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 520EPTAC Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2547EquipmentTechnologies,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2303Europlacer North America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3015Inovaxe Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2847INVENTECPerformanceChemicals . . . . . . . . . . . . . . . . . . . . . . 2611IPC-2581Consortium . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 713JTAG Technologies. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3307KuperTechnologies . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1907Magenta Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3001Malcomtech International . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2518NPL Process Defect Clinic . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 533Nutek Americas Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3421Omni Training . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 529Panasonic Factory Solutions Company of America . . . . . . . . . . 2829PCQR2-APartnershipbetweenCAT&IPC . . . . . . . . . . . . . . . . 1941Quality Systems Integrated Corp. . . . . . . . . . . . . . . . . . . . . . . . . 706SMTS LTD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3050STI Electronics, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2921Total Parts Plus. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 814UNICOTE-HalcoLLC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2319YXLON . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2629
Curing Equipment & Systems Advanced West . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2329all4-PCB(NorthAmerica)Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2235Alpha 1 Technologies. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1317BTUInternational,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3409Christopher Associates, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2801Circuit Automation, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 810Coatema Coating Machinery GmbH . . . . . . . . . . . . . . . . . . . . . . 418Conveyor Technologies of Sanford, NC, Inc. . . . . . . . . . . . . . . . 1421EquipmentTechnologies,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2303ERSA North America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1101Heller Industries. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3218ITC Intercircuit . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2001JMW Enterprises . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2901Magenta Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3001NordsonASYMTEK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3200PVA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2451SMT North America, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2641Specialty Coating Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2635Toshi Technology Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3729
Design Entry PCB Planet (India) Limited . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2310Polar Instruments, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2214Sanmina-SCI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 629
Design Services: PCB Libraries and Models Aster Technologies. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3414DDM Novastar, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2551IPC-2581Consortium . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 713Magenta Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3001Sanmina-SCI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 629TopLine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1301
Design Services: PCB Tools Acculogic Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3321ACD . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1814
57
INFO
RM
ATI
ON
that I
NSP
IRES
INN
OVA
TIO
N
AllFlexFlexibleCircuits&Heaters . . . . . . . . . . . . . . . . . . . . . . 1233ApexylEnterprisesLtd./JiuJiangFlexCo.,Ltd. . . . . . . . . . . . . . 2202Aster Technologies. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3414AT&SAmericasLLC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2229DDM Novastar, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2551FKNSystek . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2919IPC-2581Consortium . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 713JTAG Technologies. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3307Sanmina-SCI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 629ScanCAD International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2422XACTPCB . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1912
Design Services: Systems Advanced Mechatronics Solutions, Inc. . . . . . . . . . . . . . . . . . . . 819DDM Novastar, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2551Digicom Electronics, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3717Interconnect Systems, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 401Microtek Labs. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1800PCB Planet (India) Limited . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2310Pentagon EMS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1120Plasma Etch, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2040Sanmina-SCI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 629ScanCAD International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2422UniversalInstrumentsCorporation . . . . . . . . . . . . . . . . . . . . . . 2737XACTPCB . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1912
Dicing Equipment Control Micro Systems, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2800Seika Machinery, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2401
Die Bonding Equipment AIR-VACEngineeringCompany . . . . . . . . . . . . . . . . . . . . . . . . . 1529ApexylEnterprisesLtd./JiuJiangFlexCo.,Ltd. . . . . . . . . . . . . . 2202Besi North America, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3706Finetech (parent co. of Martin) . . . . . . . . . . . . . . . . . . . . . . . . . 3020GPD Global, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2535Hitachi High Technologies America, Inc. . . . . . . . . . . . . . . . . . . 2440Nordson DAGE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3208PACTECHUSA,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3715Panasonic Factory Solutions Company of America . . . . . . . . . . 2829Plasma Etch, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2040PVA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2451SMTHybridPackaging2012 . . . . . . . . . . . . . . . . . . . . . . . . . . . 3743TopLine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1301WorldEquipmentSourceOwnedBy:R-1Source,Inc. . . . . . . . 1414
Dispensing Equipment AIR-VACEngineeringCompany . . . . . . . . . . . . . . . . . . . . . . . . . 1529Amistar Automation, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1601ASC International. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2529Chad Industries . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2520Conveyor Technologies of Sanford, NC, Inc. . . . . . . . . . . . . . . . 1421DDM Novastar, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2551ESSEMTECUSA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1617Fisnar Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3400Fuji America Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3228GPD Global, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2535IBESMTEquipment . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2717JMW Enterprises . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2901Juki Automation Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1137KuperTechnologies . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1907Magenta Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3001
Manncorp . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2907MetrohmUSA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2108mta automation inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3016MYDATA automation Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3429NordsonASYMTEK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3200Nordson EFD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3300OKInternational . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1641PillarhouseUSAInc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3001Precision Placement Machines . . . . . . . . . . . . . . . . . . . . . . . . . 1221Production Solutions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1400PVA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2451Quik-Tool,LLC. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3335RBP Chemical Technology, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . 1900ScanCAD International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2422Scheugenpflug, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 609SemcoPackaging&ApplicationsSystems . . . . . . . . . . . . . . . . 2945SMTHybridPackaging2012 . . . . . . . . . . . . . . . . . . . . . . . . . . . 3743SMTS LTD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3050Sono-TekCorporation. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3700Specialty Coating Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2635Speedline Technologies, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . 3248Toshi Technology Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3729Transition Automation Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2703WorldEquipmentSourceOwnedBy:R-1Source,Inc. . . . . . . . 1414
Distributor/Manufacturers Representative all4-PCB(NorthAmerica)Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2235Amistar Automation, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1601ApexylEnterprisesLtd./JiuJiangFlexCo.,Ltd. . . . . . . . . . . . . . 2202Brock Electronics . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3741Christopher Associates, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2801Count On Tools . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1436Easy Braid Co. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3443Hisco. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2011HitachiViaMechanics(USA),Inc. . . . . . . . . . . . . . . . . . . . . . . . 2241ICAPE Group . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1951Insulectro . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2037LPKFLaser&Electronics . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2335Magenta Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3001Malcomtech International . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2518MicroCare Corporation. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 601MidAmericaTaping&Reel . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1129NIXOFAMERICA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1721Nujay Technologies Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1816RBP Chemical Technology, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . 1900RNS International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 715Samsung/Dynatech . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1629Seika Machinery, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2401ShengyiTechnologyCo.,Ltd/ParamountLaminates . . . . . . . . . 1806SMTS LTD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3050Spindle Dynamics LLC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2112STI Electronics, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2921Tapco Circuit Supply. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2209V-TEK,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1307
Drilling & Routing Equipment & Supplies Advanced West . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2329Burkle North America, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2201Cencorp Americas LLC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1329Conveyor Technologies of Sanford, NC, Inc. . . . . . . . . . . . . . . . 1421EquipmentTechnologies,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2303Excellon Automation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2121
EX
HIB
ITO
RS
58
www.IPCAPEXEXPO.org
Index of Exhibitors by Product CategoryFASTechnologies . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2117FKNSystek . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2919HitachiViaMechanics(USA),Inc. . . . . . . . . . . . . . . . . . . . . . . . 2241IBESMTEquipment . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2717LCOA. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2136LPKFLaser&Electronics . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2335Micron Laser Technology . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2308Orbotech. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1829Pentagon EMS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1120Posalux SA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1929Precision Placement Machines . . . . . . . . . . . . . . . . . . . . . . . . . 1221PROMATION, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1228RNS International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 715ScanCAD International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2422Seika Machinery, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2401Spindle Dynamics LLC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2112Tapco Circuit Supply. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2209Toshi Technology Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3729
Dryers/Drying Systems AccuAssembly . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1112Advanced West . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2329all4-PCB(NorthAmerica)Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2235AqueousTechnologies . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3029BTUInternational,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3409CHEMCUTCorporation. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1819Circuit Automation, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 810EquipmentTechnologies,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2303Integrated Process Systems. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2018ITC Intercircuit . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2001Magenta Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3001MetrohmUSA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2108Seika Machinery, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2401Smart Sonic Stencil Cleaning Systems . . . . . . . . . . . . . . . . . . . 1320SMT North America, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2641Stoelting. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2418Tapco Circuit Supply. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2209Totech Super Dry . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 506
Electronic Manufacturing Services (EMS)/Contract Manufacturer Apollo Seiko . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2841Arc-Tronics,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 622Computrol Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2851Count On Tools . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1436Digicom Electronics, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3717IBL Technologies, LLC. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 501MacDermid Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2321Maxpcb, LLC. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1822Micron Laser Technology . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2308PCB Planet (India) Limited . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2310RC Precision Engineering Sdn Bhd. . . . . . . . . . . . . . . . . . . . . . . . 620Sanmina-SCI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 629SMTHybridPackaging2012 . . . . . . . . . . . . . . . . . . . . . . . . . . . 3743Spectrum Assembly, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 512STI Electronics, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2921TopLine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1301WAGO Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3721
Embedded Technologies AT&SAmericasLLC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2229DuPont Electronic Technologies. . . . . . . . . . . . . . . . . . . . . . . . . 2313
Microscan Systems Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2707Oak Mitsui Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2200Sanmina-SCI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 629STI Electronics, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2921Ticer Technologies . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2022TopLine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1301
Encapsulation Equipment 3MElectronicSolutionsDivision. . . . . . . . . . . . . . . . . . . . . . . . 3709GPD Global, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2535Heller Industries. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3218KuperTechnologies . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1907Magenta Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3001NordsonASYMTEK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3200Novagard Solutions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 428Plasma Etch, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2040PVA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2451
Enclosures Pentagon EMS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1120PillarhouseUSAInc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3001RNS International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 715Sanmina-SCI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 629TDI International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 820WAGO Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3721
Environmental & Waste Treatment/Management ADS Gold Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1919AqueousTechnologies . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3029CHEMCUTCorporation. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1819Dow Electronic Materials . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1837EquipmentTechnologies,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2303MetrohmUSA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2108RBP Chemical Technology, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . 1900
EOS/ESD Handling Products & Services 3MElectronicSolutionsDivision. . . . . . . . . . . . . . . . . . . . . . . . 3709Advanced Mechatronics Solutions, Inc. . . . . . . . . . . . . . . . . . . . 819CCI . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2903Crystal Mark, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3416Fancort Industries, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1146FKNSystek . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2919MidAmericaTaping&Reel . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1129ML System Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1128Omni Training . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 529Seika Machinery, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2401STI Electronics, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2921TDI International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 820V-TEK,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1307
Equipment Lease/Refurbish/& Resale Advanced West . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2329Agilent Technologies, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2817Alpha 1 Technologies. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1317ASC International. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2529ASM Assembly Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1111AssembléonAmerica . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1407AtotechUSA,Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1913Conveyor Technologies of Sanford, NC, Inc. . . . . . . . . . . . . . . . 1421Easy Braid Co. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3443EquipmentTechnologies,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2303ESSEMTECUSA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1617
EX
HIB
ITO
RS
60
www.IPCAPEXEXPO.org
Index of Exhibitors by Product CategoryEuroplacer North America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3015IBESMTEquipment . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2717JMW Enterprises . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2901MYDATA automation Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3429OEM Press Systems, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2107OrproVision . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3449Samsung/Dynatech . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1629Spindle Dynamics LLC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2112TEAM A.T.E. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1123Toshi Technology Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3729UNICOTE-HalcoLLC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2319WorldEquipmentSourceOwnedBy:R-1Source,Inc. . . . . . . . 1414YXLON . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2629
Flexible Circuits A.I. Technology, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2818AdvancedElectronicTechnologyHKLimited. . . . . . . . . . . . . . . 2115AllFlexFlexibleCircuits&Heaters . . . . . . . . . . . . . . . . . . . . . . 1233ApexylEnterprisesLtd./JiuJiangFlexCo.,Ltd. . . . . . . . . . . . . . 2202Arc-Tronics,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 622AT&SAmericasLLC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2229Computrol Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2851Conductive Compounds Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 421DMI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1332DuPont Electronic Technologies. . . . . . . . . . . . . . . . . . . . . . . . . 2313FCT Assembly. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 612ICAPE Group . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1951Interconnect Systems, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 401Magenta Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3001Micron Laser Technology . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2308Microtek Labs. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1800Nujay Technologies Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1816Plasma Etch, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2040Sanmina-SCI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 629Saturn Electronics Corporation . . . . . . . . . . . . . . . . . . . . . . . . . 3006SMTHybridPackaging2012 . . . . . . . . . . . . . . . . . . . . . . . . . . . 3743STI Electronics, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2921Tapco Circuit Supply. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2209
Flip Chip Bonding Equipment AIR-VACEngineeringCompany . . . . . . . . . . . . . . . . . . . . . . . . . 1529Besi North America, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3706Finetech (parent co. of Martin) . . . . . . . . . . . . . . . . . . . . . . . . . 3020Hesse&Knipps . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3345Hitachi High Technologies America, Inc. . . . . . . . . . . . . . . . . . . 2440NordsonASYMTEK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3200Panasonic Factory Solutions Company of America . . . . . . . . . . 2829PVA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2451SMTHybridPackaging2012 . . . . . . . . . . . . . . . . . . . . . . . . . . . 3743
Flux AIM. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2804Christopher Associates, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2801Cobar Solder Products Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1709ERSA North America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1101FCT Assembly. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 612Henkel Electronic Materials LLC . . . . . . . . . . . . . . . . . . . . . . . . 2711Heraeus Materials Technology . . . . . . . . . . . . . . . . . . . . . . . . . 3444Indium Corporation. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3415INVENTECPerformanceChemicals . . . . . . . . . . . . . . . . . . . . . . 2611Nihon Superior Co., Ltd.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3044
P.KayMetal,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3301Qualitek International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2820Quality Systems Integrated Corp. . . . . . . . . . . . . . . . . . . . . . . . . 706RBP Chemical Technology, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . 1900SHENMAO Technology, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2946Sono-TekCorporation. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3700Stellar Technical Products . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 523STI Electronics, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2921
Foils & Laminates Airtech International, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2301all4-PCB(NorthAmerica)Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2235ApexylEnterprisesLtd./JiuJiangFlexCo.,Ltd. . . . . . . . . . . . . . 2202Arlon Technology Enabling Innovation. . . . . . . . . . . . . . . . . . . . 2044Circuit Foil Luxembourg . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1807DuPont Electronic Technologies. . . . . . . . . . . . . . . . . . . . . . . . . 2313Exopack Advanced Coatings . . . . . . . . . . . . . . . . . . . . . . . . . . . 2323Hisco. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2011Insulectro . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2037Isola Group . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2019LCOA. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2136Oak Mitsui Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2200Ohmega Technologies Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1802Park Electrochemical Corp. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2221Rogers Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2101Sanmina-SCI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 629ShengyiTechnologyCo.,Ltd/ParamountLaminates . . . . . . . . . 1806TaiwanUnionTechnologyCorporation . . . . . . . . . . . . . . . . . . . 1906Tapco Circuit Supply. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2209Ticer Technologies . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2022
Fume Extraction Systems AIR-VACEngineeringCompany . . . . . . . . . . . . . . . . . . . . . . . . . 1529Apollo Seiko . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2841Count On Tools . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1436Easy Braid Co. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3443EquipmentTechnologies,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2303ERSA North America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1101MetrohmUSA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2108mta automation inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3016OKInternational . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1641Stellar Technical Products . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 523STI Electronics, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2921
Gas: Atmosphere Systems Air Products . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1707AmeriVacS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2216Heller Industries. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3218
Gas: Specialty Gases Air Products . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1707
Hand Tools AIR-VACEngineeringCompany . . . . . . . . . . . . . . . . . . . . . . . . . 1529Ascentec Engineering . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 500Aven Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3707Count On Tools . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1436ERSA North America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1101FocalSpot, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3009Gordon Brush Mfg. Co., Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 1701Hisco. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2011OLAMEFUSA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3746
61
INFO
RM
ATI
ON
that I
NSP
IRES
INN
OVA
TIO
N
Booths400-999locatedintheSailsPavilion(UpperLevel)•Booths1000+locatedinHallsA–C(GroundLevel)
Omni Training . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 529Schleuniger, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1132Stellar Technical Products . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 523STI Electronics, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2921Stone Mountain Tool . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 536TDI International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 820TopLine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1301WorldEquipmentSourceOwnedBy:R-1Source,Inc. . . . . . . . 1414
Ink/Thick Films & Equipment ApexylEnterprisesLtd./JiuJiangFlexCo.,Ltd. . . . . . . . . . . . . . 2202ASC International. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2529DuPont Electronic Technologies. . . . . . . . . . . . . . . . . . . . . . . . . 2313Electra Polymers Ltd. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2049EquipmentTechnologies,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2303Hisco. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2011Insulectro . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2037Integrated Process Systems. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2018KuperTechnologies . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1907LackwerkePetersGmbH+CoKG . . . . . . . . . . . . . . . . . . . . . . . . 720MicroCraft . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2129ScanCAD International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2422Tapco Circuit Supply. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2209Technic Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2236Vistana . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 429
Labeling Systems 3MElectronicSolutionsDivision. . . . . . . . . . . . . . . . . . . . . . . . 3709Amistar Automation, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1601ASYS Group Americas Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3035cab Technology, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2951Cencorp Americas LLC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1329Cogiscan Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1232Control Micro Systems, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2800Conveyor Technologies of Sanford, NC, Inc. . . . . . . . . . . . . . . . 1421FLEXcon . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 420FlexLink Systems, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2445Hover-Davis,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2737NIXOFAMERICA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1721Nutek Americas Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3421PROMATION, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1228Schleuniger, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1132Simplimatic Automation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1220TAMURAH.A./EUNILH.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 630WorldEquipmentSourceOwnedBy:R-1Source,Inc. . . . . . . . 1414
Lamination Equipment & Services Advanced West . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2329Airtech International, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2301all4-PCB(NorthAmerica)Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2235ALT Dynachem . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2152ApexylEnterprisesLtd./JiuJiangFlexCo.,Ltd. . . . . . . . . . . . . . 2202Burkle North America, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2201C. A. Picard Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1921CedalEquipmentSRL. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 407Christopher Associates, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2801Coatema Coating Machinery GmbH . . . . . . . . . . . . . . . . . . . . . . 418DIS Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2244EquipmentTechnologies,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2303Insulectro . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2037OEM Press Systems, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2107
Tapco Circuit Supply. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2209TMP Inc. A Division of French . . . . . . . . . . . . . . . . . . . . . . . . . . 2114Ventec-USA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2145
Laser Systems Advanced Mechatronics Solutions, Inc. . . . . . . . . . . . . . . . . . . . 819Apollo Seiko . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2841ASC International. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2529ASYS Group Americas Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3035cab Technology, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2951Cencorp Americas LLC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1329Control Micro Systems, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2800Conveyor Technologies of Sanford, NC, Inc. . . . . . . . . . . . . . . . 1421EquipmentTechnologies,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2303Excellon Automation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2121FCT Assembly. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 612FlexLink Systems, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2445HitachiViaMechanics(USA),Inc. . . . . . . . . . . . . . . . . . . . . . . . 2241IntegratedIdeas&Technologies . . . . . . . . . . . . . . . . . . . . . . . . 2701JOT Automation Ltd. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3351KuperTechnologies . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1907LPKFLaser&Electronics . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2335Malcomtech International . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2518MET Associates . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2423Micron Laser Technology . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2308Nikon Metrology, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3615Nutek Americas Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3421Orbotech. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1829OrproVision . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3449PROMATION, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1228Simplimatic Automation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1220SMTHybridPackaging2012 . . . . . . . . . . . . . . . . . . . . . . . . . . . 3743TAMURAH.A./EUNILH.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 630
Lighting Aven Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3707CaltexScientific . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2905Hisco. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2011Microscan Systems Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2707RNS International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 715Saturn Electronics Corporation . . . . . . . . . . . . . . . . . . . . . . . . . 3006Scienscope International . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1537Stellar Technical Products . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 523STI Electronics, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2921UL(UnderwritersLaboratories) . . . . . . . . . . . . . . . . . . . . . . . . . . 607
Marking Tools & Systems Advanced Mechatronics Solutions, Inc. . . . . . . . . . . . . . . . . . . . 819ASYS Group Americas Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3035Besi North America, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3706cab Technology, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2951Cencorp Americas LLC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1329Control Micro Systems, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2800Conveyor Technologies of Sanford, NC, Inc. . . . . . . . . . . . . . . . 1421Crystal Mark, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3416DataI/OCorporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3744FlexLink Systems, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2445KEYENCECorporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 518PROMATION, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1228RNS International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 715Schleuniger, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1132
62 Index of Exhibitors by Product CategorySimplimatic Automation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1220UL(UnderwritersLaboratories) . . . . . . . . . . . . . . . . . . . . . . . . . . 607WAGO Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3721
Masking & Demasking Systems Ascentec Engineering . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 500Crystal Mark, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3416Fisnar Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3400KuperTechnologies . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1907Pentagon EMS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1120Tapco Circuit Supply. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2209
Masks & Screens for Soldering/Printing DEKInternational . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2600I Source Technical Services, Inc. . . . . . . . . . . . . . . . . . . . . . . . . 1131IntegratedIdeas&Technologies . . . . . . . . . . . . . . . . . . . . . . . . 2701MET Associates . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2423Micron Laser Technology . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2308MicroScreen, LLC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3315Pentagon EMS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1120ScanCAD International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2422Shin-EtsuSiliconesofAmerica,Inc. . . . . . . . . . . . . . . . . . . . . . . 611Transition Automation Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2703
Material Handling Equipment/Automation Systems AccuAssembly . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1112CedalEquipmentSRL. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 407DataI/OCorporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3744Fisnar Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3400Hover-Davis,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2737
OEM Press Systems, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2107OrproVision . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3449PVA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2451RC Precision Engineering Sdn Bhd. . . . . . . . . . . . . . . . . . . . . . . . 620Scheugenpflug, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 609SMTHybridPackaging2012 . . . . . . . . . . . . . . . . . . . . . . . . . . . 3743Totech Super Dry . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 506WAGO Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3721Wise srl . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2100
Materials: Chip Packaging A.I. Technology, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2818CCI . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2903DuPont Electronic Technologies. . . . . . . . . . . . . . . . . . . . . . . . . 2313Electra Polymers Ltd. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2049Henkel Electronic Materials LLC . . . . . . . . . . . . . . . . . . . . . . . . 2711Heraeus Materials Technology . . . . . . . . . . . . . . . . . . . . . . . . . 3444MidAmericaTaping&Reel . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1129Ormet Circuits, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 711Park Electrochemical Corp. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2221ProEx Device Programming . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3408Rogers Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2101Sanmina-SCI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 629Ticer Technologies . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2022TopLine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1301
Materials: Other 3MElectronicSolutionsDivision. . . . . . . . . . . . . . . . . . . . . . . . 3709A.I. Technology, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2818Airtech International, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2301Alpha-CooksonElectronics . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3045
EX
HIB
ITO
RS
European and Asian collaboration
EuroAsia semiconductor is the quarterly magazine focusing exclusively on equipment and materials for
the microelectronics production industry in Europe and Asia.
Organise your FREE subscription TODAY
www.euroasiasemiconductor.com
EAS Ad Half Horizontal.indd 1 05/01/2012 09:47
63
INFO
RM
ATI
ON
that I
NSP
IRES
INN
OVA
TIO
N
ApexylEnterprisesLtd./JiuJiangFlexCo.,Ltd. . . . . . . . . . . . . . 2202Ascentec Engineering . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 500Conductive Compounds Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 421Dow Electronic Materials . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1837DuPont Electronic Technologies. . . . . . . . . . . . . . . . . . . . . . . . . 2313ERSA North America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1101FLEXcon . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 420Hisco. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2011Indium Corporation. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3415Insulectro . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2037MidAmericaTaping&Reel . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1129Omni Training . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 529Ormet Circuits, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 711Park Electrochemical Corp. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2221Pentagon EMS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1120Rogers Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2101Sanmina-SCI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 629Senju Comtek Corp. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2616Stellar Technical Products . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 523TopLine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1301V-TEK,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1307Zymet . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 521
Media/Industry Publications ASSEMBLY Magazine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 530Circuitnet . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . SupporterCircuits Assembly. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 434Control Design . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . BinCuster Consulting Group . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2009Electronics Assembly . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . BinElectronicsIndustryUpdate . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 409Electronics Protection . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . BinElektorUS. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . BinEMCHINA.org.cn . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . SupporterEMSNow Media LLC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 912EMT Worldwide . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . SupporterEuroAsia Semiconductor . . . . . . . . . . . . . . . . . . . . . . . . . . SupporterGlobalSMT&Packaging . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 507I-Connect007 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 701IPC Outlook. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 635MEPTEC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . BinMetal Finishing . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . BinMPO/MedicalDeviceNow.com . . . . . . . . . . . . . . . . . . . . . . . . . . . BinPCB007 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 701PrintedCircuitDesign&FAB . . . . . . . . . . . . . . . . . . . . . . . . . . . . 434Printed Circuit Journal . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 838Real-TimeWith...IPC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 701SMT Magazine. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 701SMTNet . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 710U.S.Tech . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 721Wiring Harness News . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Bin
Microvias/Embedded Components AT&SAmericasLLC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2229Dow Electronic Materials . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1837Micron Laser Technology . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2308Plasma Etch, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2040Sanmina-SCI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 629Ticer Technologies . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2022TopLine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1301
Motion Control/Automation CaltexScientific . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2905Chad Industries . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2520Europlacer North America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3015FKNSystek . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2919KEYENCECorporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 518Magenta Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3001Nordson EFD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3300Omron Inspection Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2649Sanmina-SCI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 629WAGO Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3721
Package-on-Package A.I. Technology, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2818Computrol Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2851Hitachi High Technologies America, Inc. . . . . . . . . . . . . . . . . . . 2440Juki Automation Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1137Sanmina-SCI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 629SMTHybridPackaging2012 . . . . . . . . . . . . . . . . . . . . . . . . . . . 3743Zymet . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 521
Packing & Storage 3MElectronicSolutionsDivision. . . . . . . . . . . . . . . . . . . . . . . . 3709AccuAssembly . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1112Bliss Industries, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1402CCI . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2903EquipmentTechnologies,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2303Hisco. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2011Magenta Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3001MidAmericaTaping&Reel . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1129SemcoPackaging&ApplicationsSystems . . . . . . . . . . . . . . . . 2945Stellar Technical Products . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 523Tintronics Industries. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 528TopLine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1301V-TEK,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1307
Pallets & Carriers AqueousTechnologies . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3029Ascentec Engineering . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 500CCI . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2903Conveyor Technologies of Sanford, NC, Inc. . . . . . . . . . . . . . . . 1421DEKInternational . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2600DMI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1332Hover-Davis,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2737I Source Technical Services, Inc. . . . . . . . . . . . . . . . . . . . . . . . . 1131InsulFAB PCB Tooling . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2947Manncorp . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2907Pentagon EMS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1120Simplimatic Automation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1220Smart Sonic Stencil Cleaning Systems . . . . . . . . . . . . . . . . . . . 1320Stone Mountain Tool . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 536
Photoimaging Equipment Advanced West . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2329all4-PCB(NorthAmerica)Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2235Aven Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3707Burkle North America, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2201CaltexScientific . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2905Dow Electronic Materials . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1837Electra Polymers Ltd. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2049EquipmentTechnologies,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2303HIROX-USA,Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3406
European and Asian collaboration
EuroAsia semiconductor is the quarterly magazine focusing exclusively on equipment and materials for
the microelectronics production industry in Europe and Asia.
Organise your FREE subscription TODAY
www.euroasiasemiconductor.com
EAS Ad Half Horizontal.indd 1 05/01/2012 09:47
65
INFO
RM
ATI
ON
that I
NSP
IRES
INN
OVA
TIO
N
Booths400-999locatedintheSailsPavilion(UpperLevel)•Booths1000+locatedinHallsA–C(GroundLevel)
Integrated Process Systems. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2018KEYENCECorporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 518KuperTechnologies . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1907National Graphic Supply . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2215Orbotech. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1829ScanCAD International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2422SchmidSystemsInc.USA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2029Tapco Circuit Supply. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2209Technic Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2236UcamcoUSA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2110Wise srl . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2100
Photoresist Materials & Phototooling all4-PCB(NorthAmerica)Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2235Dow Electronic Materials . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1837DuPont Electronic Technologies. . . . . . . . . . . . . . . . . . . . . . . . . 2313EastmanKodakCompany. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1801Electra Polymers Ltd. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2049Exopack Advanced Coatings . . . . . . . . . . . . . . . . . . . . . . . . . . . 2323National Graphic Supply . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2215Sanmina-SCI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 629Shin-EtsuSiliconesofAmerica,Inc. . . . . . . . . . . . . . . . . . . . . . . 611Taiyo America, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2307Tapco Circuit Supply. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2209Technic Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2236
Photovoltaics/Solar A.I. Technology, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2818Advanced West . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2329Air Products . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1707all4-PCB(NorthAmerica)Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2235Alpha-CooksonElectronics . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3045Besi North America, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3706BTUInternational,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3409CedalEquipmentSRL. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 407Chad Industries . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2520CHEMCUTCorporation. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1819Christopher Associates, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2801Conductive Compounds Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 421Conveyor Technologies of Sanford, NC, Inc. . . . . . . . . . . . . . . . 1421DEKInternational . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2600Dow Electronic Materials . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1837DuPont Electronic Technologies. . . . . . . . . . . . . . . . . . . . . . . . . 2313Electra Polymers Ltd. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2049EuroAsia Semiconductor . . . . . . . . . . . . . . . . . . . . . . . . . . SupporterFisnar Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3400Henkel Electronic Materials LLC . . . . . . . . . . . . . . . . . . . . . . . . 2711Hisco. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2011Indium Corporation. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3415MacDermid Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2321MetrohmUSA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2108MicroScreen, LLC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3315mta automation inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3016NordsonASYMTEK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3200OMG Electronic Chemicals, LLC. . . . . . . . . . . . . . . . . . . . . . . . . 2251Photo Stencil . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2419PVA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2451Sanmina-SCI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 629ScanCAD International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2422SchmidSystemsInc.USA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2029SHENMAO Technology, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2946
Shin-EtsuSiliconesofAmerica,Inc. . . . . . . . . . . . . . . . . . . . . . . 611SMT North America, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2641Sono-TekCorporation. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3700UL(UnderwritersLaboratories) . . . . . . . . . . . . . . . . . . . . . . . . . . 607VJElectronix,Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3051WAGO Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3721
Plating/Wet Process: Equipment Advanced West . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2329all4-PCB(NorthAmerica)Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2235AtotechUSA,Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1913Besi North America, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3706CHEMCUTCorporation. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1819De Nora Tech, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2043Dow Electronic Materials . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1837EquipmentTechnologies,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2303Integrated Process Systems. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2018ITC Intercircuit . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2001SchmidSystemsInc.USA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2029Tapco Circuit Supply. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2209Technic Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2236UNICOTE-HalcoLLC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2319UyemuraInternationalCorporation . . . . . . . . . . . . . . . . . . . . . . 1901Wise srl . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2100
Plating/Wet Process: Supplies ADS Gold Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1919all4-PCB(NorthAmerica)Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2235AtotechUSA,Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1913Dow Electronic Materials . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1837EquipmentTechnologies,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2303Integrated Process Systems. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2018MacDermid Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2321OMG Electronic Chemicals, LLC. . . . . . . . . . . . . . . . . . . . . . . . . 2251Tapco Circuit Supply. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2209Technic Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2236UyemuraInternationalCorporation . . . . . . . . . . . . . . . . . . . . . . 1901
Printed Circuit Board (PCB) Manufacturer AdvancedElectronicTechnologyHKLimited. . . . . . . . . . . . . . . 2115AllFlexFlexibleCircuits&Heaters . . . . . . . . . . . . . . . . . . . . . . 1233ApexylEnterprisesLtd./JiuJiangFlexCo.,Ltd. . . . . . . . . . . . . . 2202Aster Technologies. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3414AT&SAmericasLLC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2229Bare Board Group. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1100DalianPacificElectronicsCo,Ltd. . . . . . . . . . . . . . . . . . . . . . . . . 437Divsys International, LLC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 520Global PCB Marketplace . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . BinICAPE Group . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1951LPKFLaser&Electronics . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2335Maxpcb, LLC. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1822Micron Laser Technology . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2308Nujay Technologies Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1816Omni Training . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 529Printed Circuit Girls and Geeks . . . . . . . . . . . . . . . . . . . . . . . . . . 623Prototron Circuits . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2250Sanmina-SCI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 629Saturn Electronics Corporation . . . . . . . . . . . . . . . . . . . . . . . . . 3006SMTHybridPackaging2012 . . . . . . . . . . . . . . . . . . . . . . . . . . . 3743UL(UnderwritersLaboratories) . . . . . . . . . . . . . . . . . . . . . . . . . . 607
EX
HIB
ITO
RS
66
www.IPCAPEXEXPO.org
Index of Exhibitors by Product Category
Printed Electronics CEMCO Ltd . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 841 Coatema Coating Machinery GmbH . . . . . . . . . . . . . . . . . . . . . . 418Conductive Compounds Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 421DEKInternational . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2600DiamondM-T,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 413DuPont Electronic Technologies. . . . . . . . . . . . . . . . . . . . . . . . . 2313FLEXCon . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 420Henkel Electronic Materials LLC . . . . . . . . . . . . . . . . . . . . . . . . 2711Heraeus Materials Technology . . . . . . . . . . . . . . . . . . . . . . . . . 3444KurokiIndustrialCo.,Ltd. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 936Metal Etch Services . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 400Ormet Circuits, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 711Sanmina-SCI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 629Speedline Technologies, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . 3248Taiyo America, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2307Vistana . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 429
Prototyping AdvancedElectronicTechnologyHKLimited. . . . . . . . . . . . . . . 2115AllFlexFlexibleCircuits&Heaters . . . . . . . . . . . . . . . . . . . . . . 1233ApexylEnterprisesLtd./JiuJiangFlexCo.,Ltd. . . . . . . . . . . . . . 2202AT&SAmericasLLC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2229Bare Board Group. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1100Computrol Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2851Count On Tools . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1436DDM Novastar, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2551Digicom Electronics, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3717Divsys International, LLC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 520ESSEMTECUSA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1617FKNSystek . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2919IntegratedIdeas&Technologies . . . . . . . . . . . . . . . . . . . . . . . . 2701LPKFLaser&Electronics . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2335Micron Laser Technology . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2308MidAmericaTaping&Reel . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1129Nujay Technologies Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1816Prototron Circuits . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2250RNS International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 715Sanmina-SCI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 629Saturn Electronics Corporation . . . . . . . . . . . . . . . . . . . . . . . . . 3006STI Electronics, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2921Texmac/TakayaInc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3403TopLine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1301
REACH/RoHS Compliance Services Blackfox Training Institute, LLC . . . . . . . . . . . . . . . . . . . . . . . . . 3000CCI . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2903Divsys International, LLC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 520HumiSeal, Chase Electronic Coatings . . . . . . . . . . . . . . . . . . . . 1813ICAPE Group . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1951INVENTECPerformanceChemicals . . . . . . . . . . . . . . . . . . . . . . 2611MidAmericaTaping&Reel . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1129Sanmina-SCI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 629Saturn Electronics Corporation . . . . . . . . . . . . . . . . . . . . . . . . . 3006Total Parts Plus. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 814UNICOTE-HalcoLLC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2319
Reclamation/Recovery Systems (Environmental) ADS Gold Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1919Alpha-CooksonElectronics . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3045Brock Electronics . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3741FCT Assembly. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 612National Graphic Supply . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2215P.KayMetal,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3301ShenzhenKunqiXinhuaTechnologyCo.,Ltd. . . . . . . . . . . . . . . 2917Sono-TekCorporation. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3700Stoelting. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2418Technic Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2236UyemuraInternationalCorporation . . . . . . . . . . . . . . . . . . . . . . 1901
Reflow Soldering Equipment (Ovens) DDM Novastar, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2551ECD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2721Finetech (parent co. of Martin) . . . . . . . . . . . . . . . . . . . . . . . . . 3020IBL Technologies, LLC. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 501Juki Automation Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1137Mirae Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1609PDR. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 514SEHO North America, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3521SMTS LTD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3050TAMURAH.A./EUNILH.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 630Toshi Technology Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3729
Repair & Rework ACE Production Technologies . . . . . . . . . . . . . . . . . . . . . . . . . . 1636AER Technologies. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 508AIR-VACEngineeringCompany . . . . . . . . . . . . . . . . . . . . . . . . . 1529Arc-Tronics,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 622Ascentec Engineering . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 500Ash Technologies Ltd. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 716CaltexScientific . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2905Christopher Associates, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2801Computrol Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2851Conveyor Technologies of Sanford, NC, Inc. . . . . . . . . . . . . . . . 1421Crystal Mark, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3416Easy Braid Co. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3443ERSA North America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1101FCT Assembly. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 612Finetech (parent co. of Martin) . . . . . . . . . . . . . . . . . . . . . . . . . 3020FocalSpot, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3009HEPCO, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2644I Source Technical Services, Inc. . . . . . . . . . . . . . . . . . . . . . . . . 1131IBL Technologies, LLC. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 501Interconnect Systems, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 401JBC Tools . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1303KyzenCorporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3242LaserJob Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3404Manncorp . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2907MET Associates . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2423Micron Laser Technology . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2308Nordson EFD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3300OKInternational . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1641Omni Training . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 529Orbotech. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1829OrproVision . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3449PACE Incorporated . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 513Pentagon EMS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1120
Don’t be fooled by a small piece of a BIGGER picture...
Anyone can claim to be good at what they do…
Know who you’re doing business with!
Advanced Chemical Company Industry leader in Precious Metal Refining for over 40 Years.See the bigger picture. Customer visits and Material witnessing is encouraged.
www.advchem.com
Visit us in
Booth #532
Pet Sitting Specialist
Daisy Daniels(401) 034-4586
EX
HIB
ITO
RS
68
www.IPCAPEXEXPO.org
Index of Exhibitors by Product CategoryPillarhouseUSAInc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3001Q Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3002Quality Systems Integrated Corp. . . . . . . . . . . . . . . . . . . . . . . . . 706Sanmina-SCI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 629ScanCAD International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2422SEHO North America, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3521Simplimatic Automation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1220SMTS LTD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3050Spindle Dynamics LLC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2112Stellar Technical Products . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 523STI Electronics, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2921Stone Mountain Tool . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 536Tintronics Industries. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 528TopLine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1301Toshi Technology Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3729UnicompTechnologyUSA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 801V-TEK,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1307VisionEngineering . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3735VJElectronix,Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3051WorldEquipmentSourceOwnedBy:R-1Source,Inc. . . . . . . . 1414YXLON . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2629ZESTRON . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3621Zymet . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 521
RFID AtotechUSA,Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1913Besi North America, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3706Cogiscan Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1232Conductive Compounds Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 421FlexLink Systems, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2445Henkel Electronic Materials LLC . . . . . . . . . . . . . . . . . . . . . . . . 2711Juki Automation Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1137Sanmina-SCI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 629Saturn Electronics Corporation . . . . . . . . . . . . . . . . . . . . . . . . . 3006
Software: CAD/CAM/CIM AccuAssembly . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1112Aegis Industrial Software . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2435ASM Assembly Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1111AssembléonAmerica . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1407Aster Technologies. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3414Cimnet Systems, a Consona ERP Solution. . . . . . . . . . . . . . . . . 2142Cogiscan Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1232FASTechnologies . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2117IPC-2581Consortium . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 713Juki Automation Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1137LPKFLaser&Electronics . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2335MachineVisionProducts,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2809MentorGraphicsCorporation(ValorDivision) . . . . . . . . . . . . . . 1435MYDATA automation Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3429Orbotech. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1829Panasonic Factory Solutions Company of America . . . . . . . . . . 2829PCBCafe . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . SupporterPolar Instruments, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2214ScanCAD International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2422Siemens PLM Software . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1108Smart Sonic Stencil Cleaning Systems . . . . . . . . . . . . . . . . . . . 1320UcamcoUSA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2110WAGO Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3721XACTPCB . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1912
Software: Data Acquisition & Systems AccuAssembly . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1112Aegis Industrial Software . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2435Akrometrix . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 502ASC International. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2529ASM Assembly Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1111AssembléonAmerica . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1407Cimnet Systems, a Consona ERP Solution. . . . . . . . . . . . . . . . . 2142Cogiscan Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1232DataI/OCorporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3744Datapaq,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2402ECD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2721FASTechnologies . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2117Integrated Process Systems. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2018KIC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2428MachineVisionProducts,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2809MentorGraphicsCorporation(ValorDivision) . . . . . . . . . . . . . . 1435Microscan Systems Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2707Nikon Metrology, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3615Panasonic Factory Solutions Company of America . . . . . . . . . . 2829ScanCAD International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2422WAGO Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3721XACTPCB . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1912
Software: Electronic Design Automation (EDA) MentorGraphicsCorporation(ValorDivision) . . . . . . . . . . . . . . 1435Polar Instruments, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2214ScanCAD International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2422
Software: MES AccuAssembly . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1112Aegis Industrial Software . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2435ASM Assembly Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1111AssembléonAmerica . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1407Cimnet Systems, a Consona ERP Solution. . . . . . . . . . . . . . . . . 2142Cogiscan Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1232MachineVisionProducts,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2809MentorGraphicsCorporation(ValorDivision) . . . . . . . . . . . . . . 1435Panasonic Factory Solutions Company of America . . . . . . . . . . 2829ScanCAD International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2422Siemens PLM Software . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1108
Software: Other AccuAssembly . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1112Aegis Industrial Software . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2435Amistar Automation, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1601Cimnet Systems, a Consona ERP Solution. . . . . . . . . . . . . . . . . 2142Cogiscan Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1232Creative Electron . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 828DataI/OCorporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3744FASTechnologies . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2117GOEPEL Electronics . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2450Inovaxe Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2847PCQR2-APartnershipbetweenCAT&IPC . . . . . . . . . . . . . . . . 1941ScanCAD International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2422Scienscope International . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1537Smart Sonic Stencil Cleaning Systems . . . . . . . . . . . . . . . . . . . 1320UcamcoUSA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2110XACTPCB . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1912
69
INFO
RM
ATI
ON
that I
NSP
IRES
INN
OVA
TIO
N
Booths400-999locatedintheSailsPavilion(UpperLevel)•Booths1000+locatedinHallsA–C(GroundLevel)
Software: Process Control AccuAssembly . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1112DataI/OCorporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3744Hesse&Knipps . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3345KIC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2428MentorGraphicsCorporation(ValorDivision) . . . . . . . . . . . . . . 1435Omron Inspection Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2649ScanCAD International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2422SEHO North America, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3521WAGO Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3721
Software: Product Data Management (PDM) Aegis Industrial Software . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2435Agilent Technologies, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2817ASM Assembly Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1111AssembléonAmerica . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1407Cimnet Systems, a Consona ERP Solution. . . . . . . . . . . . . . . . . 2142Integrated Process Systems. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2018MachineVisionProducts,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2809MentorGraphicsCorporation(ValorDivision) . . . . . . . . . . . . . . 1435Panasonic Factory Solutions Company of America . . . . . . . . . . 2829ScanCAD International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2422Tapco Circuit Supply. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2209Total Parts Plus. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 814XACTPCB . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1912
Software: Product Lifecycle Management (PLM) Cimnet Systems, a Consona ERP Solution. . . . . . . . . . . . . . . . . 2142ScanCAD International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2422Siemens PLM Software . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1108Total Parts Plus. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 814
Solder (Paste/Bar/Cream/Powder) AIM. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2804Alpha-CooksonElectronics . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3045Amtech-AdvancedSMTSolderProducts . . . . . . . . . . . . . . . . 2434CaltexScientific . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2905Christopher Associates, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2801Cobar Solder Products Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1709ERSA North America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1101FCT Assembly. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 612Henkel Electronic Materials LLC . . . . . . . . . . . . . . . . . . . . . . . . 2711Heraeus Materials Technology . . . . . . . . . . . . . . . . . . . . . . . . . 3444Hisco. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2011Indium Corporation. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3415INVENTECPerformanceChemicals . . . . . . . . . . . . . . . . . . . . . . 2611Manncorp . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2907Nihon Superior Co., Ltd.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3044Nordson EFD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3300P.KayMetal,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3301Qualitek International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2820Quality Systems Integrated Corp. . . . . . . . . . . . . . . . . . . . . . . . . 706Seika Machinery, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2401Senju Comtek Corp. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2616SHENMAO Technology, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2946SMTHybridPackaging2012 . . . . . . . . . . . . . . . . . . . . . . . . . . . 3743Stellar Technical Products . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 523STI Electronics, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2921Transition Automation Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2703WorldEquipmentSourceOwnedBy:R-1Source,Inc. . . . . . . . 1414
Solder Resist: Equipment Advanced West . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2329all4-PCB(NorthAmerica)Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2235Burkle North America, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2201CHEMCUTCorporation. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1819Circuit Automation, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 810Electra Polymers Ltd. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2049EquipmentTechnologies,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2303Hisco. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2011Integrated Process Systems. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2018KuperTechnologies . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1907MicroCraft . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2129Quality Systems Integrated Corp. . . . . . . . . . . . . . . . . . . . . . . . . 706ScanCAD International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2422SchmidSystemsInc.USA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2029Tapco Circuit Supply. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2209Technic Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2236Wise srl . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2100WorldEquipmentSourceOwnedBy:R-1Source,Inc. . . . . . . . 1414
Solder Resist: Materials Dow Electronic Materials . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1837Electra Polymers Ltd. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2049Henkel Electronic Materials LLC . . . . . . . . . . . . . . . . . . . . . . . . 2711Hisco. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2011LackwerkePetersGmbH+CoKG . . . . . . . . . . . . . . . . . . . . . . . . 720Quality Systems Integrated Corp. . . . . . . . . . . . . . . . . . . . . . . . . 706Rogers Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2101Sanmina-SCI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 629Shin-EtsuSiliconesofAmerica,Inc. . . . . . . . . . . . . . . . . . . . . . . 611Taiyo America, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2307Tapco Circuit Supply. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2209Technic Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2236WorldEquipmentSourceOwnedBy:R-1Source,Inc. . . . . . . . 1414
Solderability Test Systems ASC International. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2529CaltexScientific . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2905Christopher Associates, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2801Malcomtech International . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2518Qualectron Systems Corporation . . . . . . . . . . . . . . . . . . . . . . . . 2412Quality Systems Integrated Corp. . . . . . . . . . . . . . . . . . . . . . . . . 706RPS Automation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1444Sanmina-SCI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 629Tintronics Industries. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 528WorldEquipmentSourceOwnedBy:R-1Source,Inc. . . . . . . . 1414
Soldering Equipment: Other ACE Production Technologies . . . . . . . . . . . . . . . . . . . . . . . . . . 1636Advanced West . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2329Air Products . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1707AIR-VACEngineeringCompany . . . . . . . . . . . . . . . . . . . . . . . . . 1529Apollo Seiko . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2841AqueousTechnologies . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3029ASC International. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2529Ascentec Engineering . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 500Besi North America, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3706CaltexScientific . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2905Christopher Associates, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2801Control Micro Systems, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2800
EX
HIB
ITO
RS
70
www.IPCAPEXEXPO.org
Index of Exhibitors by Product CategoryCount On Tools . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1436DMI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1332ERSA North America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1101Fancort Industries, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1146Heller Industries. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3218Hisco. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2011IBESMTEquipment . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2717IBL Technologies, LLC. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 501Juki Automation Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1137KMUSALLC. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1138Magenta Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3001Malcomtech International . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2518Manncorp . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2907mta automation inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3016NordsonASYMTEK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3200Omni Training . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 529PACE Incorporated . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 513Pemtron Technology. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1321Pentagon EMS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1120PillarhouseUSAInc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3001PROMATION, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1228Qualitek International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2820Quality Systems Integrated Corp. . . . . . . . . . . . . . . . . . . . . . . . . 706RPS Automation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1444Sanmina-SCI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 629SEHO North America, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3521Senju Comtek Corp. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2616SMTHybridPackaging2012 . . . . . . . . . . . . . . . . . . . . . . . . . . . 3743SMT North America, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2641Stellar Technical Products . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 523TopLine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1301Toshi Technology Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3729UNICOTE-HalcoLLC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2319VJElectronix,Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3051WorldEquipmentSourceOwnedBy:R-1Source,Inc. . . . . . . . 1414
Soldering Equipment: Reflow (Ovens) DDM Novastar, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2551IBL Technologies, LLC. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 501JMW Enterprises . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2901KIC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2428LPKFLaser&Electronics . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2335Malcomtech International . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2518Manncorp . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2907NordsonASYMTEK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3200On Site Gas Systems, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2950PDR. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 514Precision Placement Machines . . . . . . . . . . . . . . . . . . . . . . . . . 1221Q Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3002Qualitek International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2820Quality Systems Integrated Corp. . . . . . . . . . . . . . . . . . . . . . . . . 706Samsung/Dynatech . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1629SEHO North America, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3521Seika Machinery, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2401Senju Comtek Corp. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2616SMT North America, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2641SMTS LTD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3050Speedline Technologies, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . 3248TAMURAH.A./EUNILH.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 630Technic Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2236Toshi Technology Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3729VitronicsSoltec . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3509
Soldering Equipment: Selective ACE Production Technologies . . . . . . . . . . . . . . . . . . . . . . . . . . 1636AIR-VACEngineeringCompany . . . . . . . . . . . . . . . . . . . . . . . . . 1529Alpha 1 Technologies. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1317Apollo Seiko . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2841Ascentec Engineering . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 500CaltexScientific . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2905Count On Tools . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1436DDM Novastar, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2551DMI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1332ERSA North America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1101Fancort Industries, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1146Hisco. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2011IBESMTEquipment . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2717JMW Enterprises . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2901Juki Automation Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1137Magenta Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3001Manncorp . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2907mta automation inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3016On Site Gas Systems, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2950Pentagon EMS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1120PillarhouseUSAInc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3001PROMATION, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1228Quality Systems Integrated Corp. . . . . . . . . . . . . . . . . . . . . . . . . 706RPS Automation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1444SEHO North America, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3521SEICAUSA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2729Seika Machinery, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2401Senju Comtek Corp. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2616SMTS LTD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3050Sono-TekCorporation. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3700Stellar Technical Products . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 523TAMURAH.A./EUNILH.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 630Toshi Technology Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3729VitronicsSoltec . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3509WorldEquipmentSourceOwnedBy:R-1Source,Inc. . . . . . . . 1414
Soldering Equipment: Wave ACE Production Technologies . . . . . . . . . . . . . . . . . . . . . . . . . . 1636Air Products . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1707Alpha 1 Technologies. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1317Ascentec Engineering . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 500CaltexScientific . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2905Count On Tools . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1436DDM Novastar, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2551DMI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1332ECD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2721ERSA North America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1101ESSEMTECUSA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1617Hisco. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2011IBESMTEquipment . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2717JMW Enterprises . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2901Juki Automation Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1137KIC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2428Magenta Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3001Manncorp . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2907On Site Gas Systems, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2950Pentagon EMS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1120PillarhouseUSAInc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3001Qualitek International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2820Quality Systems Integrated Corp. . . . . . . . . . . . . . . . . . . . . . . . . 706
Inspiring innovation
Our experts are at home everywhere in the world...
We provide you with soldering, cleaning and coatingsolutions for electronic assembly
industries throughout 26 countries.
Come and visit us on booth 2611
www.inventec.dehon.com
EX
HIB
ITO
RS
72
www.IPCAPEXEXPO.org
Index of Exhibitors by Product CategorySEHO North America, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3521Senju Comtek Corp. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2616ShenzhenKunqiXinhuaTechnologyCo.,Ltd. . . . . . . . . . . . . . . 2917SMTS LTD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3050Sono-TekCorporation. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3700Speedline Technologies, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . 3248TAMURAH.A./EUNILH.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 630Technical Devices Company. . . . . . . . . . . . . . . . . . . . . . . . . . . . 3723Toshi Technology Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3729VitronicsSoltec . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3509WorldEquipmentSourceOwnedBy:R-1Source,Inc. . . . . . . . 1414
Soldering Irons/Tips/& Stations AIR-VACEngineeringCompany . . . . . . . . . . . . . . . . . . . . . . . . . 1529Apollo Seiko . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2841Christopher Associates, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2801Count On Tools . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1436Easy Braid Co. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3443ERSA North America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1101Finetech (parent co. of Martin) . . . . . . . . . . . . . . . . . . . . . . . . . 3020Hisco. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2011JBC Tools . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1303KMUSALLC. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1138mta automation inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3016OKInternational . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1641Omni Training . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 529PACE Incorporated . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 513PROMATION, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1228Qualitek International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2820Quality Systems Integrated Corp. . . . . . . . . . . . . . . . . . . . . . . . . 706SMTS LTD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3050Stellar Technical Products . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 523STI Electronics, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2921VJElectronix,Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3051WorldEquipmentSourceOwnedBy:R-1Source,Inc. . . . . . . . 1414
Stencil: Cleaning Systems Alpha 1 Technologies. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1317AqueousTechnologies . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3029Ascentech-GEN3 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 617AssembléonAmerica . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1407ASYS Group Americas Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3035Easy Braid Co. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3443Europlacer North America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3015IBESMTEquipment . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2717KyzenCorporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3242Manncorp . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2907MET Associates . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2423Precision Placement Machines . . . . . . . . . . . . . . . . . . . . . . . . . 1221ScanCAD International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2422Seika Machinery, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2401Smart Sonic Stencil Cleaning Systems . . . . . . . . . . . . . . . . . . . 1320SMTHybridPackaging2012 . . . . . . . . . . . . . . . . . . . . . . . . . . . 3743Stoelting. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2418Toshi Technology Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3729UnicompTechnologyUSA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 801WorldEquipmentSourceOwnedBy:R-1Source,Inc. . . . . . . . 1414ZESTRON . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3621
Stencil: Printing Systems Alpha 1 Technologies. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1317Amistar Automation, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1601Ascentec Engineering . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 500AssembléonAmerica . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1407ASYS Group Americas Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3035CaltexScientific . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2905DDM Novastar, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2551DEKInternational . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2600ERSA North America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1101ESSEMTECUSA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1617Europlacer North America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3015Hitachi High Technologies America, Inc. . . . . . . . . . . . . . . . . . . 2440I Source Technical Services, Inc. . . . . . . . . . . . . . . . . . . . . . . . . 1131IBESMTEquipment . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2717LPKFLaser&Electronics . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2335Manncorp . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2907MET Associates . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2423Mirae Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1609Pentagon EMS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1120Photo Stencil . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2419Precision Placement Machines . . . . . . . . . . . . . . . . . . . . . . . . . 1221Production Solutions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1400Quik-Tool,LLC. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3335Samsung/Dynatech . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1629ScanCAD International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2422Smart Sonic Stencil Cleaning Systems . . . . . . . . . . . . . . . . . . . 1320SMTHybridPackaging2012 . . . . . . . . . . . . . . . . . . . . . . . . . . . 3743Speedline Technologies, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . 3248Toshi Technology Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3729Transition Automation Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2703WorldEquipmentSourceOwnedBy:R-1Source,Inc. . . . . . . . 1414Yamaha Motor IM America, Inc. . . . . . . . . . . . . . . . . . . . . . . . . 1747
Stencil: Supplies & Accessories Alpha-CooksonElectronics . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3045AqueousTechnologies . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3029ASYS Group Americas Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3035Conductive Compounds Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 421DEKInternational . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2600Easy Braid Co. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3443FCT Assembly. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 612I Source Technical Services, Inc. . . . . . . . . . . . . . . . . . . . . . . . . 1131IntegratedIdeas&Technologies . . . . . . . . . . . . . . . . . . . . . . . . 2701JNJ Industries . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3742KyzenCorporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3242LaserJob Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3404MET Associates . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2423MicroScreen, LLC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3315Ovation Products . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2628Photo Stencil . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2419Production Solutions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1400ScanCAD International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2422Smart Sonic Stencil Cleaning Systems . . . . . . . . . . . . . . . . . . . 1320Transition Automation Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2703WorldEquipmentSourceOwnedBy:R-1Source,Inc. . . . . . . . 1414ZESTRON . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3621
73
Surface Finishing (HASL/OSP/Other) all4-PCB(NorthAmerica)Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2235AtotechUSA,Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1913CHEMCUTCorporation. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1819Dow Electronic Materials . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1837EquipmentTechnologies,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2303Integrated Process Systems. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2018ITC Intercircuit . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2001MacDermid Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2321OMG Electronic Chemicals, LLC. . . . . . . . . . . . . . . . . . . . . . . . . 2251SchmidSystemsInc.USA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2029Semblant . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2151Technic Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2236Tintronics Industries. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 528UNICOTE-HalcoLLC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2319UyemuraInternationalCorporation . . . . . . . . . . . . . . . . . . . . . . 1901
Surface Prep all4-PCB(NorthAmerica)Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2235AtotechUSA,Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1913CHEMCUTCorporation. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1819Dow Electronic Materials . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1837EquipmentTechnologies,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2303Henkel Electronic Materials LLC . . . . . . . . . . . . . . . . . . . . . . . . 2711Integrated Process Systems. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2018INVENTECPerformanceChemicals . . . . . . . . . . . . . . . . . . . . . . 2611ITC Intercircuit . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2001
MacDermid Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2321Micron Laser Technology . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2308OMG Electronic Chemicals, LLC. . . . . . . . . . . . . . . . . . . . . . . . . 2251Plasma Etch, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2040SchmidSystemsInc.USA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2029Technic Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2236
Tape & Reel Equipment & Services 3MElectronicSolutionsDivision. . . . . . . . . . . . . . . . . . . . . . . . 3709Alltemated Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3305GPD Global, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2535MidAmericaTaping&Reel . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1129OLAMEFUSA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3746ProEx Device Programming . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3408Q Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3002TDI International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 820Tintronics Industries. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 528V-TEK,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1307
Test and Inspection: Equipment-Analog Acculogic Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3321Akrometrix . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 502Aster Technologies. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3414atg-LM . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2050CaltexScientific . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2905EquipmentTechnologies,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2303KEYENCECorporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 518MicroCraft . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2129
Mixed Flowing Gas Testing (MFG Testing) Fully Automated System
▪ Tests electronic parts and components to any worldwide standard such as ASTM B845, Battelle Class I-IV, etc.
▪ All controls for gas delivery, temperature and humidity are automated and managed by custom software.
JTech Solutions specializes in temperature and humidity control for the semiconductor manufacturing and high tech research fields. For more information, please visit us on the web at www.jtechsolutions.us.
www.jtechsolutions.us | ph: 408.425.4393 | [email protected]
EX
HIB
ITO
RS
74
www.IPCAPEXEXPO.org
Index of Exhibitors by Product CategoryQualectron Systems Corporation . . . . . . . . . . . . . . . . . . . . . . . . 2412Quality Systems Integrated Corp. . . . . . . . . . . . . . . . . . . . . . . . . 706RNS International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 715SiFO . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1404SPEA America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1429TestResearchUSA,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1441Texmac/TakayaInc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3403
Test and Inspection: Equipment-AOI/Automated AccuAssembly . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1112Acculogic Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3321Akrometrix . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 502Amistar Automation, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1601ASC International. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2529Aster Technologies. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3414Brock Electronics . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3741CaltexScientific . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2905Cencorp Americas LLC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1329Christopher Associates, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2801Conveyor Technologies of Sanford, NC, Inc. . . . . . . . . . . . . . . . 1421Creative Electron . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 828CyberOptics Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2429EquipmentTechnologies,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2303Europlacer North America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3015FocalSpot, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3009GOEPEL Electronics . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2450IBESMTEquipment . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2717KEYENCECorporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 518KohYoungTechnology,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1401LPKFLaser&Electronics . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2335MachineVisionProducts,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2809Magenta Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3001Malcomtech International . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2518MIRTEC Corp. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3637Nikon Metrology, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3615Nordson YESTECH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3209Omron Inspection Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2649Orbotech. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1829OrproVision . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3449PillarhouseUSAInc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3001Qualectron Systems Corporation . . . . . . . . . . . . . . . . . . . . . . . . 2412RNS International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 715Saki America, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3329ScanCAD International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2422SEICAUSA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2729SMTHybridPackaging2012 . . . . . . . . . . . . . . . . . . . . . . . . . . . 3743SMTS LTD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3050SPEA America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1429TEAM A.T.E. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1123TestResearchUSA,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1441Texmac/TakayaInc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3403Toshi Technology Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3729UnicompTechnologyUSA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 801V-TEK,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1307ViTECHNOLOGY . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2749ViscomInc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3629ViTroxTechnologiesSdnBhd . . . . . . . . . . . . . . . . . . . . . . . . . . . 1351WorldEquipmentSourceOwnedBy:R-1Source,Inc. . . . . . . . 1414Yamaha Motor IM America, Inc. . . . . . . . . . . . . . . . . . . . . . . . . 1747YXLON . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2629
Test and Inspection: Equipment-Boundary Scan Aster Technologies. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3414atg-LM . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2050GOEPEL Electronics . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2450JTAG Technologies. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3307Qualectron Systems Corporation . . . . . . . . . . . . . . . . . . . . . . . . 2412RNS International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 715Seika Machinery, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2401SiFO . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1404SMTHybridPackaging2012 . . . . . . . . . . . . . . . . . . . . . . . . . . . 3743SPEA America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1429TestResearchUSA,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1441Texmac/TakayaInc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3403WorldEquipmentSourceOwnedBy:R-1Source,Inc. . . . . . . . 1414XJTAG. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1121
Test and Inspection: Equipment-Digital Acculogic Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3321Ash Technologies Ltd. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 716Aster Technologies. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3414atg-LM . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2050Aven Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3707CaltexScientific . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2905Easy Braid Co. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3443EquipmentTechnologies,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2303Fischer Technology, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1703GOEPEL Electronics . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2450HIROX-USA,Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3406JTAG Technologies. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3307KEYENCECorporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 518Magenta Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3001North Star Imaging, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3342Orbotech. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1829PARMI Co., Ltd. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3543Qualectron Systems Corporation . . . . . . . . . . . . . . . . . . . . . . . . 2412RNS International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 715Seika Machinery, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2401SiFO . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1404SPEA America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1429TestResearchUSA,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1441VisionEngineering . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3735WorldEquipmentSourceOwnedBy:R-1Source,Inc. . . . . . . . 1414XJTAG. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1121
Test and Inspection: Equipment-Environmental Chambers Air Products . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1707Akrometrix . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 502CincinnatiSub-Zero . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3018Conveyor Technologies of Sanford, NC, Inc. . . . . . . . . . . . . . . . 1421EquipmentTechnologies,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2303Microtek Labs. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1800PCQR2-APartnershipbetweenCAT&IPC . . . . . . . . . . . . . . . . 1941Quality Systems Integrated Corp. . . . . . . . . . . . . . . . . . . . . . . . . 706SMTS LTD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3050WorldEquipmentSourceOwnedBy:R-1Source,Inc. . . . . . . . 1414
Test and Inspection: Equipment-Fixtures/Handlers 3MElectronicSolutionsDivision. . . . . . . . . . . . . . . . . . . . . . . . 3709Acculogic Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3321ASC International. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2529
75
INFO
RM
ATI
ON
that I
NSP
IRES
INN
OVA
TIO
N
Booths400-999locatedintheSailsPavilion(UpperLevel)•Booths1000+locatedinHallsA–C(GroundLevel)
Ascentec Engineering . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 500Aster Technologies. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3414atg-LM . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2050CheckSum LLC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2413Cirris Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1136Conveyor Technologies of Sanford, NC, Inc. . . . . . . . . . . . . . . . 1421DataI/OCorporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3744GOEPEL Electronics . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2450InsulFAB PCB Tooling . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2947Nordson DAGE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3208Pentagon EMS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1120QA Technology Company, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2822Qualectron Systems Corporation . . . . . . . . . . . . . . . . . . . . . . . . 2412Quality Systems Integrated Corp. . . . . . . . . . . . . . . . . . . . . . . . . 706QxQ, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2816RNS International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 715Seika Machinery, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2401SiFO . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1404Smart Sonic Stencil Cleaning Systems . . . . . . . . . . . . . . . . . . . 1320SPEA America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1429TestResearchUSA,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1441TopLine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1301V-TEK,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1307WorldEquipmentSourceOwnedBy:R-1Source,Inc. . . . . . . . 1414
Test and Inspection: Equipment-Functional Agilent Technologies, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2817Ascentec Engineering . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 500Aster Technologies. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3414atg-LM . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2050CheckSum LLC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2413Conveyor Technologies of Sanford, NC, Inc. . . . . . . . . . . . . . . . 1421DataI/OCorporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3744EquipmentTechnologies,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2303GOEPEL Electronics . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2450Nordson DAGE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3208Omron Inspection Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2649QA Technology Company, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2822Qualectron Systems Corporation . . . . . . . . . . . . . . . . . . . . . . . . 2412Quality Systems Integrated Corp. . . . . . . . . . . . . . . . . . . . . . . . . 706QxQ, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2816RNS International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 715SEICAUSA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2729SiFO . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1404SPEA America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1429TEAM A.T.E. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1123TestResearchUSA,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1441WorldEquipmentSourceOwnedBy:R-1Source,Inc. . . . . . . . 1414
Test and Inspection: Equipment-In-Circuit Acculogic Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3321Agilent Technologies, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2817Air Products . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1707Aster Technologies. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3414atg-LM . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2050CheckSum LLC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2413Cirris Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1136Conveyor Technologies of Sanford, NC, Inc. . . . . . . . . . . . . . . . 1421Huntron Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 619IBESMTEquipment . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2717QA Technology Company, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2822
Qualectron Systems Corporation . . . . . . . . . . . . . . . . . . . . . . . . 2412Quality Systems Integrated Corp. . . . . . . . . . . . . . . . . . . . . . . . . 706QxQ, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2816RNS International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 715SEICAUSA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2729Seika Machinery, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2401SiFO . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1404SPEA America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1429TEAM A.T.E. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1123TestResearchUSA,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1441Texmac/TakayaInc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3403Toshi Technology Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3729WorldEquipmentSourceOwnedBy:R-1Source,Inc. . . . . . . . 1414XJTAG. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1121
Test and Inspection: Equipment-Infrared Quality Systems Integrated Corp. . . . . . . . . . . . . . . . . . . . . . . . . 706RNS International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 715
Test and Inspection: Equipment-Mixed Signal Acculogic Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3321atg-LM . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2050CheckSum LLC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2413GOEPEL Electronics . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2450Huntron Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 619PCQR2-APartnershipbetweenCAT&IPC . . . . . . . . . . . . . . . . 1941Quality Systems Integrated Corp. . . . . . . . . . . . . . . . . . . . . . . . . 706RNS International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 715SiFO . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1404SPEA America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1429TEAM A.T.E. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1123
Test and Inspection: Equipment-Other Akrometrix . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 502ASC International. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2529CaltexScientific . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2905CincinnatiSub-Zero . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3018DataI/OCorporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3744Easy Braid Co. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3443Fischer Technology, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1703Huntron Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 619JTAG Technologies. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3307Magenta Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3001OLAMEFUSA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3746PARMI Co., Ltd. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3543Quality Systems Integrated Corp. . . . . . . . . . . . . . . . . . . . . . . . . 706RNS International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 715Sanmina-SCI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 629
Test and Inspection: Equipment-Package Akrometrix . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 502JTAG Technologies. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3307KohYoungTechnology,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1401MachineVisionProducts,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2809Nikon Metrology, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3615Nordson DAGE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3208Nordson YESTECH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3209Panasonic Factory Solutions Company of America . . . . . . . . . . 2829Quality Systems Integrated Corp. . . . . . . . . . . . . . . . . . . . . . . . . 706Sonoscan, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1337ViTECHNOLOGY . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2749YXLON . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2629
EX
HIB
ITO
RS
76
www.IPCAPEXEXPO.org
Index of Exhibitors by Product Category
Test and Inspection: Equipment-PXI Systems Huntron Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 619RNS International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 715
Test and Inspection: Equipment-RoHS Ascentec Engineering . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 500Creative Electron . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 828Fischer Technology, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1703HIROX-USA,Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3406Malcomtech International . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2518Oxford Instruments. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 708Quality Systems Integrated Corp. . . . . . . . . . . . . . . . . . . . . . . . . 706RNS International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 715Scienscope International . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1537UPATechnology . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3317YXLON . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2629
Test and Inspection: Equipment-Solder Paste Air Products . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1707ASC International. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2529Ascentech-GEN3 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 617Brock Electronics . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3741CaltexScientific . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2905Christopher Associates, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2801CyberOptics Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2429Easy Braid Co. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3443GOEPEL Electronics . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2450KohYoungTechnology,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1401MachineVisionProducts,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2809Magenta Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3001Malcomtech International . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2518Mirae Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1609MIRTEC Corp. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3637Nordson YESTECH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3209PARMI Co., Ltd. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3543Pemtron Technology. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1321Qualectron Systems Corporation . . . . . . . . . . . . . . . . . . . . . . . . 2412Saki America, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3329ScanCAD International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2422Seika Machinery, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2401Smart Sonic Stencil Cleaning Systems . . . . . . . . . . . . . . . . . . . 1320TestResearchUSA,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1441ViTECHNOLOGY . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2749ViscomInc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3629WorldEquipmentSourceOwnedBy:R-1Source,Inc. . . . . . . . 1414YXLON . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2629
Test and Inspection: Equipment-System Integration Acculogic Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3321ASC International. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2529CaltexScientific . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2905Cirris Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1136Conveyor Technologies of Sanford, NC, Inc. . . . . . . . . . . . . . . . 1421Easy Braid Co. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3443OLAMEFUSA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3746Omron Inspection Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2649RNS International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 715SiFO . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1404Texmac/TakayaInc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3403V-TEK,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1307XACTPCB . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1912
Test and Inspection: Equipment-Vision/Videos AccuAssembly . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1112Amistar Automation, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1601ASC International. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2529Ascentec Engineering . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 500Aven Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3707Brock Electronics . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3741C. A. Picard Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1921CaltexScientific . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2905Cencorp Americas LLC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1329Chad Industries . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2520Conveyor Technologies of Sanford, NC, Inc. . . . . . . . . . . . . . . . 1421CyberOptics Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2429EquipmentTechnologies,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2303ERSA North America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1101FocalSpot, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3009GOEPEL Electronics . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2450HIROX-USA,Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3406KEYENCECorporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 518MachineVisionProducts,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2809Malcomtech International . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2518Microscan Systems Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2707MIRTEC Corp. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3637Nordson YESTECH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3209Omron Inspection Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2649Orbotech. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1829OrproVision . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3449Qualectron Systems Corporation . . . . . . . . . . . . . . . . . . . . . . . . 2412RNS International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 715ScanCAD International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2422Scienscope International . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1537Seika Machinery, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2401Sonoscan, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1337SPEA America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1429TestResearchUSA,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1441Texmac/TakayaInc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3403ViscomInc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3629VisionEngineering . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3735
Test and Inspection: Equipment-Wire Harness Cirris Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1136KMUSALLC. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1138Quality Systems Integrated Corp. . . . . . . . . . . . . . . . . . . . . . . . . 706RNS International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 715
Test and Inspection: Equipment-X-Ray Advanced West . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2329Amistar Automation, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1601Aster Technologies. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3414Creative Electron . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 828Easy Braid Co. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3443EquipmentTechnologies,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2303Fischer Technology, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1703FocalSpot, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3009GEMeasurement&Control. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 829Glenbrook Technologies, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2650GOEPEL Electronics . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2450Hamamatsu Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3719IBESMTEquipment . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2717Microtek Labs. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1800Nikon Metrology, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3615
barcode reading and inspection
©2012 Microscan Systems, Inc.
Hi-brite spot Light
Visionscape®gige camera
Mobile HawkdpM imager
QX Hawk imager
Complete traceability solutions from handheld scanners and barcode readers to vision systems and advanced lighting.
component traceability 1d/2d symbol readingintelligent pattern Location
component inspection reading and Verification of Marked data Matrix symbols
optical character recognition and Verification
Visit Us inBooth #2707
www.microscan.com
[email protected] | 1.425.226.5700 | 800.762.1149
79
INFO
RM
ATI
ON
that I
NSP
IRES
INN
OVA
TIO
N
Booths400-999locatedintheSailsPavilion(UpperLevel)•Booths1000+locatedinHallsA–C(GroundLevel)
Nordson DAGE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3208Nordson YESTECH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3209North Star Imaging, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3342Omron Inspection Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2649Oxford Instruments. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 708PACE Incorporated . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 513Qualectron Systems Corporation . . . . . . . . . . . . . . . . . . . . . . . . 2412Saki America, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3329Scienscope International . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1537SMTHybridPackaging2012 . . . . . . . . . . . . . . . . . . . . . . . . . . . 3743SMTS LTD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3050Sonoscan, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1337TEAM A.T.E. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1123TestResearchUSA,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1441Toshi Technology Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3729UnicompTechnologyUSA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 801UPATechnology . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3317ViscomInc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3629ViTroxTechnologiesSdnBhd . . . . . . . . . . . . . . . . . . . . . . . . . . . 1351VJElectronix,Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3051WorldEquipmentSourceOwnedBy:R-1Source,Inc. . . . . . . . 1414Yamaha Motor IM America, Inc. . . . . . . . . . . . . . . . . . . . . . . . . 1747YXLON . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2629
Test and Inspection: Test Laboratory/Failure Analysis Akrometrix . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 502CaltexScientific . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2905CincinnatiSub-Zero . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3018Creative Electron . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 828Easy Braid Co. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3443GEMeasurement&Control. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 829Hamamatsu Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3719INVENTECPerformanceChemicals . . . . . . . . . . . . . . . . . . . . . . 2611KEYENCECorporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 518Nikon Metrology, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3615North Star Imaging, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3342RNS International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 715Sanmina-SCI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 629STI Electronics, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2921UL(UnderwritersLaboratories) . . . . . . . . . . . . . . . . . . . . . . . . . . 607
Test and Inspection: Testing Services Acculogic Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3321AER Technologies. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 508Agilent Technologies, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2817Air Products . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1707Akrometrix . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 502Arc-Tronics,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 622Aster Technologies. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3414CincinnatiSub-Zero . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3018FocalSpot, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3009GardienServicesUSAInc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 813GOEPEL Electronics . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2450Huntron Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 619JOT Automation Ltd. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3351JTAG Technologies. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3307Malcomtech International . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2518MicroCraft . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2129Microtek Labs. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1800
Nikon Metrology, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3615North Star Imaging, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3342PCQR2-APartnershipbetweenCAT&IPC . . . . . . . . . . . . . . . . 1941Qualectron Systems Corporation . . . . . . . . . . . . . . . . . . . . . . . . 2412Quality Systems Integrated Corp. . . . . . . . . . . . . . . . . . . . . . . . . 706QxQ, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2816Saki America, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3329Sanmina-SCI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 629ScanCAD International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2422SEICAUSA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2729SiFO . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1404Sonoscan, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1337SPEA America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1429STI Electronics, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2921TestResearchUSA,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1441Texmac/TakayaInc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3403UL(UnderwritersLaboratories) . . . . . . . . . . . . . . . . . . . . . . . . . . 607ViscomInc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3629WorldEquipmentSourceOwnedBy:R-1Source,Inc. . . . . . . . 1414XJTAG. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1121YXLON . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2629ZESTRON . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3621
Test and Inspection: Testing Software Acculogic Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3321Aegis Industrial Software . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2435Agilent Technologies, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2817Akrometrix . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 502ASC International. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2529ASM Assembly Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1111CaltexScientific . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2905Cimnet Systems, a Consona ERP Solution. . . . . . . . . . . . . . . . . 2142Creative Electron . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 828CyberOptics Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2429Datapaq,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2402ERSA North America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1101GardienServicesUSAInc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 813GOEPEL Electronics . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2450HIROX-USA,Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3406JTAG Technologies. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3307KIC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2428MachineVisionProducts,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2809Malcomtech International . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2518MentorGraphicsCorporation(ValorDivision) . . . . . . . . . . . . . . 1435MicroCraft . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2129Microtek Labs. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1800Nikon Metrology, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3615Nordson YESTECH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3209North Star Imaging, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3342Omron Inspection Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2649Orbotech. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1829PCQR2-APartnershipbetweenCAT&IPC . . . . . . . . . . . . . . . . 1941QxQ, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2816RNS International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 715Sanmina-SCI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 629ScanCAD International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2422Scienscope International . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1537SiFO . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1404SPEA America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1429UcamcoUSA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2110
EX
HIB
ITO
RS
80
www.IPCAPEXEXPO.org
Index of Exhibitors by Product CategoryViscomInc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3629XJTAG. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1121YXLON . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2629
Thermal Profiling Akrometrix . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 502Amistar Automation, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1601BTUInternational,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3409Datapaq,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2402ECD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2721ERSA North America . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1101FocalSpot, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3009Heller Industries. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3218KIC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2428Magenta Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3001Malcomtech International . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2518Manncorp . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2907PillarhouseUSAInc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3001Sanmina-SCI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 629Seika Machinery, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2401STI Electronics, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2921Tapco Circuit Supply. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2209TopLine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1301
Tooling Equipment & Supplies ApexylEnterprisesLtd./JiuJiangFlexCo.,Ltd. . . . . . . . . . . . . . 2202Ascentec Engineering . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 500Brock Electronics . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3741Burkle North America, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2201CaltexScientific . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2905Count On Tools . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1436DEKInternational . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2600DIS Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2244DMI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1332EquipmentTechnologies,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2303FKNSystek . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2919GSC. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1715Hisco. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2011InsulFAB PCB Tooling . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2947KMUSALLC. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1138Microtek Labs. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1800Novagard Solutions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 428OEM Press Systems, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2107OLAMEFUSA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3746Orbotech. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1829Ovation Products . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2628Pentagon EMS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1120Quik-Tool,LLC. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3335RNS International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 715SMTS LTD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3050Spindle Dynamics LLC . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2112Total Parts Plus. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 814WorldEquipmentSourceOwnedBy:R-1Source,Inc. . . . . . . . 1414
Training & Education AER Technologies. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 508Agilent Technologies, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2817AIM. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2804Amtech-AdvancedSMTSolderProducts . . . . . . . . . . . . . . . . 2434AssembléonAmerica . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1407AtotechUSA,Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1913
Blackfox Training Institute, LLC . . . . . . . . . . . . . . . . . . . . . . . . . 3000BTUInternational,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3409CaltexScientific . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2905Cimnet Systems, a Consona ERP Solution. . . . . . . . . . . . . . . . . 2142Coatema Coating Machinery GmbH . . . . . . . . . . . . . . . . . . . . . . 418Custer Consulting Group . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2009ECD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2721EPTAC Corporation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2547EquipmentTechnologies,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2303GOEPEL Electronics . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2450IBESMTEquipment . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2717INVENTECPerformanceChemicals . . . . . . . . . . . . . . . . . . . . . . 2611IPC-AssociationConnectingElectronicsIndustries . . . . . . . . . . . 635Magenta Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3001Malcomtech International . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2518Microtek Labs. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1800MYDATA automation Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3429North Star Imaging, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3342NPL Process Defect Clinic . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 533Omni Training . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 529PACE Incorporated . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 513Saturn Electronics Corporation . . . . . . . . . . . . . . . . . . . . . . . . . 3006ScanCAD International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2422SEHO North America, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3521Siemens PLM Software . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1108SMTHybridPackaging2012 . . . . . . . . . . . . . . . . . . . . . . . . . . . 3743SMT North America, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2641STI Electronics, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2921Technic Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2236TopLine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1301Total Parts Plus. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 814UcamcoUSA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2110WorldEquipmentSourceOwnedBy:R-1Source,Inc. . . . . . . . 1414Yamaha Motor IM America, Inc. . . . . . . . . . . . . . . . . . . . . . . . . 1747YXLON . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2629
Vacuum Sealant Equipment Airtech International, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2301AmeriVacS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2216Brock Electronics . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3741WorldEquipmentSourceOwnedBy:R-1Source,Inc. . . . . . . . 1414
Via Filling/Plugging/Tenting Advanced West . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2329all4-PCB(NorthAmerica)Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2235AtotechUSA,Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1913Christopher Associates, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2801Circuit Automation, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 810Dow Electronic Materials . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1837EquipmentTechnologies,Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . 2303ITC Intercircuit . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2001LackwerkePetersGmbH+CoKG . . . . . . . . . . . . . . . . . . . . . . . . 720LaserJob Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3404MacDermid Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2321Sanmina-SCI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 629Saturn Electronics Corporation . . . . . . . . . . . . . . . . . . . . . . . . . 3006Taiyo America, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2307
Wafer Bumping Equipment CaltexScientific . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2905Heller Industries. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3218
To subscribe or for more information visit www.intertechpira.com/plus-plastic-electronics.aspx
To subscribe or for more information visit www.intertechpira.com/plus-plastic-electronics.aspx
Subscribe for just £100/€120/$155 for the year
Stay ahead of the competition in the printed and organic electronics industryindustry
www.intertechpira.com/plus-plastic-electronics.aspx
81
Booths400-999locatedintheSailsPavilion(UpperLevel)•Booths1000+locatedinHallsA–C(GroundLevel) INFO
RM
ATI
ON
that I
NSP
IRES
INN
OVA
TIO
N
LaserJob Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3404Sanmina-SCI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 629ScanCAD International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2422WorldEquipmentSourceOwnedBy:R-1Source,Inc. . . . . . . . 1414
Wire Bonding Equipment Besi North America, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3706CaltexScientific . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2905Hesse&Knipps . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3345Sanmina-SCI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 629ScanCAD International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2422SMTHybridPackaging2012 . . . . . . . . . . . . . . . . . . . . . . . . . . . 3743TopLine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1301WorldEquipmentSourceOwnedBy:R-1Source,Inc. . . . . . . . 1414
Wire Cutting/Stripping and Wrapping Machine Tools Control Micro Systems, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2800FKNSystek . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2919Hisco. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2011KMUSALLC. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1138PillarhouseUSAInc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3001RC Precision Engineering Sdn Bhd. . . . . . . . . . . . . . . . . . . . . . . . 620Schleuniger, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1132SMTS LTD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3050Toshi Technology Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3729WorldEquipmentSourceOwnedBy:R-1Source,Inc. . . . . . . . 1414
Workstations/Ergonomics/Chairs AIR-VACEngineeringCompany . . . . . . . . . . . . . . . . . . . . . . . . . 1529ASYS Group Americas Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3035Brock Electronics . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3741Conveyor Technologies of Sanford, NC, Inc. . . . . . . . . . . . . . . . 1421Hisco. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2011IBESMTEquipment . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2717Lista International . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1345MYDATA automation Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3429Omni Training . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 529PROMATION, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1228Simplimatic Automation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1220SMTHybridPackaging2012 . . . . . . . . . . . . . . . . . . . . . . . . . . . 3743SMTS LTD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3050STI Electronics, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2921TDI International, Inc.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 820WorldEquipmentSourceOwnedBy:R-1Source,Inc. . . . . . . . 1414
EX
HIB
ITO
RS
82
www.IPCAPEXEXPO.org
Exhibitors Listing
3M Electronic Solutions Division 37096801RiverPlaceBoulevardAustin,Texas78726Phone:+1866-722-3736Web:www.3MStatic.com3MElectronicSolutionsDivisionprovidesafullrangeofpackaging,workstation and instrumentation product solutions which are designed to help electronic products manufacturers develop and maintain complete ANSI/ESDS20.20compliantstaticcontrolprograms.TheupdatedStaticControlproductcatalogfromthe3MElectronicsSolutionsDivisionfeatures140pagesofelectrostaticdischargesolutionsfromtheindustryleader.Thecatalogiscurrentlyavailableonlinefromwww.3MStatic.com.
A.I. Technology, Inc. 281870WashingtonStreetPrincetonJunction,NewJersey08550Phone:[email protected]: www.aitechnology.com RichardAmigh,Sales&MarketingManager +1609-799-9388,[email protected] Charlie Boersig, Applications Mgr. +1609-799-9388,cboersig@aitechnology.comAITisanISO9001certifiedfacilitythatmanufacturesflexible“stress-free”adhesives,films,pastesandthermalgelsandgrease.Productsareavailableinsyringes,jars,premixed&frozenorseparatedinPartA&PartBforambientstorage.Epoxiesareusedfordie-attach,lidsealing,BGA,multichipmodules, and wafer lamination. Our IMTS uses proprietary flexible thermal dielectricinsulatinglayerresultinginstressandwarp-freethermalcopper-cladlaminates.Newin2012isour“MODIFIED”-COOL-SILVER3G“non-silicone”greaseforincreasedthermalperformance. New Product
Accu-Tech Laser Processing, Inc. 2053550SouthPacificStreet,SuiteA100Vista,California92081Phone:+1760-744-6692Web: www.accutechlaser.com
AccuAssembly 11121621McEwenDrive,Unit33Whitby, Ontario L1N 9A5CanadaPhone:[email protected] Web: www.accuassembly.com Doug Derry, Sales and Marketing +1905-571-4603,[email protected] KylaEdwards,Sales +1905-571-4603,kedwards@accuassembly.comBarTectorMES-forpickandplaceproductivity,improvedquality,eliminationof wrong parts, inventory tracking, parts traceability on Fuji, Panasonic, Universal,Assembléon,etc.Systemrunsonplacement,screenprinters,reflowovensandthroughholeequipment.BarTectoreconomicalAOIequipmentforSMTandTHparts.DrStorage-Drycabinets,cabinetsforfeeder storage, baking dry cabinets, and environmental monitors for moisture sensitivedevices(msds).humitel-smarttrackingandcontrolsystemformoisturesensitivedevices(MSDs).Essegi-Intelligentstockdeliverysystems.
New Product
Acculogic Inc. 3321175RivieraDriveMarkham,ONTL3R5J6CanadaPhone:+1800-697-8378Web: www.acculogic.com Robert Steel, National Sales Manager +1770-205-0950,r.steel@acculogic.comAcculogicisaglobalsupplierofautomatictestequipmentandtestprogrammingservices.Acculogic’stestproductsincludetheFLS980-theworld’sonlydoublesidedFlyingProbewithcapacityfor22probeswith3-Djoy-stick-likemotion-alsoofferedastheFLS940singlesidedsystem,anextensivelineofIn-CircuitTestSystems,apowerfulsuiteofBoundaryScantest and programming tools. Acculogic’s test services include development servicesforAcculogictestproducts,majorin-circuittestplatforms(Teradyne/GenRad,Agilent,TRI),functionaltestandtest&ticketservices.
ACD 18141250AmericanParkwayRichardson,Texas75081Phone:[email protected]:www.ACDUSA.com W.ScottFillebrown,President/CEO +1972-664-0900,[email protected] ToddKingrey,Sr.AccountManager +1469-624-5146,[email protected] in 1984, ACD’s services comprise complete board layout services, ATEengineeringservices,DFM/DFAcapability,printedcircuitfabrication,componentprocurement,SMTandthrough-holemixedtechnologyassembly,boxbuild,rework,X-ray,flyingprobeandfunctionaltest,anddevelopment.For more information, visit the company’s Web site.
ACE Production Technologies 16363010N.FirstStreetSpokaneValley,Washington99216Phone:+1509-924-4898Web:www.ace-protech.com Alan Cable, President +1509-924-4898,[email protected] Randy Allinson, Business Development +1860-395-9384,[email protected] Soldering Solutions: Affordable selective soldering systems suitablefortin-leadandlead-freesolder.Theproductlineconsistsofadvanced solder fountain rework stations, batch mode selective soldering andadvancedin-lineselectivesolderingwithpreheatoptionsaswellasautomated fluxing capabilities. All of these flexible systems feature CAD friendlyprogramming,lead-freecompatiblesolderpots,andmultiplesoldernozzles.NEWproductsondisplay:KISS-205automatedhigh-speed,multi-stageSelectiveand104FPHILIn-LineConvectionPre-HeatandFluxingstation.
ADS Gold Inc. 19193843EastEagleDriveAnaheim,California92807Phone:+1714-632-1888Web: www.adsgold.com Tim Hooper, Sales Manager +1714-632-1888,[email protected] Gold offers full turnkey recycling programs. Our emphasis is in the reclaimandrefiningofpreciousmetalsfromnearlyanyPMsource.ADSreclaims precious metals from plating solutions, plated components, from embedded inner layers, and more. In addition, our PL Metals Division can turn your scrap metals into dollars, including copper, aluminum, nickel, tin-lead,tinandcarbide.OurElite-TechServicesDivisionisyourresourceforHazardous waste management and disposal, and your supply line for various plating supplies.
83
Booths400-999locatedintheSailsPavilion(UpperLevel)•Booths1000+locatedinHallsA–C(GroundLevel)
Advanced Electronic Technology HK Limited 2115Office01,28/F,SinggaCommercialCentre144-151ConnaughtRoadWestWestern,HongKongSARPhone:[email protected] Web: www.aetpcb.com ShirleyZeng,SalesManager +85235280460,[email protected] Electronic Technology is a PCB manufacturer specialized in HIGH TECH/HIGHMIXboards.Withtwofactoriesandover10yearsofexperienceintheindustrywecanproducehighqualityPCBwithmin.lineof3milsandfinishedholesof0.01”.FPC1-14LRIGID-FLEX2-16LRIGIDPCB1-24LWithblind/buriedvias,micro-vias,impedancecontrolUsingallFR4types,Aluminum,HighTg,Teflon,Halogen-free,Rogers.Finishing:HardGold
New Product
Advanced Mechatronics Solutions, Inc. 8199051SiempreVivaRoad,SuiteJSan Diego, California 92154Phone:[email protected]:www.ams-fa.com JustinKang,MechanicalEngineer +1619-661-5985,[email protected],Inc.isacorporationdedicatedinservingwarehouseequipmentstocompaniesthroughoutMexico,BrazilandUnitedStates.Wesupplypipes,joints,rackingsystems,variousautomatedequipments,andmore.Newestautomatedequipmentsarelasermarkingmachinesandconformalcoatingmachines. We have excellent reputation for technical support, engineering designandefficientdelivery.Weofferverycompetitivepricingwithexcellentqualityofproducts.Wearegrowingeveryyearwhichyieldsbetterqualityand better pricing to our customers. New Product
Advanced West 23292130S.SantaFeStreetSantaAna,California92705Phone:+1714-541-9600Web: www.AdvancedWest.com Brian Solo, President +1714-541-9600x102,Brian@AdvancedWest.comADVANCEDWESTisaleadingsupplierofREBUILTequipmentforPrintedCircuitFabricationandtheChemicalMillingIndustry.Equipmentsuppliedincludes: Drills, Routers, Developers, Cupric and Ferric Chloride Etchers, Photoprinters, Chemical Clean Lines, Scrubbers, Lamination Presses, Hot Roll Laminators and more. In addition, we now offer brand new replacement partsforchemcutwetprocesslines,replacementglenbrookx-raytubes,dupont,dynachemandhakutoRollLaminators.AllataSAVINGSof40to60%!AdvancedWestalsooffersOn-lineAUCTIONSERVICESinconjunctionwithAUCTIONPODIUM.
Aegis Industrial Software 24355WalnutGroveDrive,Suite320Horsham,Pennsylvania19044Phone:+1215-733-3571Web: www.aiscorp.com LynetteDurringer,OfficeManager, +1215-773-3571,[email protected] RobertMiklosey,VicePresidentofProductManagement +1215-773-3571,bmiklosey@aiscorp.comAegisSoftwareprovidessingle-vendorinformationsystemsforhigh-reliabilitymanufacturers,providingacriticalcomplementtoenterprise-levelERPandPLM capabilities. Aegis’ Manufacturing Operations Software (MOS) fully manages the manufacturing information environment, from process planning and launch, through manufacturing execution and shop floor materials control, tooperationsanalyticsandreal-timedashboardsystems.
AER Technologies 508650ColumbiaStreetBrea, California 92821Phone:[email protected] Web: www.pcboardrework.com KevinHolden,MarketingCommunicationsManager +1714-446-6083,[email protected] JamesCasper,ProductionManager/ProductQuality +1714-446-6081,[email protected] Technologies specializes in the removal and replacement of surface mountandthrough-holecomponentsonelectronicprintedcircuitboards.IPCCertificationensuresconsistent,highqualityresults,whilehandsolderinganddesolderingprovideacost-effectivesolutiontolowvolumeorhighmixjobs.AERisRoHScompliantandcapableofreworkingclass1,2and3electronics.Withover60yearsofexperienceinelectronicsremanufacturingand printed circuit board rework, AER Technologies is one of the largest electronics service centers on the west coast.
Agilent Technologies, Inc. 28175301StevensCreekBoulevardSantaClara,California95051Phone:+1800-829-4444Web:www.agilent.com/find/pcb TestandMeasurement-ContactCenter +1800-829-4444,[email protected] Technologies (NYSE: A) is the world’s premier measurement company. Agilent provides world class solutions in the functional test andin-circuittestmarkets,providingmanufacturerswitheasy-to-useandcost effective tests that also provide high test coverage on even the most complexboards.Stopbybooth2817andlearnhowAgilentproductsandservices have your test needs covered.
AIM 280425KenneyDriveCranston,RhodeIsland02920Phone:+1401-463-5605Web: www.aimsolder.com KellyCardone,MarketingCoordinator +1401-463-5605,[email protected] offers a full line of solder assembly materials to the electronics industry includingsolderpaste,liquidflux,bar,wire,preforms,adhesives,cleanersandchemicals,platinganodesandindium-andgold-basedspecialtyalloys.WeareISO9001andQS9000certifiedwithmanufacturing,distributionandsupportfacilitieslocatedthroughouttheAmericas,Asia-PacificandEurope.
New Product
Air & Water Systems 3727429MarvinRoad,Suite120FortMill,SouthCarolina29707Phone:+1704-588-2603Web: www.airandwatersystems.com Hal Wilson, President +1(704)588-2603,[email protected]
Air Products 17077201HamiltonBoulevardAllentown,Pennsylvania18195-1501Phone:[email protected] Web:www.airproducts.com/electronics_assembly EPATMarketingTeam,Attn:IPCAPEXShow +1800-654-4567,[email protected] Total Solution for the Electronics Packaging, Assembly and Test Industry. Air Products is a leading gas supplier to the global electronics industry. Formorethan30years,wehavebeenprovidingexpertise,technology,chemicals and gases for semiconductor devices, passive components and interconnects to packaging and testing at chip, PCB and system levels. For moreinformation,visitwww.airproducts.com/electronics_assembly.
EX
HIB
ITO
RS
84
www.IPCAPEXEXPO.org
Exhibitors Listing
AIR-VAC Engineering Company 152930ProgressAvenueSeymour,Connecticut06483Phone:+1203-888-9900Web:www.air-vac-eng.com Howard Lasto, West Coast Manager +1760-438-9363,[email protected] LindaGwozdzik,OfficeManager +1203-888-9900x107,[email protected] Manufacturer of precision Assembly and Rework Systems. The Onyx Series is our Robotic Assembly Platforms capable of placing devices within 5microns.ApplicationsincludeSurfaceMount&Semiconductordevices,MEMS,RFandOpto/Photonics.TheDRS25ReworkandRepairSystemhasbeenspecificallydesignedforLead-FreeassembliessuchasBGA/CSPandFlipChip.Optionsinclude:7500watt,3-zoneIRPreheatersandSolderRemovalSystem(vacuum).ThePCBRMSystem5.2(Lead-Freemini-wave)providesSelectiveSolderingandReworkpossibilitiesforanytypeofThru-Hole component. New Product
Airtech International, Inc. 23015700SkylabRoadHuntingtonBeach,California92647Phone:+1714-899-8100Web: www.airtechpcb.com Jim Hegeduis, PCB Business Manager +1714-899-8100,jhegeduis@airtechintl.comAirtechisamanufacturerofhighperformancereleasefilms,conformablereleasefilms,presspadsandassociatedvacuumbaggingmaterialsforHDI,FPCandRigid-Flexlaminationapplications.Weserviceworldwidelaminatorsthrough a dedicated network of technically trained, value added distributors. Our distributors offer local inventories, on site support, sheeting, tooling and custompackagingservicestomeetlaminator’srequirements.
Aiscent Technologies, Inc. 7314720Kingsway,Suite2600Burnaby,BritishColumbiaV5H4N2CanadaPhone:[email protected] Web: www.aiscenttech.com Edward Chong, Manager +1778-374-1720,[email protected] company designs and manufactures revolutionary Laser Direct Imaging systems for the PCB industry, Flat Panel industry, Touch Panel industry, High Density Packaging for IC Substrates and spherical surface direct imaging system. New Product Zone New Product
Akrometrix 5022700NEExpressway,BuildingB,Suite500Atlanta,Georgia30345Phone:+1404-486-0880Web: www.akrometrix.com Neil Hubble, Application Engineer +1404-486-0880x23,[email protected],President/CEO +1404-486-0880x30,[email protected] is the leading provider of modular metrology solutions for global microelectronicsindustry.AkrometrixTherMoiré,LineMoiré,DigitalFringeProjection, Digital Image Correlation and Studio Software products offer comprehensive flatness and strain measurements and analysis capabilities forR&Dandhighvolumeapplications.Apioneerinthetemperaturedependentmeasurementarena,Akrometrixequipmentisutilizedby95%ofthetop20globalsemiconductormanufacturers.Foundedin1994,Akrometrixis based in Atlanta, GA with operations in all major microelectronics regions globally. New Product
All Flex Flexible Circuits & Heaters 12331705CannonLaneNorthfield,Minnesota55057Phone:[email protected] Web: www.allflexinc.com Dave Becker, Sales Manager +1507-663-7162,[email protected] Flex is a flexible circuit and heater circuit manufacturer specializing in proto-typetohighvolumeproduction.Wemanufacturecustomdesignedsingle-sided,double-sided,multi-layer,andmaxi-flex®circuitsover40feetlong. Complete surface mount and thru hole component assembly, expert design and engineering support, and other value add services. All Flex serves military, aerospace, industrial, medical, and instrumentation markets. AS9100/ISO9001:2008,MilP50884E,ITAR,JCP,IPC6013,RoHS,andUL.HeadquarteredinNorthfield,MN.
all4-PCB (North America) Inc. 2235345MiraLomaAvenueGlendale,CA91204Phone:+1818-230-2345Web:www.all4-pcb.us Torsten Reckert, President +1818-230-2345,[email protected] Craig Coffman, Technical Sales Manager +1818-970-4979,craig.coffman@ALL4-PCB.COMall4-PCBequipmentandconsumablesforthePCBIndustry:PCBEQUIPMENT:DirectImaging(PrintProcess),ViaFilling(MASS),Planarizer&deburr(Pola&Massa),Automation&wetprocess(Kuttler),LaminationSystems(Lauffer),Photoplotter&Inkjet(FirstEIE),Lay-up/Registrationbonding(InduBond),HASL machines (Pentagal), Pumice machines (IS), Cross Sectioning (MSC polymers),SprayCoating(all4-PCB),EtchantRecycling(Kuttler).PCBCONSUMABLES:flexmaterial(Krempel),conductive(Tatsuta)andnon-conductiveviafillpastes(Sanei),specialtyreleasefilm&presspadmaterials(MSC Polymers)
Alltemated Inc. 33053196N.KennicottAvenueArlingtonHeights,Illinois60004Phone:[email protected]: www.alltemated.com Randy Temple, Sales Engineer +1847-971-3100,[email protected] Dave Skupien, Sales Engineer +1847-477-7587,dave.skupien@actionir.comAlltematedisapreferredchoiceforcomponent-preparationservices.Alltemated sets the standard for tape and reel packaging, IC programming, leadtrim/forming,bakeanddry-packservicesandcarriertapemanufacturing.AlltematedalsomanufacturesPLACE-N-BOND® Pick and PlaceUnderfilms.ThepatentedtechnologyusessolidthermoplasticfilmstoedgeorcornerbondBGA/CSPpackagestothePCBtoimprovesolderBall/Joint reliability.
Alpha 1 Technologies 131760FranklinAvenueBinghamton,NewYork13901Phone:[email protected]: www.alpha1technologies.com Don Burshnick, President +1607-772-2900,[email protected] Burshnick, Customer Service +1607-772-2900,[email protected] 1 Technologies provides remanufactured SMT and Through Hole equipmentintheUSandaroundtheworld.Allourremanufacturedmachines include installation, warranty, spare parts, and we support all our remanufacturedmachinesbyphone,email,andfieldservice.
85
Booths400-999locatedintheSailsPavilion(UpperLevel)•Booths1000+locatedinHallsA–C(GroundLevel)
Alpha-Cookson Electronics 3045109CorporateBoulevardSouthPlainfield,NewJersey07080Phone:[email protected] Web: alpha.cooksonelectronics.com Michael Previti, Americas Region Marketing Manager +1678-475-6897,[email protected], a business unit of Cookson Electronics, is the global leader in the development, manufacturing and sales of innovative materials used in the assembly of electronics products, including ALPHA ® solder paste, preforms, wave soldering alloys and fluxes, cored solder wire, electronics cleanersandadhesives.Sinceitsfoundingin1872,CooksonElectronicshasbeencommittedtodevelopingandmanufacturingthehighestqualitysoldering materials. That tradition continues today as Alpha supplies high qualityproductstotheLED,PowerElectronicsandPhotovoltaicindustries.
Sponsor
ALT Dynachem 2152VialLombardia,52Castronno,Varese21040ItalyPhone:[email protected]: www.dynachem.eu Osvaldo Novello, Managing Director +1390332896300x011,onovello@dynachem.euALTDynachemprovidetheindustrywithadvancedequipmentsfordryfilmlamination, both automatic cut sheet laminators and vacuum laminators.
New Product
AmeriVacS 22161518 Lancaster Point WaySan Diego, California 92154Phone:+1619-498-8227Web: www.amerivacs.com Peter Tadlock, President peter@amerivacs.comManufacturerofhighperformancecleanroomcompatibleVacuumSealerswith Gas Purge for protecting your sensitive products. Perfect vacuum seals onallheatsealablebags,includingallESDbags.AllAmeriVacSVacuumSealersincorporateaquiet,non-particlegenerating,maintenance-freeCompressedAir-DrivenVacuumPumpforquickandefficientvacuumsealedproducts every time. Always in stock. One week trial period. Two year limitedwarranty.Customdesigningavailable.Backedupbyover20yearsofexperience.ProudlymadeintheU.S.A.
Amistar Automation, Inc. 16011269LindaVistaDriveSanMarcos,California92078-3831Phone:+1760-471-1700Web: www.amistarautomation.com Joseph Pultinevicius, President +1760-471-3923,[email protected] Richard Geisz, Customer Support Manager +1760-471-3993,[email protected],Inc.sellsandsupportsproductionequipmentmanufacturedbyi-PULSECo,Ltd.ofJapan,DataPlaceAutomatedLabelingSystems manufactured by Amistar Corp. and Amistar Automation, Inc., productionequipmentmanufacturedbyTWSAutomation,Italy,andMechatronic-Systems,Germany.TheysellandsupportExtraEyeFirstArticleInspectionequipment,manufacturedbyElectronCsillag,Israel,andSecurityDisposalEquipmentfromKoritsu,Japan.AAIisalsothesourceforpartsandserviceforAmistarthru-holeandPlaceProequipment. Sponsor
Amtech - Advanced SMT Solder Products 2434500MainStreet,Suite18P.O. Box 989DeepRiver,Connecticut06417Phone:+1860-526-8300Web: www.amtechsolder.com Leigh Gesick , [email protected] Gilbert Roberge, Technical Support Manager +1860-526-5300x304,[email protected], a division of SMT International designs and manufactures advanced SMT soldering materials for the assembly of printed circuit boards. Our products include: Halogen Free Soldering Materials, Solder Pastes, Tacky Fluxes,LiquidFluxes,BarSolder,CoreWire,BGASolderSpheres,DrossEliminatorsandReworkMaterials.AllourLead-FreeproductsareRoHScompliant.AllproductsaremanufacturedintheUnitedStatesunderanISO-9001qualitysystem.
Apexyl Enterprises Ltd./JiuJiang 2202 Flex Co., Ltd. 399LaughlinCircleOttawa,ONK2T0E4CanadaPhone:+1613-882-6776Web: www.apexyl.com XinXie +1613-882-6776,orders@apexyl.comApexylEnterprisesLtd.representscertifiedChinesesuppliersinNorthAmerica.AllofourmanufacturersareISOcertified,ULand/orRoHSapproved.Theproductshavebeensuppliedtoworld-renownedbrands.Theproductinclude:JiuJiangFlex’sFlexibleCopper-CladLaminate,Coverlay,AdhesiveFilm,Stiffener;ShanghaiNanya’s([email protected],www.ccl-china.com)FR-4CCL,PrepregformultilayerPCBandHDIboard;TG140,middleTG155,highTG175,highCTI600,halogen-freeorAluminumbaseFR-4CCL;WealsoprovideFlexiblePCBDiesandTooling;Pierce&Blank Die, Compound Die.
Apollo Seiko 28413969WestLemonCreekRoadBridgman,Michigan49106Phone:[email protected]: www.apolloseiko.com Rick Schiffer, President +1269-465-3400,[email protected] Stacey Barajas, Executive Assistant +1269-465-3400,stacey@apolloseiko.comApolloSeikoistheworld-wideleaderinselectivesolderingsolutions.Ourtechnologiesincludedirectpowerirontip,micro-flame,laserdiodeandbottomsidesoldering.Table-toporin-linesystemsareavailable,equipmentin stock.
Aqueous Technologies 30299055RanchoParkCourtRanchoCucamonga,California91730Phone:[email protected]:www.aqueoustech.com MikeKonrad,President +1909-944-7771,[email protected] John Hall, Sales Manager +1909-291-1124,jhall@aqueoustech.comAqueousTechnologiesmanufacturesavarietyofaward-winningcleaningand cleaning related products including the industry’s most popular fully automated defluxing and cleanliness testing system (Trident). Productsondisplayinclude:TridentXLDZeroDischargeAutomaticDefluxingandCleanlinessTestingSystem,TridentDUOHighYieldAutomaticDefluxingandCleanlinessTestingSystem.TridentXArevolutionarynewcleaning/defluxingproduct!Zero-Ionioniccontamination(cleanliness)tester,StencilWasher Series ultrasonic stencil cleaning systems. New Product
EX
HIB
ITO
RS
86
www.IPCAPEXEXPO.org
Exhibitors Listing
Arc-Tronics, Inc. 6221150PagniDriveElkGroveVillage,Illinois60007Phone:+1847-437-0211Web:www.arc-tronics.com Marcia Weinstein, Director of Marketing and Sales +1847-437-0211,marciaw@arc-tronics.comArc-TronicsInc.isafull-serviceEMSproviderforturnkeyproductsinprintedcircuitboardassembly,cable/harnessassembly,andcompleteboxbuildorhigherlevelintegrationwithfacilitieslocatedinUSAandMexico.ThecompanyisISO9001:2008andISO13485certified,ITARregistered,AS-9100certifiedandcertifiedinULpanelbuilding.
Argosy Industries, Inc. 11061040S.Andreasen,Suite150Escondido,California92029Web: www.argosyinc.com Jeffrey Low, [email protected]
Arlon Technology Enabling Innovation 20449433HyssopDriveRanchoCucamonga,California91730Phone:+1909-987-9533Web:www.arlon-med.com BradFoster,VPofSales +1909-987-9533x203,[email protected] MikeSmith,VPofMarketing +1800-635-9333,[email protected] is a supplier of copper clad laminates and bonding sheets for manufacture of PWBs. Products include high performance polyimide and epoxy systems, products for thermal management and SMT Technology, as well as a full line of low loss and PTFE laminates and bonding materials for highfrequencyandmicrowaveapplications.
ASC International 25291799CountryRoad90,Suite6MaplePlain,Minnesota55359Phone:[email protected]: www.ascinternational.com Jon Arneson, President +1763-479-6210x11,[email protected] Steve Arneson, National Business Manager +1763-479-6210x12,[email protected] International helps electronics manufacturers worldwide improve productionyields,providingunique3Dautomaticopticalinspectionsystemsandprocesscontroltools.ASCInternationalspecializesinbothoff-lineandin-linesolderpasteinspectionandAOIsolutions.ProductsincludetheNewVisionPro,HSiandAV860seriesofSPI/AOIsolutions. New Product
Ascentec Engineering 50019535SW129thAvenueTualatin,Oregon97140Phone:[email protected] Web: www.ascenteceng.com Ian Ruef, General Manager +1503-925-1942x118,[email protected] Coleman Cobb, Regional Sales Manager +1503-925-1942x115,[email protected] supplier of premium custom tooling for electronic assembly. Wave solder pallets, surface mount carriers, heat sink alignment tooling, press support plates, material prep tooling, component feeders, and vacuum fixtures.Specializingintitanium,aluminum,andESDcompositematerials.Staffedwithexperiencedengineers.Forquickturn,qualityandaffordabletooling solutions, Ascentec Engineering is the vendor of choice.
Ascentech-GEN3 617127GooseHillRoadChester, Connecticut 6412Phone:+1860-526-8903Web: www.ascentechllc.com Randy Allinson, Member +1860-395-9384,[email protected] Gregory Alexander, +1860-395-8794,[email protected].,amanufacturerofspecialisttestequipmentincludingSolderability(MUSTSystemIIIwettingbalance),SIR(Auto-SIR),IonicCleanlinessTest(CM-Series)andSolderPasteAnalysis(SPA1000)aswellasConformalCoatingSystemsbothbatchandin-line non robotic. Ascentech LLC will also exhibit and demonstrate the NEW GensonicUltra-SonicSMTStencilCaresystem.
Ash Technologies Ltd. 716B5,M7BusinessParkNaas,KildareIrelandWeb:www.ash-vision.com JamesForan,james@ash-vision.comAshTechnologiesLtd.isaspecialistmagnificationcompany,internationallyrecognized for our award winning, innovative and patented video magnificationproductsandsolutionssinceitsfoundationin1994.Inresponse to demands from the production and inspection processes of industryforgreaterprecision,efficiency,ergonomicsandrecording/documentation within key processes, Ash Technologies has developed a broadrangeofspecializedmagnificationsolutionsthatdeliverahighqualityimagecombinedwithamodularandconfigurabledesign. New Product
ASM Assembly Systems 11113975LakefieldCourt,Suite106Suwanee,Georgia30024Phone:+1770-797-3000Web: www.siplace.com Mark Ogden, Marketing Manager +1770-797-3189,[email protected] VinceNuzzo,SalesManager +1856-218-8204,[email protected] Assembly Systems is the supplier of SIPLACE, a leader in surface mounttechnology(SMT)equipment,software,andservicestotheelectronics assembly market. The spectrum of our products and services includeanaward-winninginnovativeandflexibleplatform,customizedsolutions, logistics, information technology, planning and consulting, as well ascustomizedaround-the-clockserviceandmaintenancesupport.
Assembléon America 14071225OldAlpharettaRoad#260Alpharetta,Georgia30005-2910Phone:+1770-751-4420america.registrar@Assembléon.comWeb:www.Assembléon.com Holly Nelson, Executive Administrative Assistant +1770-751-4524,holly.nelson@Assembléon.com Terry York, Manager, Business Support +1770-751-4433,terry.york@Assembléon.comAssembléon’sbroadproductrangeprovidessolutionsforSMTelectronicsassemblywithafocusonPick-and-Placemachineryandhigh-endscreenprinters.Assembléonalsomarketsawiderangeofsoftwaresolutionsandservice capabilities. These total solutions support manufacturing from low volumehigh-mixbatchproductionthroughtoultra-highvolumecontinuousproduction of electronic assemblies. Its machines are based on high precision X-Ypositioningplatformsincorporatingadvancedparallelplacementtechnology and continuous software calibration for the most demanding applications. New Product New Product Zone
87
ASSEMBLY Magazine 530600WillowbrookLane,Suite610WestChester,Pennsylvania19382Phone:+1610-436-4220Web: www.assemblymag.com Tom Esposito, Publisher +1610-436-4220x8530,espositot@bnpmedia.comASSEMBLYmagazineisamonthlypublicationandcompletee-mediabrandservingthe2.7billiondollarassemblymarketwithworldclassinformationon the latest technology, innovation, and best practice of assembly in manufacturing.Visitusatwww.assemblymag.comtosubscribe.
Aster Technologies 34149450Trans-CanadaSt-Laurent,QCH4S1R7CanadaPhone:[email protected]:www.aster-technologies.com YvesLevesque,yves.levesque@testforce.comAsteristheleadingsupplierinboard-leveltestabilityanalysistools,capitalizing on proven expertise in board testability and strong customer relations.Foundedin1993,AsterdevelopsawiderangeofproductsdealingwithPCBtestability,viewingandqualitymanagement.TestWayisa proven solution, used by many PCB design and manufacturing companies worldwidethatprovidesauniqueapproachtoidentifyelectricaltestabilityrequirements,computetheoreticaltestcoverageearlyinthedesignchain,andchecktherealtestefficiencyofrunningtestprograms. New Product
ASYS Group Americas Inc. 3035140SatelliteBoulevard.N.E.,SuiteB1Suwanee,Georgia30024Phone:[email protected]:www.asys-group.com Markus Wilkens, President +1770-246-9706,markus.wilkens@asys-group.comASYSGroupprovideshighqualityequipmentandexcellentsupportworldwide. The product range includes SMD board handling, marking systems(laser/label/inkjet),depanelingsystems(in-/offline),finalassemblyand EKRA screen printers for the SMT,semi-pack,solar,andhybridmarkets.
New Product
AT&S Americas LLC 22291798TechnologyDrive,Suite130SanJose,California95110Phone:[email protected]: www.ats.net AndreasWippel,DirectorRegionalSalesUSA +1408-573-1211,[email protected] WolframZotter,HeadofSalesEngineeringAmericas +1408-573-1211,[email protected]&SisthelargestmanufacturerofprintedcircuitboardsinEuropeandIndia.AT&Sranksamongthetopsuppliersworldwideinthehigh-techHDIMicroviasegment.AT&S’spresence,withmanufacturingplantsinEuropeandAsia(China,Korea,India),providesaglobalfootprintforsalesandsupport.
atg-LM 2050700EastHarrisonAvenuePomona,California91767Phone:+1909-625-5551Web: www.ectinfo.com KlausKoziol,DirectorofSalesNorthAmerica +1909-374-1302,[email protected] BrianCrisp,RegionalSalesManager-FixtureandServicesDivision +1909-273-7111,[email protected] 1965, Everett Charles Technologies, ECT, has been a leader in the development of advanced technology PCB and semiconductor test products holdingover100patents.Originatingwiththecompany’ssignaturePOGO® springcontacts,ECThasbroadeneditsbusinessthroughacquisitionandmanaged growth. In 1996, ECT became a subsidiary of Dover Corp. (NYSE: DOV).
Atotech USA, Inc. 19131750OverviewDriveRockHill,SouthCarolina29730Phone:+1803-817-3500Web: www.atotech.com Cindy Lesslie, Administrative Assistant +1803-817-3596,[email protected] Daniel Schmidt, Global Marketing Management +493034985423,[email protected]’s extensive knowledge and vast product offering gives you highly productivesystemsandsingle-sourceresponsibility.Solidresearchanddevelopmentcombinedwithdecadesoffieldprovenprocessingisyourassurance for the best systems technology comprising full package of chemistry, production technology and best local service world wide. Atotech onlyworkswithcertifiedsupplierstoensurethehighestqualityproductwithconsistencysecondtonone.Adherencetointernationalqualitystandardsisa way of life at Atotech.
Austin American Technology Corporation 1328401IndustrialBoulevardBurnet,Texas78611Phone:+1512-756-4150Web:www.aat-corp.com Michelle Strebel, Sales Coordinator +1512-756-4150x14,[email protected] Steve Stach, President +1512-756-4150x12,[email protected] American Technology engineers and manufactures high performance cleaningsystems.Fromgeneralpurposetohighreliabilityrequirements,AATsystemsaredesign-drivenbythescienceofcleaning.Oursystemsincludebatchandinline;aqueousandsolvent;sprayinairandsprayunderimmersion with ultrasonics. Applications include solar panel cleaning, medical,military,aerospace,printedcircuitboardcleaning(aqueousandsemi-aqueous),SMT,flipchip,BGA,rework,etc.
Automation 2012 SupporterIED Communications Ltd.64, Empire Building, D N Road, FortMumbai,400001IndiaPhone:+912228505138
Aven Inc. 37074595 Platt RoadAnnArbor,Michigan48108Phone:+1734-973-0099Web: www.aveninc.com MarkKanpurwala,DirectorofSales +1734-973-0099x201,[email protected] Inc is a leading provider of precision hand tools and optical inspection products. With Over 25 years of experience Aven provides a single source for allyouprecisionassemblyneeds.VisitourboothtoseethelatestinHandTools and Optical Inspection products. Including our popular Mighty Scope andILoupeXL2.
Bare Board Group 11008565 B Somerset DriveLargo,Florida33773Phone:[email protected]: www.bareboard.com Greg Papandrew, President +1727-549-2200,[email protected] Tobey Marsicovetere, Marketing Diva +1727-549-2200,[email protected] Bare Board Group has the sourcing experience necessary to assist you in obtainingoffshorePCBsatcompetitivepricingthroughourpre-qualifiedteamofU/L,ISO,TSandQSapprovedmanufacturers.BBGhaspersonnelreadytomeetyourneedsonbothsidesoftheworldforon-siteexpediting,sourceinspectionandaround-the-clockcommunication.
EX
HIB
ITO
RS
88
www.IPCAPEXEXPO.org
Exhibitors Listing
Besi North America, Inc. 370633EastComstockDrive,Suite7Chandler, Arizona 85225Phone:[email protected] Web: www.besi.com JoeLippincott,VP,Sales&CustomerSupport +1480-497-6404,[email protected] Frida Hirt, Communications Manager +41417495847,frida.hirt@besi.comBesidevelopsandengineersassemblyequipmentfortheglobalsemiconductor and electronics industries. Besi’s product lines Datacon, Esec,FicoandMecocombineuniqueknowledgeinleading-edgeassemblyprocesses for leadframe, array connect and wafer level packaging applications. The offering comprises of systems for die sorting, die attach, flipchipbonding,molding,trim&form,singulationandplating.
Blackfox Training Institute, LLC 3000701DelawareAvenue,UnitBLongmont,Colorado80501Phone:+1303-684-0135Web: www.blackfox.com AlDill,President/CEO +1303-684-0135x201,[email protected] SharonMontana-Beard,VP/Sales&Operations +1303-684-0135x208,sharonm@blackfox.comBlackfoxistheonlyIPCAuthorizedCertificationCenterintheworldthatprovidescustomizedskill-basedBlackfoxCertificationstoachievetheIPCAcceptability Standards. Since 1996, Blackfox has offered convenient, worldwide class locations to better support our customers. Blackfox complimentsthisbyofferinganOn-LineSolutiondesignedtosupportourcustomersneedforWorldClassLearningandCertification!ExperiencetheBlackfox difference!
Bliss Industries, Inc. 1402386RailroadCourtMilpitas,California95035Phone:+1408-945-8401Web: www.blissindustries.com KenBliss,CEO +1408-945-8401,kbliss@blissindustries.comBlissIndustriesoffersawidevarietyofESD-safeproductsforindustriesspecializing in lean electronics manufacturing. Our carts and racks safely storefragilePCboards,SMTfeeders,fixtures,toolingandinventory.Theyprotect them from damage and factory abuse with a heavy duty welded tubularsteelframe.Formorethan30years,BlisshasbeentheleaderinSMT(SurfaceMountTechnology)cart-basedmanufacturingsystems,increasinguptime and throughput. Bliss provides expert process engineering support as well as custom cart engineering.
BPM Microsystems 37025373W.SamHoustonPkwyN.,Suite250Houston,Texas77041Phone:+1713-688-4600Web: www.bpmmicro.com Natalie Hunter, Marketing +1713-688-4600,natalie_hunter@bpmicro.comBPMMicrosystemsisagloballeaderinhigh-speed,high-volumeprogrammingequipmentforintegratedcircuitssuppliedtotheelectronicsindustry.Wewillbeexhibitingourlatestaward-winninghigh-speeduniversal8thGenerationprogrammingtechnology,models3800and2800,aswell as our Flashstream programming technology. New Product
Brock Electronics 3741350HarryWalkerParkwayN.,Unit16Newmarket,ONL3Y8L3CanadaPhone:+1905-954-0505Web: www.brockelectronics.com Paul Walsh, General Manager +1905-954-0505,[email protected] Raymond Schouten +1905-954-0505,raymond@brockelectronics.comBROCKElectronicsistheAmericasDistributorfortheClusoFirstArticleInspection(FAI)SystemforPCBAssemblies&alsoforMicro-TecInstrumentationsolderpasteinspectionsystems,hardnesstesters&theSolder Saver Dross Recovery System. SmarteStation workstations for improvedmanualPCBassembly.Consumables-highqualityconsumableproducts for the PCB assembly space, including understencil wiping roll, covertapeextenders&splicingtools&supplies. New Product
BTU International, Inc. 340923EsquireRoadNorthBillerica,Massachusetts01862Phone:+1978-667-4111Web: www.btu.com CocoZhang,ProductManager +1978-667-4111,[email protected] Rob DiMatteo, Regional Sales +1978-667-4111x143,[email protected]’sPyramaxsolderreflowovensaredesignedandbuilttomastertoday’slead-freeprocesses,andthechallengesoftomorrow.With6,8,10and12zoneairornitrogenmodels,350°Cmaximumtemperature,flexibleplatformconfiguration,lownitrogenandpowerconsumptionandacomprehensivemenu of options, the Pyramax is both the industry’s most versatile performer and its best value. New Product
Bürkle North America, Inc. 220112802ValleyViewStreet,Suite12/13Garden Grove, California 92845Phone:+1714-379-5090Web: www.burkleusa.com DavidHoward,VicePresident,BusinessUnitManager +1714-622-2578,[email protected] Richard Crowe, President [email protected]ürkle North America is the distribution organization (application, service, partssales&directfactorycontact&support)forBürkle(lamination&coating),Schmoll(drilling&routing),Impex(MeasuringSystems),LHMT(Scoring&Beveling),andBacher(exposure®istration).
C. A. Picard Inc. 1921305HillBradyRoadBattleCreek,Michigan49037Phone:+1269-962-2231Web: www.capicard.com Mark Fink, President +1269-962-2231,[email protected] Gary Weidner, Sales Manager +1843-504-4246,[email protected],imageframes,artworkpunch,postetchpunchandlaminationplateneeds.IntroducingtheVisperAVIequipmentwithGerberfilecapabilityforfinalvisualinspectionofPCBs.PleasevisitthePicardboothforallyourregistrationneedsandtheVisperAVIequipment.
89
Booths400-999locatedintheSailsPavilion(UpperLevel)•Booths1000+locatedinHallsA–C(GroundLevel)
cab Technology, Inc. 295187ProgressAvenue,#1Tyngsboro,Massachusetts01879Phone:+1978-649-0293Web: www.cabtechn.com JoeKomus,President +1978-649-0293,[email protected] are a manufacturer of PCB Depanelizers and PCB Magazines. We offertendifferentPCBDepanelizersforpre-scoredandroutedboards.PCB Magazines for storage, transport and automatic feeding. We also manufactureLasermarkingequipmentandBarcode,LabelPrinters.
Caltex Scientific 290516190ScientificIrvine, California 92618Phone:[email protected]: www.caltexsci.com Peter Cho, President +1949-788-0101,[email protected] Tina Lynne, Sales Manager +1949-788-0101,[email protected] microscope and measurement system specialist, featuring Sony TechnoLOOKTL10Zand3DCX-3000rotationaldigitalmicroscopesforSMTinspection.Fullyautomated3DsolderpasteinspectionsystemSPI-3000isnew low cost bench top unit for offline solder paste inspection to serve multi SMTlines.SPM-300-3Dmanualsolderpasteinspectionsystemforentrylevelapplication.CaltexBH-2000BGAinspectionmeasurementsystemforoptical BGA inspection. New Product
CCI 29034500QuebecAvenueNorthNew Hope, Minnesota 55428Phone:+1763-537-2090Web: www.corstat.com RogerZimmerman,SalesManager +1763-537-2090,[email protected] the industry leader in ESD shielding packaging. Manufacturing static shieldingcorrugatedandplasticmaterials.Converterofconductiveandanti-static foams. CCI has the solution for the shipping, handling, and storage of your ESD sensitive components.
Cedal Equipment SRL 407ViaCascinaMojetta38Milan,20148ItalyPhone:[email protected]:www.cequi.it Mauro Colombo +39335-5621213,[email protected]’smanagementshavebeendealingwiththePCBfieldfrommanyyears&theyallhavealargeexperiencereachedininternationalcompanies,producinglaminationpress,bonding&otherequipmentrelatedtoit.Soallourbackgroundinthepressperformances&itsapplicationhasbeenusedtodevelopourequipment.Highqualityandhighproductionareboththeguide lines of all new projects we are developing for the PCB market. Cedal equipment’sexperience,world-widematured,plustheknowledgeofthismarket,assureaperfectcustomer’ssatisfactionandfollow-up.
Cencorp Americas LLC 13293600W.MilitaryHighway,Suite1McAllen,Texas78503Phone:+1956-467-5660Web: www.cencorp.com Lorie Sullivan, Accounting Manager +1956-467-5660x4,[email protected] KentDixon,SalesManager +1281-251-8895,kent.dixon@cencorp.comCencorpisaglobalsupplierofautomationfordepaneling,odd-formassembly,lasermarking,testhandlingandcustomizedback-endsolutions.Since1978,Cencorphasbeenatrustednameandvaluedpartnerformanytop OEM and EMS customers.
Chad Industries 25201565 South Sinclair StreetAnaheim,California92806Phone:[email protected]: www.chadindustries.net Ward Palmer, Sales Manager +1714-938-0080,[email protected] Scott Smith, Product Manager +1714-398-8447,[email protected];ChadIndustriesprovidesreliable,highlyflexiblesemiandfullyautomaticsystemstohandleOdd-FormBoardAssemblyandFinalAssemblyapplications.FeaturingtheCHAD-IQproductlineandpatentedtechnologiesincludingour3-Dadaptivecomplianceassemblyhead,single-pinleadclinchsystem,andadjustablepartsfeeders.
CheckSum LLC 24136120-195thSt.NEArlington,Washington98223Phone:[email protected]: www.checksum.com JohnVanNewkirk,CEO +1360-435-5510,[email protected] Harry Jin, Field Product Manager +1360-421-0205,[email protected](ICT)andon-board,simultaneouspartprogramming systems. The test systems detect and isolate manufacturing process faults and functional failures. CheckSum test systems utilize sophisticatedcapabilitiessuchasmulti-pointguarding,complex-impedancemeasurement,vectorlesstestwithTestJetTechnology,MultiWriteron-boardpart programming, Boundary Scan, and fully integrated functional test. The installedbaseismorethan3000systems.CheckSumistheonlyU.S.ATEvendorsupplyingcompleteturnkeybed-of-nailstestfixtures,testprogramsand support.
CHEMCUT Corporation 1819500ScienceParkRoadStateCollege,Pennsylvania16803Phone:[email protected]: www.chemcut.net RickLies,CEO/GeneralManager +1814-272-2800,[email protected] Mike Soble, Sales +1814-272-2800,[email protected],theleadingsupplierofwetprocessingequipmenttothePCB&PhotoChem-Millingmarkets,deliversworld-leadingprocessuniformity,state-of-the-artprocesscontrols,andcustomer-provenreliability.Chemcut’sequipmentproductsinclude;modularsystemsthatcanbeconfiguredforanyprocess,performance,orproductionrequirement,andcompact,self-contained systems that are available for all common processes. All Chemcut productsarebackedbyreliablepost-saleservice,technicalsupportandindustry leading spare parts availability.
China Printed Circuit Association (CPCA) 741Room101,No,28,YangmingInternationalGardenLane588,ShuiqingRoadShanghai,201199PR of ChinaPhone:+862154179011Web:www.cpca.org.cn/en KevinYan,VicePresident +86-21-64147371,[email protected] Printed Circuit Association (CPCA) is a sole national PCB trade organization under the Ministry of Information Industry and Technology ofthePeople’sRepublicofChina.ItwasestablishedinJune1990anduptonowhas700memberswhoarebig-andmedium-sizedPCBproducers,manufacturesofspecialequipment,rawandauxiliarymaterials,researchinstitutes, colleges and universities from all over the country. In their ownership,themembersareofstate-run,collective,private,sino-foreignjointly invested and solely foreign funded.
EX
HIB
ITO
RS
90
www.IPCAPEXEXPO.org
Exhibitors Listing
Christopher Associates, Inc. 28013617WestMacArthurBoulevard,Suite507SantaAna,California92704Phone:+1714-979-7500Web: www.christopherweb.com Roberto Garcia, Sales Coordinator +1714-979-7500,[email protected] Martin Gershenson, Director of Business Development +1714-979-7500,martin@christopherweb.comSuppliersofadvancedmanufacturingtechnologyandequipmentincludingAOI,Verification/Repairstations,SolderPastemeasurementsystems,AirFiltration Systems, Cleanroom supplies, u.v. imaging and curing, laminators, assembly and joining materials. New Product
Cimnet Systems, a Consona ERP Solution 2142450E.96thStreet,Suite300Indianapolis,Indiana46240Phone:+1888-826-6766Web:www.cimnet-systems.consona.com Iain Wilson, Product Manager +1630-512-8369,[email protected] Jeff Murdock, Customer Account Manager +1317-249-8363,[email protected] Systems and Intuitive ERP are leading solutions from Consona Corporationthatenableover700PCBandelectronicscustomerstocontinuously improve their business processes. Cimnet Systems specializes indeliveringPCBmanufacturersacomprehensivefamilyofindustry-specificERP,engineeringautomation,salesquotation,manufacturingexecution,andsupply chain communication solutions, as well as outsourced CAM and sales quotationservices.
Cincinnati Sub-Zero 301812011MostellerRoadCincinnati, Ohio 45241Phone:+1513-772-8810Web: www.cszindustrial.com Mark Chrusciel, Sales Director +1513-772-8810,Chrusciel@cszinc.comCSZmanufacturesafullrangeofenvironmentaltestchambersincluding,temperature cycling chambers, humidity chambers, accelerated stress testingchambers,thermalshockchambers,altitudechambers,HALT/HASSchambers, AGREE vibration chambers, industrial freezers and more. Sizes rangefrombenchtopchamberstofullwalk-in/drive-inrooms.Standardtemperaturerangesinclude-84’Cto+190’Cwithrelativehumidityfrom10%to98%.CSZ’spatentedTundrarefrigerationisidealforcustomers’testingproductsdownto-40Cor-54Csavingoperatingcosts. New Product
Circuit Automation, Inc. 8105292 System DriveHuntington Beach, California 92649Phone:+1714-763-4180Web: www.circuitautomation.com Thomas Meeker, President +1949-231-2254,[email protected] Larry Lindland, Sales Manager +1978-390-3902,[email protected]:VacuumDegassingmachine,DP-VDM.ReducesairmicrobubblesfromLPSIMcoatingsandviafillinginks.IdealforheavyCuplating.Eliminatesneedsforstepcurefinalbakingofsoldermask.Introducingnew“smartphone”DP-6000Seriesadvancedcoatinganddryingsystems:unsurpassed, consistent, coating thickness control and distribution. Several configurationsavailableaccommodatingdifferentthroughputandpanelconfigurationrequirements. New Product
Circuit Cellar BinP.O.Box180Vernon,Connecticut06066Phone:+1860-875-2199Web: www.circuitcellar.com Shannon Barraclough, [email protected]’suniquecombinationofeditorialproductsandservices provides a tremendous value to the embedded systems design community. Through its monthly publication and management of numerous design contests, Circuit Cellar continually assists its global readership andindustryvendorsbyfocusingonreal-worlddesigntechniquesandworkbench-leveladvice.
Circuit Foil Luxembourg 18079 rue de WinselerWiltz, L9559LuxembourgPhone:+011352957551-1Web: www.circuitfoil.com John Jephson, Product Manager +1215-887-7255,[email protected] Wilfried Halmes, Sales Manager +1215-941-5955,[email protected] Foil is a global company with a prestigious reputation for its manufacturingofhigh-qualityelectrodepositedcopperfoilsfortheelectronics industry, targeted primarily at laminators and printed circuit board manufacturers. New Product
Circuitnet Supporter22 Parkridge RoadHaverhill,Massachusetts01835Phone:+1843-682-4755Web: www.circuitnet.com Jeff Ferry, Publisher +1843-682-4755,[email protected] KenCavallaro,BusinessManager +1978-363-2176,[email protected] business day we dig through the unending stream of news, articles, features, and discussions covering the world of electronics manufacturing. We conveniently package links to these important news stories in a simple email digest and send this email to our exclusive subscribers every business day.
Circuits Assembly 434P.O.Box470Canton,Georgia30169Phone:+1678-589-8800Web: circuitsassembly.com Mike Buetow, Editor in Chief +1617-327-4702,[email protected] KristaFabian,GlobalSalesManager +1302-519-8901,[email protected],award-winningmagazineexclusivelyservingtheelectronicsassemblymarketplace.CIRCUITSASSEMBLYfocusesontheentireassemblyprocess,includingsurface-mount/mixed-technology;componentplacement;screenprinting;soldering;rework;test/inspection;materials; process control; data management; advanced component packaging;emergingtechnologies;andmore.PublishedbyUPMediaGroupInc.,CIRCUITSASSEMBLYanditsemailnewsletter,pcbupdate.com,arefreetoqualifyingprofessionals.Visitcircuitsassembly.comformoreinformation.UPMediawillpresenttheNPIandSEAawardsonFebruary28at5:00pminbooth434. New Product
91
Booths400-999locatedintheSailsPavilion(UpperLevel)•Booths1000+locatedinHallsA–C(GroundLevel)
Cirris Systems 11361991 Parkway BoulevardSaltLakeCity,Utah84119Phone:+1800-441-9910Web: www.cirris.com Darin Yeager, National Sales Manager +1800-441-9910x633,[email protected] JoeKlekas,Sales/TradeShows +1800-441-9910x632,[email protected] is a worldwide leader in cable, harness and interconnect test equipment.WemanufacturetheEasy-wireandSignaturelinesofanalyzers.EmphasizedthisyearisthenewEasy-TouchbenchtopanalyzerwithfullyintegratedWindows7PC&1500VDC/1000VAC;alsothePin-Sightforfirstendedpinningofconnectors&optionallibrary.Weoffer64to32,000testpointranges;&5VDCto2800VDC/2000VACvoltageranges.Wehavea solution for most cable, harness, and interconnect testing and pinning applications;offeringofftheshelfandturn-keyintegrationforDWV,IR,Continuity&Component.
Coatema Coating Machinery GmbH 418Roseller Str. 4Dormagen,NRW41539GermanyPhone:[email protected] Web: www.coatema.de ThomasKolbusch,VicePresident +4921339784121,tkolbusch@coatema.deForalmost40yearsnowCoatemaCoatingMachineryGmbHhasbeendesigning and constructing coating and laminating plants for the most different applications. The portfolio ranges from small lab units and pilot plants for realisation of even small batches up to production plants for different applications. All lab units for small test series as well as production linesforlarge-scaleworkaremanufacturedtoindividualproductandcustomerrequirements.Theseflexibleequipmentsolutionscanbeusedfor continuous as well as discontinuous processes and for a wide range of working widths. New Product
Cobar Solder Products Inc. 170953WentworthAvenueLondonderry,NewHampshire03053Web: www.cobar.com Lance Larrabee, General Manager +1603-432-7500,[email protected] Bob Silveri, Customer Support Manager +1603-432-7500,[email protected] is leader of the North American Market in the world of soldering in electronics. At Apex we will exhibit a complete range of advanced soldering materialrangingfrombartosolderpastetohigh-performancefluxes.Cobarannounces the new Halogen and Halide Free Cobar OT2 Solder Paste. WearesponsorofthefirstannualIPCExpoHandSolderingCompetition!CobarSolderProductsistheU.S.divisionoftheBalverZinn/CobarGroup.
New Product Sponsor
Cogiscan Inc. 123250DeGaspe,SuiteA5Bromont, QC J2L 2N8CanadaPhone:+1450-534-2644Web: www.cogiscan.com FrancoisMonette,Co-President +1450-534-2644x223,[email protected] Mitch DeCaire, Sales Manager (Americas) +1450-534-2644,mdecaire@cogiscan.comCogiscanpartnerswithleadingequipmentmanufacturersandelectronicsassemblers to create solutions that can integrate with existing systems, to providefactory-wideTrack,TraceandControl(TTC).Wearecommittedtothedevelopment and continuous improvement of solutions to Track, Trace and Control materials and tools on and off the shop floor. New Product
Computrol Inc. 2851499 East Corporate DriveMeridian,Idaho83642Phone:[email protected]: www.computrol.com Jeff Yturbe, Sales +1208-887-1000x231,[email protected] KevinKimsey,Sales +1208-887-1000x277,[email protected] is a leading Turnkey, Electronic Contract Manufacturing Services Provider, specializing in low to medium to high volume, high mix, high technology assembly, including Box build, Cable and Wire Harnesses, SMT, through-holeandmixedtechnologyPCBassembly,utilizingstateoftheartequipment.WeareamultifacilitycompanyheadquarteredinMeridianIdaho.WeareAS9100/9001:2008,ISO13485:2003,J-STD and IPC class II andIIIcertified,plusweareITARregisteredandRoHScompliant.Wehavefull electrical and functional test capabilities as well as design, DFM and DFT services.
Conductive Compounds Inc. 42117HampshireDrive,Unit8Hudson,NewHampshire03051Phone:[email protected] Web: www.conductivecompounds.com DonBanfield,President +1603-595-6221x301,[email protected] Joan Goodwin, Sales Manager +1603-595-6221x304,[email protected],Inc.develops&manufactureselectricallyconductive&resistiveinks,UVdielectrics,adhesives,coatings,encapsulants&othermaterials for the global electronics assembly market used for printed electronics,rigid&flexcircuits,&EMI/RFIshielding&thermalmanagementof electromechanical assemblies. In addition to standard products, we specializeincustomformulationsfornew&uniquehigh-techapplicationsforconsumerelectronics,medicaldevices&sensors,controls,defense,aerospace,automotive,photovoltaic,electronicdisplay&otherelectronicindustries.
Control Design Bin555W.PierceRoad,#301Itasca,Illinois60143Phone:+1630-467-1300Web: www.controldesign.com JoeFeeley,Editor-In-Chief +1630-467-1300x380,[email protected] DESIGN is the only magazine exclusively dedicated to the control and instrumentation needs of industrial machine builders (OEMs). The magazine stands alone as the authoritative source of information on embedding all things control — from PLCs to proximity switches, from software to sensors.
Control Micro Systems, Inc. 28004420AMetricDriveWinterPark,Florida32792Phone:+1407-679-9716Web: www.cmslaser.com Sales Department +1407-679-9716,[email protected] laser marking systems for fast, permanent marking of text, graphics, barcodesandECC2002Dmatrixcodesonpcboards.Specializesinlasersystemsconfiguredtospecificmarkingrequirements,includingboardmaterial,board-handling,visionsystems/readersandintegrationwithcomputernetworks.Systemsconfigurationsrangefromstand-alonemarkingislandstofullyintegrated,SMEMAin-lineworkstations.Laserwirestrippingsystems and laser wafer dicing systems also available.
EX
HIB
ITO
RS
92
www.IPCAPEXEXPO.org
Exhibitors Listing
Conveyor Technologies of Sanford, NC, Inc. 14215313WomackRoadSanford,NorthCarolina27330Phone:[email protected]:www.conveyor-technologies.com JasonVann,SalesManager +1919-776-7227,[email protected] Tom Pilson, Operations Manager +1919-776-7227,[email protected] Systems, the Advanced Automation Division of Conveyor Technologies Inc.isaworldclassmanufacturerofPCBAssemblyEquipment/LaserMarking/Routers/AutomaticComponentInspection/Coating,Curing&CoatingInspection/CustomRoboticAutomation(OddForm).Inaddition,wealsomanufacturestateoftheartPCBtransportequipmentwithadvancedfeatures such as automatic change over management systems and bar code verification.VisitCTIandletussharewithyouourworldclassengineering,equipmentandsupport.
Count On Tools 14362481HiltonDrive,Suite3Gainesville,Georgia30501Phone:+1800-538-0426Web: www.cotinc.com Curt Couch, President +1770-538-0411x302,[email protected] ZacheryShook,MarketingDirector +1770-538-0411x303,zshook@cotinc.comCountOnToolsspecializesinhighqualitySMTnozzlesandconsumablesfor pick and place machines. Our product range includes most types of placement machine (vacuum nozzles, glue dispense nozzles, cutter blades, and other consumable parts. We provide special engineering design service ofcustomnozzlesforthoseuniqueandoddcomponents.Weprovidecontractmanufacturing services and are an exclusive distributor of PB Swiss Tools, (www.pbtools.us). New Product
Creative Electron 828253PawneeStreetSanMarcos,California92078Phone:[email protected] Web: www.creativeelectron.com BillCardoso,President/CEO +1760-752-1192,[email protected] Brian Wagner, Director of Sales +1760-752-1192,[email protected],Inc.(CEI)isanagileinnovatorinthefieldofnon-destructivecounterfeitandcontrabanddetectionwithheadquartersinSouthernCalifornia.CEI’sinnovativeTruViewproductlineoffershigh-qualityradiographydonefast!TruViewmachinesareadvancedx-raysystemswithexclusiveReel-to-ReelTurboandConveyorBeltutilitiesthatallowusersto inspect tubes, trays, reels, boards, and single components at a rate of 1,000partsper5minutes-thefastestrateofinspectioninthemarket.CEIproductsareMadeintheUSA.
Crystal Mark, Inc. 3416613JustinAvenueGlendale,California91201Phone:+1818-240-7520Web: www.crystalmarkinc.com Jawn Swan, President +1818-240-7520x223,[email protected] ChrisRomero,InsideSales&Marketing +1818-240-7520x235,sales@crystalmarkinc.comManufacturersandAutomatersofMicroSandblastEquipment,WorkStations, Dust Collectors, Nozzles, Abrasive Blasting Powders. For: Texturing, Frosting, Drilling, Conformal Coating Removal, Component Demarking, Deflashing,SolderMaskRemovalandmore.Smoke&FumeCollectors.
New Product
Custer Consulting Group 200992 Spindrift CloseP.O. Box 299TheSeaRanch,California95497-0299Phone:+1707-785-1777Web: www.custerconsulting.com Walter Custer, President +1707-843-0440,[email protected] JonCuster-Topai,VicePresident +1707-620-0053,[email protected] research, business analyses and forecasts for printed circuit board fabricationandassembly,passivecomponents,semiconductors,solar/photovoltaicandtheelectronicequipmentendmarkets.
CyberOptics Corporation 24295900GoldenHillsDriveGoldenValley,Minnesota55416Phone:+1763-542-5000Web: www.cyberoptics.com ChrisRockwell,DirectorofSales-Americas +1763-542-5000,[email protected] AllenPhung,SalesManager-WestCoast,MX,BRZ +1763-542-5000,[email protected] Corporation is a recognized leader in process yield and throughput improvement solutions. It supplies optical process control sensors and inspection systems to control manufacturing process and ensure qualityofelectroniccircuitboardsworldwide.CyberOptics’productsareusedbytopmanufacturersofelectroniccircuitboardassemblyequipment,manufacturers of semiconductor DRAM memory, semiconductor capital equipmentmanufacturers,andend-userelectronicassemblymanufacturers,including ODMs and EMS who manufacture cell phones, smart phones, notebooks, and server boards. New Product
Dalian Pacific Electronics Co, Ltd. 437127Liao-He-XiRoadEconomic&TechnicalDevelopmentZoneDalian,Liaoning116600ChinaPhone:[email protected] Web: www.dpec.cn Jun Jin, [email protected] Steve Chen, [email protected],DalianPacificElectronicsCo.,Ltd.(DPEC)isahightechnologyenterprisedevelopedfromDalianPacificMulti-LayerPCBCo.,Ltd.,andisaChinaTop100ElectronicComponentsCompany.DPECfollowsthePCBdevelopmenttrendindigital,integration,micromationandmulti-functionelectronicsandpositionsitselfinhigh-techmarkets.Possessingfirst-classPCB manufacturing facilities and coupled with the earliest PCB production experience within the PCB industry, today DPEC is in the niche technology fieldsinautomotiveelectronics,networkcommunications,industrialcontrol,high-techelectronics,etc.
Data I/O Corporation 37446464185thAvenueNE,Suite101Redmond,Washington98052Phone:[email protected]: www.dataio.com DavidBoak,DirectorofSales-Americas +1206-554-9904,[email protected] Jeff Nicoll, Regional Sales Manager +1774-454-7470,[email protected]/OCorporationisthegloballeaderinprogrammingsolutionsforsemiconductordevices.Fornearly40years,ourinnovativedesign,newproduct introduction and manufacturing solutions have contributed to the success of the world’s leading electronics and technology companies. Data I/OwillbedisplayingtheirfulllineofprogrammersincludingRoadRunner3,PSSerieshandlers,FLX500andFlashPAK3.Inaddition,DataI/OwillexhibittheirFLXHDforhigh-densitydevicesandtheirFactoryIntegrationSoftwaresuite. New Product
93
Booths400-999locatedintheSailsPavilion(UpperLevel)•Booths1000+locatedinHallsA–C(GroundLevel)
Datapaq, Inc. 2402187BallardvaleStreetWilmington,Massachusetts01887Phone:[email protected]:www.datapaq.com Rich Burke, National Reflow Manager +1978-988-9000,[email protected]®istheworldwideleaderintemperatureprofiling.TheDatapaq® ReflowTrackersystemcontinuestosetindustrystandardsforease-of-useandreliabilityinthermalprofiling.Itistheidealsolutionforreflow,wavesolder,vaporphase,tack/cure,reworkstations,soldermaskovensandhightemperaturefurnaces.EasyOvenSetup(EOS)softwareisaneasy-to-usesoftware program that automatically calculates the best reflow oven settings basedontheproductandprocesslimitssetbytheend-user.EOScutsovensetup time in half and eliminates repeated trial and error experiments.
DDM Novastar, Inc. 2551241 Boro Line RoadKingofPrussia,Pennsylvania19406Phone:[email protected] Web: www.ddmnovastar.com BarbaraKirkpatrick,VPandGeneralManager +1610-337-3050x204,[email protected] JohnMalboeuf,VicePresident-WorldwideSales +1610-337-3050x205,jmalboeuf@ddmnovastar.comDDMNovastarInc.providescost-effectiveturnkeysolutionsforsurfacemountandthrough-holeassemblysystemsforlowtomediumvolumeOEM&contractmanufacturers.Equipmentincludesmanual&automatedstencilprinters,manual&automaticpick&placesystemswithdispensers,wavesolder&selectivesoldermachines,leadfreesolderreflowovensincludingmodels with exclusive patented horizontal convection, component counters, andthrough-holereworksystem.
De Nora Tech, Inc. 20437590DiscoveryLaneConcord,Ohio44077Phone:[email protected]: www.denora.com Tom Turk, Sr. Account Manager +1440-710-5350,[email protected] DonGroszek,DirectorofBusinessUnits +1440-285-0359,[email protected] De Nora group companies manufacture a range of plating anodes for electronics (acid copper plating in circuit boards), trivalent chrome system anodes, platinum anodes and auxiliary anodes for chrome plated parts with deep recessed areas. The company’s DSA® dimensionally stable anodes are designedtoprovidehigherefficiencyandmorecontrolledcurrentdensitytotheplatedpartforimprovedquality,reducedmetalconsumptionandhigherthroughput. De Nora has manufacturing facilities in Asia, Europe and the Americas.
DEK International 26001785WinnetkaCircleRollingMeadows,Illinois60008Phone:+1847-368-1155Web: www.dek.com KarenMoore-Watts,[email protected] TraceyKhoo,MarketingManager [email protected],decadesofmaterialsdepositionexperience and technologies that enable multiple applications from SMT to semiconductorpackagingtophotovoltaics,DEKdeliverstheknowhowandtotal printing solutions you need to stay competitive. Designing every product mindfulofcustomers’futureproductionneeds,DEKkeepschoice,flexibilityandlowcost-of-ownershipatthecoreofourdevelopmentphilosophy.VisitDEKtoseeourlatestinnovations,includingProActiv,ProDEKandNano-ProTek and discover how we can enable your processes today and tomorrow.
Digicom Electronics, Inc. 37177799PardeeLaneOakland, California 94621Phone:[email protected]: www.digicom.org
PANTONE SOLID COATED7477
PANTONE SOLID COATED630
PANTONE SOLID COATED158
Mo Ohady, General Manager +1510-527-8084,Mo@digicom.orgDigicomprovidesturn-keyelectronicsmanufacturingsolutionsforprototypetovolumeproductionbuilds,PCBassemblies,andcompletebox-buildsystems. We’ve built electronics and solved design and manufacturing problemssince1982.Digicomhandlestheprocessfromdesigntofinal,fullycompliantproduct.WehaveISO9001:2008andISO13485:2003(medicaldevice)certifications.Ourhighlevelofpersonalservice,can-doattitude,precisioninprocesscontrolandmonitoring,andabilitytodeliverquality,technology,value,andservice,makeusavaluableadjuncttoyourfirm.
DIS Inc. 224485 Hoffman Lane, Suite QIslanida,NewYork11749Phone:+1631-851-0102Web: www.distechnology.com Anthony Faraci, President +1631-851-0102,[email protected] Gary Sortino, Engineering Manager +1631-851-0102,gsortino@distechnology.comDISIncisaninnovativeproducerofinnerlayer/sub-laminationregistrationandweldingequipment.DISistheleadinginnovatorin‘DirectOpticalRegistration’,anewmethodofopticallyregisteringandweldinginnerlayers/sub-lamsuchthatregistrationisimprovedbyeliminatingmechanicaltoolingtolerances. Operational cycle times are reduced and process flexibility is increasedallwhilesignificantlyreducingoperatingcosts. New Product
Divsys International, LLC 5208110ZionsvilleRoadIndianapolis, Indiana 46268Phone:[email protected]: www.divsys.com Tammie Fish, Managing Owner +1317-405-9427x4,[email protected] Stanley Bentley, Sr. Technical Advisor +1317-405-9427x5,[email protected],LLC.,isawoman-ownedPCBoardSalesandProduct Assurance Company. ThemembersatDIVSYShaveallworkedinboardfabricationandassemblyoperations at previous companies. Each one has many years of actual board fabricationandEMSexperienceinthehigh-reliabilitymarkets,suchasaerospace,military,automotive,medicaldeviceandbio-medicalindustries.Thisadvantagebenefitsboththecustomerandsupplier,asourindustryexperts actually fabricated printed circuit boards and assembled components onthoseboardstocreatefinalassemblies.
DMI 133230750N.W.HillcrestStreetNorthPlains,Oregon97133Phone:[email protected]: www.dmipallet.com Raj Savara, President +1503-701-4338,[email protected],C/C,&More;WashBaskets;SpecialtyHardware&Accessories;Jigs;DedicatedPlasticsMachining&MetalMachining;CustomBuiltAuxiliaryProjects:Simpledesignrequeststothecomplex,cost-effectivetooling.Customfabricationofprocessingequipment,testequipment,andinspectionequipment.Canretrofitoldequipmenttonewstandards for PCB width, and other issues. New Product
EX
HIB
ITO
RS
94
www.IPCAPEXEXPO.org
Exhibitors Listing
Dow Electronic Materials 1837455 Forest StreetMarlborough,Massachusetts01752Phone:+1800-832-6200Web: www.dow.com Brian Amos, Marketing Manager +1508-229-7424,[email protected] Hal Thrasher, General Manager, NA IT Sales +1508-229-7594,[email protected],aglobalsupplierofmaterials&technologiesto the electronics industry, is a leader in the semiconductor, interconnect, chip packaging, display and photovoltaic markets. From technology centers worldwide,teamsoftalentedDowscientists&applicationexpertsworkcloselywithcustomerstodeliverinnovativesolutionsfornext-generationelectronics. For the interconnect segment, with a broad range of core competencies&deepindustryknowledgeinthePWB,electronicfinishesandphotovoltaic industries. Sponsor
DuPont Electronic Technologies 231314 T W Alexander DriveResearchTrianglePark,NorthCarolina27709Web: electronics.dupont.com John Myrick, Territory Manager +1714-337-2556,[email protected] Mark Dirks +1919-248-5741,[email protected] Electronics is connecting science and technology from across the company and around the world to deliver advanced material solutions for the PWB industry, including new Pyralux® flexible circuit materials, Riston® dry filmphotoresists,Interra™embeddedpassivematerials,andawidevarietyof screen printed materials for Printed Electronics applications.
Eastman Kodak Company 1801343StateStreetRochester,NewYork14650-0505Phone:+1800-698-3324Web:www.kodak.com/go/pcb KristenRush,WWMarketing&OperationsManager +1585-724-7861,ronald.schmidt@kodak.comKodakshowcasesitspremiumredphotoplotterfilm.APR7ispreconditionedatthefactoryto50%RH.Thisfeature,combinedwithitssinglesidedstructure,makesAPR7unmatchedfordimensionalstability.Inaddition,itssuperior durability and scratch resistance, low inclusion base and permanent anti-staticcoatingenablesthePCBmanufacturertoproducecomplexcircuitpatterns with high yields.
Easy Braid Co. 344311543KTelDriveMinnetonka,Minnesota55343Phone:[email protected] Web: www.easybraidco.com John Webber, National Sales Manager +1952-929-3040,[email protected] Cleve Williams, Applications Engineer +1312-316-9273,[email protected] product line includes desoldering braid, solder soakers, swabs, understencil rolls and most recently desoldering tips, solder stations, Purex fume extraction and Parmi Solder Paste Inspection systems.This year Easy Braid Co is introducing PBT washer systems for all products from stencils to printed boards to completed assemblies. They are available withfullyclosedloopsystems,DI-Waterrinseandavailableultrasonic.WearealsointroducingSECX-Rayinspectionequipment.SECX-Raysystemsareavailableinboth2Dand3Dvariationsandofferhighlyaccurate,hi-resolutionimages. New Product
ECD 27214287S.E.InternationalWayMilwaukie,Oregon97222Phone:[email protected] Web: www.ecd.com ToddClifton,VPSales&Marketing +1503-659-6100,[email protected] Rex Breunsbach, President +1503-659-6100,rex.breunsbach@ecd.comECDoffersthebroadestproductlineforthermalprofileplanning,boardprofiling,machineverification(wave/reflow)&continuousthermalmonitoringin the electronics manufacturing industry. ECD’s legacy of innovation continues with the new SuperM.O.L.E.®Gold2“TheSmartestProfileronthePlanet”. New Product
EIPC 739Bourgognestraat 16Maastricht,6221BXThe NetherlandsPhone:+31433440872Web: www.eipc.org Sonja Derhaag, [email protected] European Institute of Printed Circuits (EIPC), based in The Netherlands, is an international service provider to the European Interconnection and PackagingIndustry.Since1968,theEIPCisservicingabout110membercompanies, including suppliers of machinery and materials to the PCB industry, PCB Manufacturers, contract electronics manufacturers and OEM’s. The EIPC is a network of PCB professionals providing platforms to exchange business and technology information for the success of the European electronics industry.
ELANTAS PDG, Inc. 25455200NorthSecondStreetSt.Louis,Missouri63147Phone:+1614-621-5700Web:www.elantas.com/pdg CarlaRusso,Sales&MarketingDirector +1314-622-8748,[email protected] Jim Stockhausen, Business Development Manager +1314-621-5700x729,jim.stockhausen@altana.comApremierglobalmanufacturerofawiderangeofliquidelectricalinsulationproducts including potting compounds, conformal coatings, adhesives, specialtyepoxyproductsusedinhi-tempapplicationsandinsulatingresinsoffering heat, chemical, shock, and moisture resistance as well as good thermal conductivity and dielectric protection. The Epoxylite®,ELAN-Tron®, ELAN-Cast®, Pedigree®, and Sterling® brands are used for coating, sealing and potting electronic components, sensors, PCBs and other applications. RegisteredISO9001andISO/TS16949.
Electra Polymers Ltd. 2049Roughway Mill, Dunks GreenTonbridge,Kent,TN119SGUnitedKingdomPhone:+441732811118Web: www.electrapolymers.com ShaunTibbals,Sales/MarketingDirector +4401732811118,[email protected] Chris Wall, Technical Director +4401732811118,[email protected] is a leader in the development and manufacture of advanced resists&coatingsfortheglobalElectronicsindustry:Conventional&LDIPhotoimageableSoldermasks,PhotoimageableFlex-Coverlay,Super-WhiteLED soldermasks, Polymer Thick Film materials for surface and embedded applications,automotivedielectrics,100%solidshole-plug&Peelablemasksformulatedforlead-freesolderprocesses.For25yearsElectrahasbeen a major supplier of PWB soldermask inks to the North American market with nationwide distribution and support. New Product
95
Booths400-999locatedintheSailsPavilion(UpperLevel)•Booths1000+locatedinHallsA–C(GroundLevel)
Electronics Assembly BinMMG Publishing Limited, MMG HouseConnors Yard Beeches Road, CrowboroughEast Sussex, TN6 2AH UnitedKingdom
Electronics Industry Update 4093,InishkeenKilcoole,WicklowIrelandPhone:+353862485842Web: www.electronicsproductionworld.com
Electronics Protection Bin 7355EastOrchardRoad,Suite100GreenwoodVillage,Colorado80111Phone:+1720-528-3770x130Web:www.electronicsprotectionmagazine.com/ Laura Mayo, Advertising Sales Manager +1-800-803-9488x130,[email protected] Protection is a product and service news tabloid edited for OEM design engineers and product development professionals of electrical, electronic, commercial, medical, consumer and industrial products and equipment;andformanagersandintegratorsofhighlysensitiveequipmentwhoutilizeequipmentprotectiontechnologiesandtesting.
Elektor US BinP.O.Box180Vernon,Connecticut06066 Shannon Barraclough, [email protected]
EMCHINA.org.cn Supporter16 Jianguomenwai Blvd., #511 Tower OneChaoyang DistrictBeijing,100022ChinaPhone:+861065696760Web: www.emchina.org.cn David Yang, President +861013501383675,[email protected] XiaoDuanYang,ManagingDirector +861065696760,[email protected], www.emchina.org.cn, China’s principal digital media network dedicated to the electronic industry. In collaboration with CBC Consulting, wespecializeinprovidinge-media,marketingconsultingandpublicrelationsservices to companies doing business in China. These services include marketing and business consulting, market entry and penetration strategy, market research, technology and product validation and compliance, governmentandindustryrelation,partneridentification,publicrelations,advertising,translation,eDM/database.
EMSNow Media LLC 91253HighStreetStetchworth, Cambs, CB8 9THUnitedKingdomPhone:[email protected]: www.emsnow.com Philip Stoten, Publisher +447768318111,[email protected] Ann Pyle, Advertising Sales Manager +353851421341,[email protected] is the leading online publication in the electronics manufacturing services industry bringing together real time news, analysis, commentary and industry related multimedia from the world over. EMSNow is established asthefirstplaceindustryprofessionalsturnforrealtimeinformationand analysis concerning the electronics manufacturing industry. Industry professionals“read,hearandseeitfirst”atwww.emsnow.com
EMT Worldwide SupporterIML Group plcBlair House, High StreetTonbridge,Kent,TN91BQUnitedKingdomPhone:+4401732359990Web: www.EMTWorldWide.com Alistair Winning, Editor +4401732359990,[email protected] KeithMurray,GroupAdvertisingManager +44(0)1732359990,[email protected] has been relaunched with a fresh new look. The newsletter is delivered, free, weekly and contains the best news along with original comments from global correspondents. The newsletter is backed by a websitepackedwithreferenceinformation,including‘TheShortList’-auniquebuyersguidecontainingover30,000itemsofdata.
EnzoTech 71914776YorbaCourtChino,California91710Phone:[email protected]: www.enzotech.com David Liang, Manager +1909-993-5140,[email protected] Richard Yu, Account Representative +1909-525-7486,[email protected] in 1982, Enzotech has been striving to provide cooling solutions for avarietyofserversthatrequirehighefficiencyand24-hourpowerstability.Withtheon-goinginnovationandchallengesinthecomputerindustry,Enzotechhasbecomealeadinginnovatorindesigninguniquematerialforming technology. Along with its OEM experiences with companies such as AMD and Intel, Enzotech also have the reputation as being one of the world’smostadvancedhigh-performanceheatsinkmanufacturer.Enzotechiscommittedtoprovidecustomerswithworld-classhighqualityproducts.
EPTAC Corporation 25478025SouthWillowStreetBuilding2,Unit207Manchester,NewHampshire03103Phone:[email protected]: www.eptac.com Brian Downes, Director of Business Development +1603-296-0887x222,[email protected] John Tickle, Master Instructor +1647-547-8138,[email protected] Corporation is the internationally recognized leader in solder training andIPCcertificationtocommercialstandards,givingprofessionalstheskillsto accelerate their careers, and businesses the talent to succeed. For nearly 25years,EPTAChasbeenhelpingcorporationsincreasequalitystandards,improveproductivity,andmaximizeprofits.IPC-A-610,J-STD-001,IPC-7711/7721,IPC-A-620,IPC-A-600. New Product
Equipment Technologies, Inc. 230319 Park AvenueHudson,NewHampshire03051Phone:+1603-881-5253Web:www.equiptech.com Jon Pelletier, President +1603-881-5253,[email protected] EricWinkler,VicePresident,Int’lSales&Marketing +1603-881-5253,[email protected],Inc.(ETI)isthelargestsupplierofhighqualitysecond-handREBUILTPCBfabricatingequipmentandchemicalmillingequipmentintheworld.WeofferworldwidesupportthroughoursalesandserviceteamsontheUSEast/Westcoasts,Guangzhou,ChinaandourEuropeanofficeinGermany.Installation,technicalsupport,spareparts,shipping/cratingandwarrantiesareavailable.100%moneybackguarantee!!ETIofferscertifiedAMEAappraisalservicesandhandlesliquidationsofallPCBequipment.30yearsofexceptionalservice.Save20%-70%offthecostofnew.
EX
HIB
ITO
RS
96
www.IPCAPEXEXPO.org
Exhibitors Listing
ERSA North America 11011779PilgrimRoadPlymouth,Wisconsin53073Phone:+1920-893-3772Web: www.ersa.com AlbrechtBeck,President&CEO +1920-892-9248,[email protected] ErnieGrice,VicePresident,Sales +1262-412-0220,[email protected] complete line of lead free hand soldering tools, including the powerful i-conseries,makerofthenewhybridseries,completelineofsolderreworkstations, a complete range of Hotflow reflow soldering ovens, lead free wave solderingmachinesforlowtohighvolumeproductionrequirements,andtheVersaflowlineofselectivesolderingsystems.ERSAhasexpandeditsproductrangebyscreenprintersforsolderpasteapplicationsonthePCBswith100%in line inspection.
ESSEMTEC USA 1617816NorthDelseaDrive,Suite308Glassboro,NewJersey08028Phone:[email protected]: www.essemtec.com StephenPollock,VPofSales +1856-218-1131,[email protected] StephenPollock,VPofSales +1856-218-1131,[email protected] is a market leader in manufacturing flexible production systems for industrial users. Essemtec has been developing, manufacturing and marketingequipmentandmachinesforallprocessesintheelectronicsindustrysince1991:printers,dispensers,pick-and-placeandsolderingsystems. Manual, semiautomatic and fully automatic systems are available. The range of products also includes transportation and storage systems, as well as software solutions for planning, simulation optimization and documentation of manufacturing. All Essemtec systems are optimized for maximum flexibility. New Product
EuroAsia Semiconductor SupporterHannay House39ClarendonRoadWatford,Herts,WD171JAUnitedKingdomPhone:[email protected]: www.euroasiasemiconductor.com Martin Jennings, Sales Executive +44192369022x011,[email protected] Shehzad Munshi, Account Manager +44192369022x011,shehzad.munshi@angelbc.comEuroAsiasemiconductorisuniqueasitlooksspecificallyatthegrowingopportunities in the European and Asian markets. Europe’s long tradition of research and development expertise and the Asian region is the world’s key manufacturing zone. EuroAsia semiconductor is a magazine focusing exclusivelyonequipment&materialsforthemicroelectronicsproductionindustryinEuropeandAsia.Thecoreeditorialcoverage-equipmentandmaterials technology for the manufacturing and processing of semiconductor wafersintointegratedcircuits(includingICdesign).Alsosolar-international.ne.
Europlacer North America 30155804BreckenridgeBoulevard,SuiteETampa,Florida33610Phone:+1813-246-9500Web: www.europlacer.com JohnPerrotta,VicePresident +1267-884-6760,[email protected] Chris Ebborn, Technical Support Manager +1813-246-9500,[email protected] designs and manufactures a comprehensive range of highly flexibleSMTpick-and-placesystemsfortheglobalelectronicsindustry.Europlacer North America attributes its strong growth to a commitment to its corevaluesofcustomer-drivenproductinnovationandgenuineintegrityinallits business activities.
Excellon Automation 212120001SouthRanchoWayRanchoDominguez,California90220Phone:[email protected]: www.excellon.com Warren Wong, Business Manager +1310-668-7731,[email protected] Bailey Su, President +1310-668-7735,[email protected],featureshigh-technologymechanicalandlaserequipment.AdvancedCNCdepth-controltechniquesallowhighprecisionmicrovia and blind via drilling of High Density Interconnect (HDI) PCB. Excellon’shybridlasertechnology(UVandCO²)ismostflexibleforblindviadrilling,cutting/routingandmicro-machining/repairapplications.
New Product
Exopack Advanced Coatings 2323700CrestdaleStreetMatthews,NorthCarolina28105Phone:+441978660241Web: www.exopackadvancedcoatings.com Gwen Simms, Marketing Communications +441978660241,gwen.simms@exopack.comComplexcoatingsforhigh-performanceelectroniccomponentsincluding:Phototool&ArtworkProtectFilm,ConductiveElectrodes,InteractiveWhiteBoards, Current Collectors, Photoresist and Special Adhesives.
Fancort Industries, Inc. 114631FairfieldPlaceWestCaldwell,NewJersey07006Phone:[email protected]: www.fancort.com Ron Corey, CEO +1973-575-0610x217,[email protected] and Integrator for manufacturing solutions including robotic soldering, hot bar bonding, depaneling, robotic screw fastening, pneumatic andservopresses,SMTLeadFormingEquipmentandServicesandracksforPCB handling. New Product
FASTechnologies 21179 HickoryIrvine, California 92614Phone:+1949-551-4135Web: www.fastechnologies.com Ofer Ton, President +1949-551-4135,[email protected] SteveWester,VPApplications +1763-263-0611,[email protected] specialized in custom solutions to drill and rout applications.OurproductsincludetheDNCUltraServer,NC-CAMRoutandDrill, SmartParts Classics, monitoring and Cassetting. We are the PWB Drill &Routexperts.Ifyouhavedrillorroutissuecallus.
FCT Assembly 6121309North17thAvenueGreeley,Colorado80631Phone:[email protected] Web: www.fctassembly.com Jeremy Glanzer, Marketing +1970-214-4854,[email protected] KatieCooper,Sales +1970-218-8541,[email protected] Assembly consists of three divisions: FCT Solder, Fine Line Stencil, and A-Laser.WithnumerousfacilitiesintheUnitedStates,weareoneoftheelectronicsindustry’sleadingmanufacturersoflead-freesolderproducts,superiorqualitystencils,andprecisioncutparts.AtFCTAssembly,wesetourselves apart from our competitors by continuously studying new products and processes in order to uphold our reputation as a leader in technology. We have created a simple ordering process so call, email, or visit our online storetoaccesstheindustry’shighestqualityassemblymaterials.
97
Booths400-999locatedintheSailsPavilion(UpperLevel)•Booths1000+locatedinHallsA–C(GroundLevel)
FEASA 3705Holland Road, National Technology ParkCastletroy, Co. Limerick IrelandPhone:[email protected]: www.feasa.ie Tony O’Mara, Sales Manager +35361330333,[email protected]’srangeofLEDAnalysersarepowerful,fast&easytousetestsolution to measure the color and intensity (brightness) emitted by Light EmittingDiodes(LEDs)&otherlightingdevicessuchasLCDDisplays.Thesystems provide information about the Colour, RGB, Hue, Saturation, CIE xy Chromaticity&relativeintensityforupto20differentlightsourcesatthesame time in less than a second. The LED Analyser is used globally by all of thelargestcontractequipmentmanufacturers&automotivesubcontractorsaswellasthemostsignificantelectronics&technologicalcompaniesworldwide.
Finetech (parent co. of Martin) 30208380SouthKyrene,#110Tempe, Arizona 85284Phone:[email protected]:www.finetechusa.com Robert Avila, Sales Manager [email protected]’sreworksystemsandprecisionbondersofferindustry-leadingmachinespecifications.Advancedreworksystemsfor01005s,BGAs,shields,flip chip, POP, memory devices, and more. FINEPLACER Core is a versatile hot-gasreworksystemforthecompletereworkcycle.Stand-alonemini-oven unit for easy reballing of BGAs and CSPs or QFN solder bumping. The hybridExpert10.6reworksystemcombinesinfraredandconvectionheatingtechnologiesforunmatchedtemperatureuniformity.Manual&automatedbonderswithplacementaccuracydownto±0.5micronforIC’s,opto,MEMs,flip chip. New Product
Fischer Technology, Inc. 1703750MarshallPhelpsRoadWindsor,Connecticut06095Phone:[email protected]:www.fischer-technology.com Paul Lomax, Director of Marketing +1860-683-0781,plomax@fischer-technology.comFischerisaninnovativeleaderinthefieldofnon-destructivecoatingthickness measurement, material testing, and material analysis instrumentation. Fischer’s new generation of instruments utilize an energy dispersiveX-rayfluorescenceanalysis(EDXRF)method.Themeasurementand control software allows for the simultaneous thickness measurement and analysis of even complex coating systems, with or without calibration standards. Fischer has instruments for the analysis of jewelry and precious metals and also the analysis of hazardous substances in electrical and electronicequipment.
Fisnar Inc. 340015 Corporate DriveWayne,NewJersey07470Phone:[email protected]:www.fisnar.com StephenKohnle,SalesManager +1973-646-5044x1104,[email protected] Mark Sorensen, Technical Sales Administrator +1973-646-5044x1105,[email protected] and supplier of automation systems, robots, valve, single part and dual part dispensing including precise fluid dispensing technologies for electronic, pharmaceutical, medical and aeronautic industries.
New Product
FKN Systek 2919115 Pleasant StreetMillis,Massachusetts02054Phone:+1508-376-2500Web: www.fknsystek.com KlausHeimann,President +1508-935-2282,[email protected] Werner Christ, Sales Manager +1508-376-2500,fkn@fknsystek.comFKNSystekdesignsandmanufacturestoolsandequipmentfortheelectronicsindustry.Wesupplyafulllineofdepanelingequipmentusedforsingulatingfullyloadedpre-scoredandtabroutedPrintedCircuitCards.ThisincludesPLCcontrolledmulti-bladesaws,benchtoprouters,punchesandautomatedandhandoperatedcircularbladedepanelizersforpre-scoredboards. We also provide PCB racks and trays for in process board storage. NewfromFKNSystek,RectangularHighPowerConnectorsandDIN41612,DIN41617Connectorsfrom2ESyscom.
FLEXcon 4201FLEXconIndustrialParkway,Office4Spencer,Massachusetts01562Phone:+1508-885-8300Web:www.flexcon.com/ KenKoldan,BusinessDevelopmentManager +1815-874-6734,[email protected] Ron Ducharme, Product Manager +1508-885-8417,[email protected],laminatingandfinishingof durable materials used in graphics applications, electronics and new products. Through a culture of curiosity, flexibility and a drive for excellence, FLEXconisthetrustedpartnertoawiderangeofcompaniesfromprintersand fabricators to engineers and designers developing products for existing andemergingmarkets.HeadquarteredinSpencer,MA,thecompanyhas operations throughout North America and Europe with distribution worldwide. New Product
FlexLink Systems, Inc. 24456580SnowdriftRoad,Suite200Allentown,Pennsylvania18106Phone:[email protected]: www.flexlink.com Pat Ortiz, National Sales Manager, Indirect Sales +1561-346-9511,pat.ortiz@flexlink.comBasedonouruniqueapplicationexperienceandglobalnetwork,weprovideinnovative,profitable,andqualityautomationsolutionstodemandingworld-leadingcustomers.FlexLink’sspecialtyisProductionLogistics,definedasensuring that each machine and workstation is fed with the right product, quantity,andqualityattherighttime.Thesolutionconsidersintelligentvalueaddingprocessesandeliminationofnon-valueaddingones.Weoffercustomsolutions,standardmodules,andsoftwarethatallowsforefficient,variable, and progressive production flow throughout the process.
FocalSpot, Inc. 30099915 Businesspark Avenue, Suite ASanDiego,California92131-1130Phone:+1858-536-5050Web: www.focalspot.com FrankSilva,VicePresident,Sales +1858-536-5050x111,[email protected] FredSchlieper,President/CEO +1858-536-5050x112,[email protected],Inc.isaproviderofaffordablehigh-qualityBGA/SMTinspectionand rework solutions to the SMT electronics assembly, IC Assembly and the Industrial/Automotive/MedicalAssemblymanufacturingindustryworldwide.
EX
HIB
ITO
RS
98
www.IPCAPEXEXPO.org
Exhibitors Listing
Fuji America Corporation 3228171CorporateWoodsParkwayVernonHills,Illinois60061Phone:+1847-913-0162Web: www.fujiamerica.com Scott Wischoffer, Marketing Manager +1847-821-2405,[email protected]’snewestdevelopmentsinequipmentandtechnologyforsurfacemountassembly.TheNEWNXTIIcisthesmallestfootprint,highestoutputplacement machine available. With a depth of only 4.65 feet and a rated speedofupto27,500cph,permoduleandallthefeatures&functionsofthestandardNXTII.WewillalsointroducetheNEWIH3SolderInspectionHeadfortheNXTII/NXTIIc.CometakealookattheAIMEX(Expandable,Modular,all-in-onePlacementsystem)andtheNewNXTPM25(AdvancedSmallIntelligentPrintingStation)andtheNEWJetDispenseHead.Booth#3228See you there! New Product
Gardien Services USA Inc. 8135289NEElamYoungParkway,Suite120Hillsboro,Oregon97124Phone:[email protected] Web: www.gardien.com RickMeraw,SeniorVicePresident,USA +1416-992-4089,[email protected] JasonPosey,DirectorSales&Service,NorthAmerica +1503-705-7596,[email protected] Group is the world’s largest provider of independent testing solutions to the PCB industry. Gardien has 26 facilities located throughout Asia,NorthAmericaandEurope.Our600employeesservecustomerssupplying the automotive, defense, telecommunications, computer and industrial markets. Quality Assurance Solutions that go beyond the surface oftheboardGardien’ssolutionsinclude:Electricaltesting,Flyingprobe/Gridtesting,4wirekelvin/Hi-Pottesting,Fixturing/Dedicatedfixturing,Faultidentificationandrepair,CAMServices,Scanning,EquipmentandCustomerCare. New Product
GE Measurement & Control 82950IndustrialParkDriveLewistown,Pennsylvania17044Phone:[email protected]:www.ge-mcs.com/phoenix David Lehmann, Lead Application Engineer +1661-310-0443,[email protected]|x-rayistheproductlineofGEMeasurement&Controlformicro-andnanofocus2DX-rayelectronicsinspectionaswellasindustrialcomputedtomography (microCT and nanoCT®).High-resolutionX-raytechnologyisusedinfailureanalysisandproductionqualitytestingofelectronicdevices,e.g.solderjointinspection.Anymaterialflawandqualitycharacteristicaffectingtheshapeofsolderjointscanbedetected.GEMeasurement&Controlprovidesafullrangeof2Dand3DX-rayinspectionsolutionsincludingtheadvancedfullyautomatedµAXIinspectionsoftwarephoenixx|act.
New Product
Glenbrook Technologies, Inc. 265011 Emery AvenueRandolph,NewJersey07869Phone:+1973-361-8866Web: www.glenbrooktech.com StevenZweig,VicePresident,Sales +1973-361-8866x104,[email protected] Glenbrook Technologies will be demonstrating our line ofrealtimex-raysystemsforinspectionofassembledpcboardswithBGAs,multilayer pc boards and electronics components to verify component authenticity.GlenbrookTechnologieshasover2,000installationsofoursystemsin50countriesthroughouttheworld.WehaveofficesintheUSandHongKong.
Global PCB Marketplace BinMei LinFutian DistrictShenzhen, GuangdongPR of ChinaPhone:[email protected]: www.purchasepcb.com David Cheung, Advertising Sales Manager [email protected],GlobalPCBMarketplaceMagazineand Purchasepcb.com are Dedicated to Providing PCB Sourcing Services for GlobalPCBBuyers,Sofar,Morethan14,950QualifiedPCBBuyershavebeen our Magazine Subscribers, and the Great Majority of them Insisted on Sourcing More Products from our Bimonthly Magazine and Online e-Ads.MoreFocusedonGlobalPCBPurchasingSectorthananyOtherMedias,wealsoprovideCost-efficientAdvertisingServiceforPCBandFPCManufacturers.AdvertiseinourMagazineand/orWebsite,youcanAttractMore Prospective Buyers. New Product
Global SMT & Packaging 507CrownHouse,72HammersmithRd,Hammersmith, London, W14 8THUnitedKingdomPhone:[email protected]: www.globalsmt.net TrevorGalbraith,Editor-in-Chief +1239-245-9264x101,[email protected]&PackagingcontainsauthoritativetechnicalarticlesonpracticalissuesaffectingSMTassemblyandpackaging.Visitourstandandcollectyour free copy. Distributed globally, it has a separate print and electronic circulationtotheUS,Europe,China,KoreaandSouth-eastAsia,enablingcompaniestotargettheiradvertisingregionallyorglobally.GlobalSMT&Packaging also produces a daily international newsletter. New Product
GOEPEL Electronics 24509737GreatHillsTrail,Suite170Austin,Texas78759Phone:[email protected] Web: www.goepelusa.com David Whetstone, Director North American Sales +1512-782-2500,sales@goepelusa.comInadditiontoindustry-leadingAutomatedOpticalandX-RayInspectionsystems(OptiConAOIandAXI),GOEPELElectronicsoffersaward-winningJTAG/BoundaryScansoftware(SYSTEMCASCON)andhardware(SCANFLEX),includingtoolsforJTAGbasedProcessorEmulationTest(VarioTAP)andchip-embeddedinstrumentation(ChipVORX),andavarietyofservices. New Product
Gordon Brush Mfg. Co., Inc. 17016247RandolphStreetCommerce,California90040-3514Phone:[email protected] Web: www.gordonbrush.com Arcie Lockett, Accounts Representative +1323-724-7777,[email protected],000stockandcustombrushstylesforthe ESD, manufacturing, and aerospace industries. We expanded our line of stock brushes and also own Milwaukee Dustless Brush, a leader in the janitorialmarketplace,JEK,aleaderintheprintedcircuitboardconditioningindustry and Redtree Industries, a leader in paint brushes for the Marine industry.
99
Booths400-999locatedintheSailsPavilion(UpperLevel)•Booths1000+locatedinHallsA–C(GroundLevel)
GPD Global, Inc. 2535611 Hollingsworth StreetGrandJunction,Colorado81505Phone:[email protected]:www.gpd-global.com ChristianVega,SalesManager +1970-245-0408,[email protected] SvenWedekin,VP/GM +1970-245-0408,sven@gpd-global.comManufacturerofprecisionautomatedfluid-dispensingsystemsforadhesives,solderpaste, soldermask, conductive and nonconductive materials, LED Encapsulation,glob-top,underfill,dam/fillandmore.InnovativePCDcontinuously volumetric dispense technology for low to high viscosity media. No drip or drool even with water at high pressure. May be installed on our system or integrated into yours. Other products include axial and radial lead-formersandSMTTapePeelBackForceTester. New Product Zone
New Product
GSC 1715714ShepherdDriveGarland,Texas75042Phone:+1972-494-1911Web: www.gscusa.net Britt Smith, President +1972-494-1911,[email protected] EricNelson,ChiefOperatingOfficer +1972-494-1911,[email protected]:2008certifiedandITARregisteredmanufacturerprovidingprecisiontoolingandfixtures(wave,reflow,insertionandmuchmore)withunmatchedquality,engineeringandleadtimes.Toexperiencethe GSC DIFFERENCE just visit our website at www.gscusa.net or call us at 1-800-PALLETtogetyourfixturesolutiontoday!
Hamamatsu Corporation 3719360FoothillRoadBridgewater,NewJersey08807Phone:[email protected]: sales.hamamatsu.comHamamatsu Corporation, the North American subsidiary of Hamamatsu PhotonicsK.K.(Japan),offersmicrofocusX-raysources(MFX)andX-rayline scan cameras for nondestructive inspection of printed circuit boards. Our line scan cameras are available in various pixel pitches. We also offer X-raytime-delay-integration(TDI)linescancameraswithhighersensitivityand resolution. For failure analysis testing, we offer various systems such as photoemission and thermal emission microscopes, as well as thermal (OBIRCH) and photoelectrical (OBIC) laser stimulation systems.
Heller Industries 32184VreelandRoadFlorhamPark,NewJersey07932Phone:+1973-377-6800Web: www.hellerindustries.com Marc Peo, President +1512-567-4371,kvirden@hellerindustries.comMK3.5modelwiththelowestNitrogenandelectricalconsumption!NEWFlux Separation System provides Maintenance Free operation with Self Cleaningmodemaximizesup-timeandgeneratesmorerevenue!100%Forced Convection Reflow Soldering and Curing systems are Lead Free compliant and provides the best Delta T and lowest cost of ownership available.
Henkel Electronic Materials LLC 271114000JamboreeRoadIrvine,California92606Phone:[email protected] Web:www.henkel.com/electronics Aida Nasr, Marketing Communications +1714-368-8003,[email protected] ElaineKyle,MarketingSpecialist +1714-368-8018,[email protected]’s leading brands of Ablestik, Acheson, Hysol, Loctite and Multicore have long been recognized as the product brands to trust for printed circuit board assembly applications. With a broad portfolio of materials including surface mount adhesives, printed inks, advanced flux chemistries, traditional tin-leadandhighperformancelead-freesoldersolutionsaswellasCSPunderfillsandboardprotectionmaterials,Henkel’sadvancedformulationsensuremaximumprocessabilityandreliablein-fieldperformance.
HEPCO, Inc. 2644150SanLazaroAvenueSunnyvale,California94086Phone:[email protected]: www.hepcoblue.com Tim Hoffman, President +1408-738-1880,[email protected] Tim Hoffman, President +1408-738-1880,[email protected];LeadCuttingandFormingequipmentforaxialcomponents,transistors,capacitors,DIPs,SIPs,crystaloscillators and LEDs. Able to process parts from tape and reel, tube, card or bulk; PCB depaneling machines for routed PCBs.
Heraeus Materials Technology 3444ContactMaterialsDivision-AssemblyMaterialsHeraeusstrasse12-14Hanau,Hessen,63450Germany Phone:[email protected]:www.heraeus-contactmaterials.com Julia Hoefling, [email protected]
Hesse & Knipps 3345225 Hammond AvenueFremont,California94539Phone:[email protected]:www.hesse-knipps.com Joseph Bubel, President +1408-436-9300,[email protected] Frank Rondinelli, Director of Sales +1724-654-6454,[email protected]&KnippsGmbHdesignsandmanufactureshighspeedfinepitchwedgebonders,heavywirebondersandcomplementaryequipmentforsemiconductor backend assembly. Fully automatic wedge bonders handle both thin wire bonding and heavy wire bonding applications with aluminum, goldandcopperroundwirefrom12.5micron(.0005)to500microns(.020)indiameter,plusribbonwirefrom6x35micronsupto.3x2mm,includingHCRTM (High Current Ribbon). Integrated pull and shear test; advanced setup; PiQCProcess-integratedQualityControlsystemforreal-timeproductioncontrol.
EX
HIB
ITO
RS
100
www.IPCAPEXEXPO.org
Exhibitors Listing
HIROX-USA, Inc. 3406100CommerceWayHackensack,NewJersey07601Phone:[email protected]:www.hirox-usa.com Hideyuki Masui, Sales Manager +1201-342-2600,[email protected] Yasuo Monno, Technical Sales +1510-489-2500,monno@hirox-usa.comHIROXinventedthefirstdigitalmicroscopeovertwentyyearsagopavingtheroadfornewinnovativemicroscopy.HIROX’shigh-qualityopticalandlightingdesignshavethecapabilityofachievinganexpansivemagnificationrangefrom0x-7000x.Also,HIROX’ssystemsincorporateavarietyoffeatures,including2D/3Dmeasurement,HDR,anti-halation,and2D/3Dtiling.Hirox-USAwillbeintroducingthenewestDigitalMicroscopeSystemfromHirox,theKH-8700. New Product
Hisco 20116650ConcordPlaceHouston,Texas77040Phone:+1713-934-1700Web: www.hiscoinc.com William Bland, Mexico Regional Manager +1858-513-7748,[email protected] AndyBehr,DirectorofMarketing&BusinessDevelop +1713-934-1622,abehr@hiscoinc.comHiscoisa100percentemployee-ownedspecialtydistributorservingtheelectronic assembly and industrial manufacturing markets. With more than 34stockinglocationsthroughouttheUS,Mexico,CanadaandtheCaribbean,we offer local inventory for a variety of materials including adhesives, silicones,tapes,films,precisionhandtools,cleanroommaterialsandmore.Our team of application engineers can improve your manufacturing process and lower your costs with industry approved products, superior technical support, and fast, friendly service.
Hitachi High Technologies America, Inc. 24401375North28thAvenueDallas,Texas75261Phone:+1972-615-9103Web:www.hitachi-hta.com Matt Wyglendowski, National Sales Manager +1972-615-9103,[email protected] Takashi Hirata, General Manager [email protected] High Technologies America, Production Systems Division a world leadingmanufacturerofSMTplacementequipmentwillbeexhibitingtwovariants of our high speed, ultra flexible, modular, Sigma G5 SMT component mounter.InadditionHitachiwillalsobeexhibitingourNT-100programmingmodule,quickchangeofflinesetupstationwithfeedercartaswellasourEG-100off-linelibrarycreationmodule,CPKtestingunitandLISAtraceabilitysolutions.Topre-scheduleademonstration,emailrequeststopsdsales@hitachi-hta.comorcontactyourlocalHitachirepresentative.
Hitachi Via Mechanics (USA), Inc. 2241150CCharcotAve.SanJose,California95131Phone:+1408-392-9650Web:www.hitachi-via-usa.com Sam Sekine, President +1408-392-9650,[email protected] JennyTran,VicePresidentofEngineering +1408-392-9650x215,tjenny@hitachi-via-usa.comHitachiViaMechanicsisyourmanufacturingsolution.Offeringthemostadvanced mechanical drilling and routing systems, as well as industry leadinglaserdrills.FromtheultrafinelineDEdigitaldirectexposureartworkgeneration to our HA hole analyzer with blind via capability, we Inspire the Next.
Hong Kong Printed Circuit Assoc. (HKPCA) 735UnitB,22/F,LegendTower,7ShingYipStreetKwunTong,KowloonHongKongPhone:+85221555123Web: www.hkpca.org MandaWong,AdminOfficer +85221555099,[email protected](HKPCA),establishedinyear2000,isaHongKongbasedtradeassociationdedicatedtopromoteandprotect the right and interests of its member companies in the printed circuit industry. As the number of PCB manufacturers in China continues to grow, HKPCAsupportsandorganizestechnicalandbusinessseminars,training,conferencesandexhibitionsinHongKongandMainlandChinatohelpitsmembers and other industry players to sustain their growth.
Hover-Davis, Inc. 2737100ParagonDriveRochester, New York 14624Phone:[email protected]: www.hoverdavis.com Michael Cyr, General Manager +1585-617-2202,[email protected] Chris Fletcher, Sales Support Manager +1585-617-2154,[email protected]“TheFeederCompany”hasdevelopedandproducedsuperior component feeding technology. Our feeding solutions handle componentspackagedintapeand/ortray,pre-printedlabelsandwaferfeddie.Hover-DavisfeedingsolutionsarecompatiblewithmostmajorSMTplatforms,includingthosefromFuji,Panasonic,UniversalInstruments,ASM,Juki,Samsung,Assembléonandothers.
HumiSeal, Chase Electronic Coatings 1813201ZetaDrivePittsburgh,Pennsylvania15238Phone:[email protected]: www.humiseal.com Jerry Donahue, Sales Manager, the Americas +1412-406-5542,[email protected] JacekKnop,KeyAccountManager +1607-342-8303,[email protected] over 55 years of expertise HumiSeal is the World’s Leading Manufacturer of Conformal Coatings! We offer a complete line of Coating Chemistries,Thinners,Strippers,CleanersandMaskingmaterialstofitallyourConformalCoatingrequirements.HumiSeal’sproductsareamongthe most innovative available in today’s conformal coating arena and are qualifiedtotheindustry’smostrigorousspecifications,includingMilitary,IPCandUL.ThroughourextensivenetworkofDistributors,RepresentativesandGlobal Partners HumiSeal’s full product line is readily available on a global basis.
Huntron Inc. 61915720MainStreet,Suite100MillCreek,Washington98012Phone:[email protected]: www.huntron.com JamesCrosson,VPMarketing&Sales +1800-426-9265,[email protected] has been helping people troubleshoot circuit card problems bymanufacturinghighqualitytoolsthathelpisolatefaultyelectroniccomponents. Huntron developed the Huntron Tracker®, the pioneering troubleshootingtoolthatusespower-offsignatureanalysistoidentifycomponent failures on printed circuit boards. Huntron is also a leader in the development of single and dual head flying probers for use in automating diagnostic PCB test. New Product
101
Booths400-999locatedintheSailsPavilion(UpperLevel)•Booths1000+locatedinHallsA–C(GroundLevel)
I Source Technical Services, Inc. 11315 Rancho CircleLakeForest,California92630Phone:+1949-453-1500Web:www.i-source.com Dora Tuza, Sales Engineer +1949-283-3792,[email protected] David Tuza, General Manager +1949-453-1500,david@i-source.comISourcehasbeeninbusinessfornearly20years.Thesuccess&strengthofthe company are attributed to management’s commitment to client support, productionofhighqualityproductsandtimelydelivery.Ourproductsconsistof:SMTLaserStencils,FramelessStencils,CNC-VMCandLaserfabrication,Fixtures, Carriers, Industrial Mechanical parts, BGA Reballing tools, inspection templates...Micro machining. . Our customers span the aerospace, Electronic, Automotive, Medical industries. Our real objective is cultivate longlastingclient/supplierpartnershipswithgreatsuccess.
I-Connect007 701P.O.Box50Seaside,Oregon97138Phone:+1503-738-6610Web:www.iconnect007.com Barb Hockaday, +1916-608-0660,[email protected](www.realtimewith.com).Watchvideointerviews with industry leaders, read show articles, view our extensive photogalleryandmore.RealTimewith…IPC/APEXisproducedbyI-Connect007,homeofSMTMagazine,SMTOnline,Flex007,MilAero007,PCBDesign007,ThePCBMagazineandPCB007.Theseglobalonlinemagazines are the electronic manufacturing industry’s most comprehensive source for news, articles and original, multimedia editorial. Come see us at Booth#701.www.iconnect007.com.
IBE SMT Equipment 2717318CorporateWoodsDriveMagnolia,Texas77354Phone:[email protected] Web: www.ibesmt.com Steve Hakes, Sales +1281-259-9660x112,[email protected] Jared Garver, Sales +1281-259-9660x111,jared.garver@ibesmt.comForover15yearsIBESMTEquipmenthasprovidedqualitySMTequipmentand service to our valued customers around the world. Whether buying or selling,IBESMTEquipmenthastheresourcesandreputationtocreateasolution that is right for you.
IBL Technologies, LLC 5011086WhirlawayDriveElPaso,Texas79936Phone:[email protected]:www.ibl-tech.com Reyna Mora, Executive Administrative Assistant +1915-929-0355,[email protected] Jochen Lipp, CEO +1915-929-0033,[email protected] more than 25 years, IBL has set its focus on development, production and sales of vapor phase soldering machines. Patented reference technology, SoftVaporPhase(SVP)andSoftVaporTemperatureControl(SVTC)providethehighestquality,repeatability,andflexibility.IBLofferssalesandserviceworldwide.VaporPhaseachievesaverygentleandrepeatablereflowsoldering process due to its excellent heat transfer capability. Our vapor phasesystemsrequirelowelectricity,lowGaldenconsumption,andlowmaintenance, making them a cheaper solution for reflow.
ICAPE Group 195131,ruedesJeuneurs75002Paris,75002FrancePhone:+33158183910Web: www.icape.fr W.GlennColescott,Director,ICAPE-USA +1765-438-9161,[email protected] Thierry Ballenghien, President +33158183910,[email protected] Group is an international Services Provider specialized in the Printed CircuitBoardsupport&procurement.CorporateHeadquartersareinParis,France&ChangAn,China.WealsohaveRegionalofficesinGermany,USA,andBrazil.Weofferacomplete&highlyprofessionalnetworkofPCBfabricatorslocatedinChina,Taiwan,&India.Wehave25+fabricatorsworkingwithus.ThisallowsustoprovideallPCB/FPCtechnologies.ICAPEGrouphasmorethan200employees&partnersaroundtheworldtoprovideourCustomerswithallneededServicestosource“bestvalue”PCBsandFPCs.
Indium Corporation 341534RobinsonRoadClinton,NewYork13323Phone:[email protected]: www.indium.com Patrick Ryan, Continental Sales Manager +1315-853-4900x7581,[email protected] Tim Jensen, Product Manager +1315-853-4900x7568,[email protected] Corporation is a premier materials supplier to the global electronics, semiconductor,solar,thinfilmandthermalmanagementmarkets.Productsinclude solders, performs, and fluxes; brazes; sputter targets; indium, gallium, and germanium chemicals and sourcing; and Reactive NanoFoil®. Founded in1934,IndiumhasglobaltechnicalsupportandfactorieslocatedinChina,Singapore,SouthKorea,theUnitedKingdom,andtheUSA. New Product
Industrial + Specialty Printing Bin11262 Cornell Park DriveCincinnati, Ohio 45242Phone:+1800-925-1110
Inovaxe Corporation 28471015W.NewportCenter,Suite108DeerfieldBeach,Florida33442Phone:+1954-531-1372Web: www.inovaxe.com RonWrable,Marketing/SalesRepresentative +1954-531-1363,[email protected] MaryHuggins,Marketing/SalesRepresentative +1954-531-1363,[email protected] Corporation delivers innovative lean Material Handling and Supply Solutions to the electronics industry. It has developed and sold Material Handling,KittingandMaterialManagementSystemsandInternationalandlow costs parts Supply Procurement Programs. Products are used mainly to streamline material handling and accuracy issues in manufacturing. Product lines include Materials Storage hardware with Basic Systems (Inocart),KittingStorageHardwarewithBasicsystems(Inokit)SupplyChainManagementSystem(Inovision)andaProcurementProgram(Inosource&International Advantage). New Product
EX
HIB
ITO
RS
102
www.IPCAPEXEXPO.org
Exhibitors Listing
Insulectro 203720362WindrowDriveLakeForest,California92630-8138Phone:[email protected]: www.insulectro.com KevinMiller,VicePresidentofSales +1603-629-4402,[email protected] is the leading supplier of PCB materials used to manufacture circuit boards. Insulectro combines its premier product offering with convenient inventory access across the country from 9 stocking locations. Fabrication capabilities, as well as expert customer and technical support services, help youbuildamorecompetitivebusiness.Wedistributebest-in-classproductsfrom DuPont, Isola, LCOA, CAC, Integral Technology and Pacothane. Others include Circuit Foil, Olin Brass, Focus Tech, and Insulectro Express products.
InsulFAB PCB Tooling 2947834HayneStreetSpartanburg,SouthCarolina29305Phone:[email protected]: www.insulfabtools.com Scott Cain, Global PCB Sales Manager +1404-617-9899,[email protected] ChuckCasey,VPofSales +1864-582-7506,ccasey@insulfab.comInsulFabPCBToolingprovidesthehighestqualitycustomtoolingforallyourprocess needs. We can assist in process improvement for every application including,SMT,wave,conformalcoat,depaneling,pressfit,vacuumandhandsolder.Weofferthequickestdeliverytimesintheindustrywith2locationstobetterserveyourneeds.WearecertifiedwithbothISOandITARtoassureyourqualityandsecurity.Visitwww.insulfabtools.comorbooth2947formoreinformation.
Integrated Ideas & Technologies 27016164 West Seltice WayPostFalls,Idaho83854Phone:[email protected]: www.integratedideas.com StephanieHenninger,DirectorofTechnicalServices&Mkting +1208-262-7200,[email protected] Sharon Irvine, Director of Sales +1208-262-7200,[email protected], Inc. is an industry leader in laser cut SMT stencils. In addition, IIT Metal Fabrication Division manufactures steel, sheet metal enclosures, and machined products.
Integrated Process Systems 20182183WestParkAvenueCedarCity,Utah84720Phone:+1435-586-1188Web:www.ips-vcm.com Mike Brask, President +1435-586-1188,[email protected] Travis Houchin, Sales Engineer +1435-586-1188x16,[email protected] of horizontal and vertical conveyorized wet process equipment.Manufacturersofautomaticandmanualplatingequipmentforelectrolisandelectrolyticplatingprocesses.SuppliersofWWTPequipmentandfumescrubbers.Manufacturersoftabletopwetprocessequipment.
Integrated Systems Technology, Inc. 6341802NorthDivisionStreet,Suite213Morris,Illinois60450Gary Rockis, [email protected]
Interconnect Systems, Inc. 401759FlynnRoadCamarillo,California93012Phone:+1805-482-2870Web: www.isipkg.com Mike Laskey, Sales Manager +1805-482-2870,mike.laskey@isipkg.comISIspecializesinhighdensitymodulepackagingandadvancedsystem-levelinterconnect.ISIoffersdesign,qualification&testingcoupledwithfullyintegratedin-housemanufacturing.Capabilitiesinclude:highdensityPCBdesign,finepitchSMT,flipchip,wirebondassembly,ICpackaging,custommolding,over-moldingandautomatedopticalinspection.www.isipkg.com
INVENTEC Performance Chemicals 261126, Avenue Du Petit ParcVincennes,94683FrancePhone:[email protected] Web: www.inventec.dehon.com Rodrigo Sanchez, Mexico Subsidiary General Manager +523338388866,[email protected] AnkeSandraMEUNIER,Communication+PublicRelation +33143987533,[email protected], one of Europe’s leading Performance Chemicals companies, is the high-techindustriesbusinessoftheDehonGroup.h-techindustriesbusiness.Inventec supplies these solutions to three markets: Electronic Assembly: Soldering, Adhesive, Cleaning and protection. Surfaces Technologies: Surfacetreatment,Insulation-FireProtection,Productsandequipmentforthe Wine industry , Low temperature sterilization. Fine Chemicals: Aerosols Formulation, Foams expansion, Synthetic Chemicals and pharmaceuticals.
New Product Zone New Product Sponsor
IPC-2581 Consortium 713C/OCadenceDesignSystems,Inc.270BillericaRoadChelmsford, Massachusetts 1824IPC-2581ConsortiumisagroupofPCBdesignandsupplychaincompanieswhosecollectivegoalistoenable,facilitateanddrivetheuseofIPC-2581intheindustry.ItisdevotedtoacceleratingtheadoptionofIPC-2581asanopen, neutrally maintained global standard to encourage innovation, improve efficiencyandreducecosts.MembersoftheIPC-2581ConsortiumincludeOEMs,EDA/DFM/CAMsoftwarecompanies,PCBfabricators,electronicsassemblers and test companies. The Consortium is open to any PCB design and supply chain company that is prepared to support or is committed to a roadmapforIPC-2581adoption.VisittheIPC-2581ConsortiumBoothtolearnmore about who we are and what we are pursuing.
IPC–Association Connecting Electronics 635 Industries3000LakesideDrive,Suite309-SBannockburn,Illinois60015Phone:[email protected] Web: www.ipc.org Neal Bender, Membership Director +1847-597-2808,Membership@ipc.orgIPCisaglobaltradeassociationserving3100membercompaniesworldwidein the electronics assembly and printed board industries. Through the contributions of our members, IPC supports the industry with standards, education, training, market research, and environmental and government relationsprograms.IPChasofficesintheU.S.,India,ChinaandEurope.Visitthe IPC bookstore and take advantage of special show prices on industry standards and publications and learn how membership can help your company. New Product
103
Booths400-999locatedintheSailsPavilion(UpperLevel)•Booths1000+locatedinHallsA–C(GroundLevel)
Isola Group 20199117AzaleaWayInverGroveHeights,Minnesota55077Phone:+1480-893-6527Web:www.isola-group.com Rich Pangier, Director OEM Marketing +1651-406-9451,[email protected] builds innovative substrate materials for manufacturing circuit boards includingcopper-cladlaminatesandprepregs.Isolaoperates10productionfacilities worldwide. New products: 185HR for Lead Free applications, FR406HRforStdDkLeadFreeApplications,I-Speed-Df-0.0065forHighSpeedDigitalandLeadFreeapplication,I-Tera-Dk2.80to3.45,Df<0.0036forHighSpeedDigitalandBackplaneapplicationsandFR408HRIS-FR408HRonLowDkGlass.OtherProductsinclude;FR408HR,IS415,FR406,370HR,FR408,PolyimideP95&P96,GETEK,NoFloPrepregs,DE156HalogenFreematerial.
ITC Intercircuit 200121625 Grenada AvenueLakeville,Minnesota55044Phone:[email protected]: www.itcintercircuit.com Hubertus Hein, Design Engineer +49894536040,[email protected] Greg Malcolm, Sales Manager +1952-469-2310,greg@itcintercircuit.comITCsuppliesthemostuptodateHoleFillingEquipmentintheindustryaswellasspraycoatingsystems,ovens&handlingequipment.TheTHP35HoleFillingMachinewithnewpatentedfill/vacuumheadscanfillblind&viaholesinONEpass.Newfor2012isourVFS100PluggingMachine.Fillonlytheholesyouwant.Noneedfortapingormasking.Usersofexpensiveconductive ink will want to see this. Please stop by and see why we are the #1holefillingserviceinEurope. New Product
JBC Tools 13039296 Dielman Industrial DriveSt.Louis,Missouri63132Phone:+1866-429-5753Web: www.jbctools.com KathyMorrow,[email protected] +1(866)429-5753,info@jbctools.comMorethan80yearsofexperiencehaveplacedJBCatthetechnologicalforefront of tools for soldering and rework operations in electronics. Innovation,efficiencyandreliabilityarethekeyfeaturesofawiderangeof products which have been designed to satisfy the most demanding requirementsofprofessionals.
Jevco/ABBA Roller LLC. 2109915-26thAvenue,N.W.,#AGigHarbor,Washington98335Phone:+1253-858-2605Web: www.jevco.comJeff Brandman, [email protected]
JMW Enterprises 2901309WestPickleAlleyPOBox130Rushford,Minnesota55971Phone:+1507-864-7477Web:www.jmw-inc.com Brian Ebbinger, Sales +1507-864-7477,brian@jmw-inc.comJMWEnterprisesisafull-servicestockingdealerofpre-ownedelectronicassemblyequipment.Westockawidevarietyofequipmentincludingscreenprinters,wavesolder,reflowovens,aqueouswashes,boardhandlingconveyors, adhesive dispensers and much more.
JNJ Industries 3742290BeaverStreetFranklin,Massachusetts02038Phone:[email protected]: www.jnjcd.com RobertEnterkin,DirectorofSales&Marketing +1508-553-0529x223,[email protected] Carla Robertson, Sales coordinator +1508-553-0529x232,[email protected] manufactures SMT Production Supplies, stencil printer accessories, screenprinteraccessories,electronicandindustrialcleaningproducts.UnderstencilwiperrollsforMPM,DEK,Ekra,andPanasonicprinters,squeegeeblades and holders for polyurethane and metal blades, clean room wipes, lint free wipes, environmentally friendly cleaning solvents, saturated wipes, and aqueouscleaners.Degreasers,rustremovers,handcleaners,andprecisioncleaners.
JOT Automation Ltd. 33519863PacificHeightsBlvd.SuiteASan Diego, California 92121Phone:+1858-678-8930Web: www.jotautomation.com Stefan Adolfsson, CEO +1858-678-8930,[email protected] Automation has a long history in delivering solutions for the manufacturing of electronics, especially PCB handling and handheld devices. Today we service the Telecom, Automotive, Aerospace and Life Sciences industrieswithproductsandsolutionsintheareasof:PCBAssembly-Handling and Depaneling, Test Solutions, Final Assembly, Robotics, and SurfaceFinishing.TheCompanyisheadquarteredinOuluFinland,withglobal presence in 9 countries all over the world.
JPCA-Japan Electronics Packaging & Circuit 840 Association 12-2Nishiogikita3-ChomeSuginami-ku,Tokyo,167-0042JapanPhone:[email protected] Web: www.jpca.org KeiHiguchi,[email protected] was established in 1962 and became as a trade organization under theauthorizationbyMITIin1977.JPCAhasbeenveryactivewithsupportand cooperation of its member companies in the areas of technology, advancement, standardization, studies and researches, management, fair trading, international information exchange, technical seminars, workshops and JPCA shows.
JTAG Technologies 3307111 N. West Street, Suite AEaston,Maryland21601Phone:[email protected]: www.jtag.com Bryant Grand, North American Sales Manager +1949-454-9040,[email protected] Technologies’ products help our customers overcome the test and programming challenges of complex PCBs. Why not choose a system thatover6500customersworldwidedependondaily?Since1993JTAGTechnologies has supplied great value products to test engineering, production and design teams. Only through a process of continuous innovation have we kept our number one position as the world’s most dedicatedboundary-scansupplier.Withaflexibleproductrange,aninternational support network and systems to suit the smallest budgets, you willbegladyouspoketoJTAGTechnologiesfirst.
EX
HIB
ITO
RS
104
www.IPCAPEXEXPO.org
Exhibitors Listing
JTech Solutions Inc. 114812893AlcostaBoulevard,SuiteMSanRamon,California94583Phone:+1408-425-4393Web: www.jtechsolutions.us Scott Dickey, President +1408-425-4393,[email protected] Solutions, Inc. provides leading edge environmental control productsforthesemiconductor,nano-tech,medical,andresearchfields.
New Product New Product Zone
Juki Automation Systems 1137507AirportBoulevard,Suite101Morrisville,NorthCarolina27560Phone:+1919-460-0111Web: www.jukiamericas.com Geron Ryden, Director of Marketing +1919-460-0111,[email protected] Bob Black, President +1919-460-0111,[email protected] help us celebrate our 25th year anniversary in the SMT placement industryandthemilestoneofshippingour25,000thmachine.ThisyearJukiwill demonstrate its latest innovations to include newer and faster placement machines,abroadrangeofLEDplacementequipment,PoP(packageonpackage)technology,andunveilournewSentrySystemthatprovidesreal-time error detection. In addition, Juki will show a new line of products that provide a complete line solution. Such products include screen printers, reflow ovens,wavesoldermachinesandawardwinningselectivesolderequipment.
KEYENCE Corporation 5181100N.ArlingtonHeightsRoad,Suite210Itasca,Illinois60143Phone:[email protected] Web: www.digitalmicroscope.com AndrewKominek,Sr.MarketingSpecialist +1888-539-3623x80219,akominek@keyence.comKEYENCECorporationhaspioneeredthedevelopmentofdigitalmicroscopyforoverthepasttwentyyears,specializinginfully-integrateddigitalmicroscopes,3Dlaserscanningmicroscopesandhigh-speedmicroscopes.TheVHX-1000DigitalMicroscopeandVK-X2003DLaserScanningMicroscope are the latest tools being used for electronics inspection and failureanalysis.Thesesystemsarecapableofcapturingfully-focusedimagesandcanprovide3Dimaging,measurementanddocumentationcapabilities–perfectforchiporboard-levelanalysis. New Product
KIC 242816120WestBernardoDriveSanDiego,California92127Phone:[email protected] Web: www.kicthermal.com MB (Marybeth) Allen, Sales Manager +1858-386-2605,[email protected] Bjorn Dahle, President +1858-673-6050,bdahle@kicmail.comKIChasthelatestAutomatedSystemsforThermalManagement.ThenewKIC24/7Wavebringsinnovativeautomationtowavesoldering:around-the-clockmonitoring,automaticprofiling,SPCcharting,analysis,andproducttraceabilityinasingle,easy-to-useproduct.OurlatestReflowProcessManagementTool,theKICRPI,featurespowerfulsoftwarethatindexesthesinglemostimportantoutputofareflowoven-informationonhowwelltheprofileconformstotherequiredspec.Withournew Reflow Process Index, you gain automated inspection, process control, traceability and optimization. New Product Zone New Product
KM USA LLC 11385951LoebRoad,Suite140Charlevoix,Michigan49720Phone:[email protected]: www.kmusallc.com John Szczepanski, President+1231-237-9060,[email protected] KMUSAoffersPCBPininsertionandsplicecrimpingequipmentforelectroniccomponents,aswellasspecializedsolderingequipment.Wealsoofferafulllineofwireprocessingequipmentincludingcrimpingapplicatorsand presses, wire cutting and stripping machines, fully automated terminatingmachines,andtestingequipment.Crimpingapplicatorscanbebuilt for any terminal manufacturers brand, and include the highest warranty, a spare set of crimping punches and anvils, as well as the lowest price in the industrystartingat$1595.Leadtimeforapplicatorsisgenerally3-4weeks.
New Product
Koh Young Technology, Inc. 1401#1510HallaSigmaValleyBuilding345-90Gasan-dong,Geumcheon-Gu,Seoul,153-802KoreaPhone:[email protected] Web: www.kohyoung.com JD Shin, Senior Manager +82266705000,[email protected] Bora Lee, Manager +82263436112,[email protected],provenbyworldleadingEMScompaniesandelectronicsmanufacturers.Morethan2,600in-lineSIPsystemshavebeeninstalledgloballyduringthelast10years.UsingKohYoung’s measurement accuracy and reliability, help customers optimize their SMT process and improve production line yields. New Product
Kuper Technologies 1907P.O.Box893Concordville,Pennsylvania19331Phone:+1610-620-3795 Brendan Hogan, Managing Director +1(610)620-3795,b.hogan@comcast.netKuperTechnologiesisaproductmanagementcompanywithsalesactivitythroughoutNorthandSouthAmerica.KuperTekfocusissupportingcompanies in the technical and market development of new or emerging technologies. Current partners include Miva Technologies, Seica Test, Front Range Photomask and Rainbow Technology Systems. Products include LEDdirectimagingtechnologies,highdefinitionimagingsystemsformicroelectronics,flyingprobetestequipmentandsolutions,glasscalibrationand imaging masters, and high speed photoresist solutions.
Kyzen Corporation 3242430HardingIndustrialDriveNashville,Tennessee37211Phone:+1615-831-0888Web: www.kyzen.com Debbie Carboni, National Sales Manager, Electronics +1215-498-8856,[email protected] TomForsythe,VPSales +1615-831-0888,tom_forsythe@kyzen.comKyzenprovidesawardwinningcleaningchemistriesforelectronicsandadvanced packaging applications. We offer a broad range of process solutionsrangingfromsprayableaqueouscleaningformulationstoengineeredvapordegreasingsolvents.Kyzenalsohasafullyequippedapplications lab staffed with experts to help with customer process development. All of our products are environmentally friendly and effective in virtually all cleaning systems available today. Our goal is to provide our customerswithintegratedcleaningSOLUTIONS! Sponsor
105
Lackwerke Peters GmbH + Co KG 720HoogheWeg13Kempen,47906GermanyPhone:[email protected]:www.peters-usa.com SvenKramer,ManagerApplicationsTechnology [email protected] Rick Litavis, Service Center North America +1508-870-7272,[email protected],Germanyhasspecialisedinhigh-techcoatingsforthefabricationofPCBs,conformalcoatingsandcasting compounds for the electronics, optoelectronics and photovoltaics industries.Asafull-rangesupplierweareinanoptimumpositiontooffermarket-orientated,customer-specificandprimequalitysolutionsforawholespectrumofrequirements.LackwerkePeters’customerbasefeaturesthemostrenownedcompaniesinaerospace,automotive,trafficengineering,medical, industrial and telecommunications. New Product
LaserJob Inc. 340455FlemingDrive,Unit24Cambridge, ON N1T 2A9CanadaPhone:[email protected] Web: www.laserjob.de Carmina Laentzsch +49814152778-0,[email protected] StefanKleemann +49814152778-0,[email protected] 1992 LaserJob GmbH is producing high grade SMD stencils and deliversthestencilstoelectroniccompaniesworldwide.In2011LaserJobstarted a production facility in Toronto, Canada, to be able to provide rapid and direct service in the strategic markets of America. Product range: NanoWork stencils (nanocoated SMD stencils) for optimized aspect and area ratios,excellentsolderpasterelease,significantlesscleaningcyclesonbottomsideSMDstencils,PatchWorkstencils(step-up,step-down-stencils),waferbumpingstencils,repair/reballingstencils,LTCC/viafillstencils
LCOA 213620322WindrowDriveLakeForest,California92630Phone:[email protected]: www.lcoa.com Rocky Hilburn, Product Manager +1949-587-3303,[email protected] John Lee, Marketing +1949-340-8434,jlee@insulectro.comLCOAisaU.S.basedlaminatorofengineeredcompositepanelsusedtoenhancetheprocessofdrillingultrasmallholesinmulti-layerprintedcircuitboards. LCOA Bullseye®isaunique,innovativedrillregistrationsheetthatoffers the user the best possible drill accuracy on a full range of diameters used in PCB manufacturing. LCOA SlickBack® is a lubricated backup sheet whichreducesdrilltemperaturesandtoolwearwhileimprovingholequalityand throughput. LCOA has a global network of distributors who sell our products to the PCB fabricators.
Lista International 1345106LowlandStreetHolliston,Massachusetts01746Phone:[email protected]: www.listaintl.com JamesAnderson,VerticalMarketManager +1972-740-7888,[email protected] International Corp. is a world leader in the design and manufacture ofinnovative,efficient,modularstorageandworkspacesystems:drawerstorage cabinets and mobile cabinets; a wide range of workbenches and workstations,includingindustrial,technicalelectronic,height-adjustableandassembly/lightmanufacturingworkstations;StorageWall® Systems (astoragesystemcombiningdrawers,shelves,roll-outtrays);accessorysystems;andotheruniquesolutions.
LPKF Laser & Electronics 233512555 SW Leveton DriveTualatin,Oregon97062Phone:+1503-454-4200Web: www.lpkfusa.com LPKFSales +1503-454-4219,[email protected] General Information +1503-454-4200,[email protected]&ElectronicssuppliesafulllineofprototypingandproductionequipmentforthePCBindustryincludingUVlasersforetching,skiving,drilling and cutting of both bare and populated rigid or flexible circuit boards, stencil cutting lasers for the SMT assembly industry, and desktop PCB prototypingequipment. New Product
M+B Plating Racks 22065400VandenAbeeleVilleST-Laurent,QCH4S1P9CanadaPhone:+1514-335-2436Web: www.mbracks.com Howard Brown, CEO +1514-335-2436,[email protected] Max Ferri, Design Engineer +1514-335-2436,[email protected],Clamps&Basketsforallyourplatingneeds.M+Bhavebeendedicated to the PWB Industry since 1986. We are the leaders for all your racking&clampingrequirements.Ourmottohasalwaysbeen“YESWECAN”.Yesterday,today&tomorrowweareheretoserveYou.
MacDermid Inc. 2321245 Freight StreetWaterbury,Connecticut6702Phone:+1203-575-5700Web: www.macdermid.com WarrenKenzie,NationalBusinessManager +1949-232-5719x6827,[email protected] Electronics Solutions is a complete provider of specialty chemical solutions for the printed circuit board and photovoltaics industries. At MacDermid, we know it takes more than innovative, high performance products and superior technical service to help our customers compete and win in today’s marketplace. It takes a total commitment to understanding theirneedsandtheabilitytoprovidetherightsolutions–everytime.Whensuccess is your only goal, you can count on MacDermid.
Machine Vision Products, Inc. 28095940DarwinCourtCarlsbad,California92008Phone:[email protected]: www.machinevisionproducts.com Paul Groome, Sales Manager +1760-438-1138x130,[email protected] Richard Osborne, North American Sales Manager+1614-263-6661,[email protected],Inc.,providethefastestandmostaccurateadvancedAOI,SPIand3Dmeasurementsolutionstoelectronics,SMT,microelectronics, and packaging manufacturers as well as Lean Shop Floor Control.OurAOIsolutionsprovideclass-leadingdefectdetectionforSMTcomponentsincluding01005sandfull3Dlaserbasedpasteinspection.Formicroelectronics environments we provide wirebond, die placement and damage,dietiltandalignment,epoxyunderfill,foreignmaterialinspectionfor defects such as solder or epoxy splatter and dimensional measurements in x, y and z.
EX
HIB
ITO
RS
106
www.IPCAPEXEXPO.org
Exhibitors Listing
Magenta Systems 3001635TouhyAvenueElkGroveVillage,Illinois60007Phone:[email protected] Web: www.magentasystemsonline.com EddieGroves,Sales&ServiceManager +1224-343-5911,[email protected] Jonathan Wol, President +1847-593-9080,jwol@magentasystemsonline.comMagentaSystemsisadistributorofinnovativemanufacturingequipment,processes and technology for the N. America electronics manufacturing market. Our mission is to help electronics manufacturers improve productivity andefficiencyatlowercostsbyprovidinghighperformanceequipmentatentry-levelprices.IncludesAOI,VaporPhase&ConformalCoating.Magenta Systems is a new venture established by the owners of Pillarhouse, manufacturerofAutomatedSelectiveSolderingequipment.Weprideourselvesandplanourbusinessaroundfillingtheuniqueandchallengingneeds of our customers. New Product
Malcomtech International 251826230IndustrialBoulevardHayward, California 94545Phone:+1510-293-0580Web: www.malcomtech.com Tom Fujikawa, President +1510-293-0580,[email protected] Charlie Fujikawa, Technical Support Manager +1510-293-0580,charlie@malcomtech.comMalcomswb-2wettingbalancetesters.Malcompc-10aviscometer.Malcomnewsolderpastemixers.Malcomreflowsimulatorwithcamera.Unitechuc-250mcvinlinepcbsurfacecleaner.Eightechnewinlinereflowovens.
New Product
Manncorp 29072845 Terwood RoadWillowGrove,Pennsylvania19090Phone:[email protected] Web:http;//www.manncorp.com JeffMann,VPSales +1858-490-6266,[email protected] Henry Mann, President +1215-830-1200,[email protected] in 1968, Manncorp specializes in surface mount production equipmentformid-volumePCBassembly,includingflexiblepickandplacesystems,lead-freereflowovens,stencilprinters.reworkandselectivesolderingequipment.Manncorp’s‘TurnkeySystems’arefullyintegratedmanufacturingsolutionsofpre-selectedprinting,placementandreflowequipmentgearedtouserthroughputandbudgetaryrequirements.Through-holeproductsincludelead-freewavesoldermachinesandleadformers.Manncorp’swebsiteshowcasesover300electronicassemblyproducts,withpricing online.
Maskless Lithography, Inc. 19352550ZankerRoadSanJose,California95131Phone:[email protected] Web: www.maskless.com Irene Dunlop, Marketing Communications Manager +1408-433-1861,[email protected] RichardChenoweth,VPofGlobalSales&Marketing +1408-433-1866,[email protected] Company designs and manufactures Digital Imaging systems for the PCB industry, using Texas Instrument’s DLP as a print engine. This technology enablestheuseofstandardphoto-printresistsatproductionspeeds.
Maxpcb, LLC 1822150NorthSantaAnitaAvenue,Suite300Arcadia,California91006Phone:[email protected]: www.maxpcb.com Sunny Hsia, [email protected],low-to-highvolumeoffshorePCBcompany,withU.S.technicalsupportofficesinCaliforniaandFlorida, and manufacturing facilities in Taiwan. We offer high technology, flexibledeliveryandquantity,forawidevarietyofPCBandcomponentproducts at the most competitive price.
Mentor Graphics Corporation 1435 (Valor Division)8005SWBoeckmanRoadWilsonville,, Oregon [email protected]:www.mentor.com/valor Dan Weitzman, Regional Business Development Manager +1781-684-3009,dan_weitzman@mentor.comTheValorDivisionofMentorGraphicsoffersbestinclasssoftwaresolutionsfor all aspects of PCB manufacturing. Our products ensure the highest level ofPCBmanufacturabilityandoptimizedproductionofPCBs.TheValorMSSsuite focuses value in increased materials utilization, manufacturing asset utilization,qualityandassurance.MentorGraphicsistheonlysoftwaresupplierintheworldwithtrueend-toendsolutionsfromproductdesignthroughallphasesofmanufacturing,SMTproduction,testandfinalassembly.Visitusatbooth#1435.
MEPTEC Bin P.O. Box 22MedicinePark,Oklahoma73557Phone:+1650-714-1570Web: www.meptec.org Bette Cooper, President [email protected] (MicroElectronics Packaging and Test Engineering Council) is a trade association of semiconductor suppliers, manufacturers, and vendors concerned exclusively with packaging, assembly, and test. Since its inception over30yearsago,MEPTEChasprovidedaforumforsemiconductorpackaging and test professionals to learn and exchange ideas that relate to packaging, assembly, and test.
MET Associates 2423140Mt.HollyBypass,Unit10Lumberton,NewJersey08048Phone:[email protected]: www.metassocs.com JohnReed,VPSales +1516-790-4452,[email protected] FredCox,ExecutiveVicePresident +1609-820-7631,[email protected],MN,NC.LaserCutStencils,ElectroformedStencils,LaserReworkStencilsaswellasChem-Etched Stencils. Complete CAD services. Also, a distributor for the cost effective Wizard Quick Mount frame system, the Space Saver system, and a licenseddistributorfortheDEKVectorGuardsystem. New Product
Metal Etch Services 4001165LindaVistaDrive,Suite106SanMarcos,California92078Phone:+1760-510-9476Web: www.metaletchservices.com
107
Booths400-999locatedintheSailsPavilion(UpperLevel)•Booths1000+locatedinHallsA–C(GroundLevel)
Metal Finishing Bin 360ParkAvenueNewYork,NewYork10010Phone:+1212-633-3100Web:www.metalfinishing.com Larry Post, Advertising Sales Manager +1212-633-3191,[email protected] Jason Awerdick, Marketing Manager +1212-633-3103,j.awerdick@elsevier.comMetalFinishingMagazineistheleadingpublicationforfinishersincludingthose involved in plating and coatings for electronics and printed circuits.
Metro SMT Ltd. 3004Gatwick Airport HQ, Cherry Tree HouseSmallDole,WestSussex,BN59XJUnitedKingdomPhone:+1866-789-7841Web: www.metrosmt.com David Cotton, Sales Director +1866-789-7841,[email protected] technology behind the world’s best SMT nozzles will be on display. Including the revolutionary ceramic material ‘Roxton’ for longer life and less-wear.BrandnewrangesoflowercostspecialistfeedersforallSMTmachines.
Metrohm USA 21086555 Pelican Creek CircleRiverview,Florida33578Phone:+1800-727-6768Web: www.metrohmusa.com MichaelKubicsko,BusinessManager-Electrochemistry +1800-727-6768x2262,[email protected] RiteshVyas, +1800-727-6768,[email protected],includingtheCVS/CPVS797Computraceforbenchanalysisofbrightener/carrierandtracemetals. Also available: manual to automated Metrohm titration systems andProcessLabat-lineanalyzersfordeterminationofinorganicbathcomponents; Eco Chemie Autolab electrochemistry systems for bath design andconfiguration.
MicroCare Corporation 601595 John Downey DriveNewBritain,Connecticut6051Phone:[email protected]: www.microcare.com Jennifer Poudrier, Marketing Manager +1860-827-0626x3017,[email protected] HeatherGombos,VP,BusinessOperations +1860-827-0626,[email protected]® precision cleaners can make a difference for your company by:Reducingmanufacturingcosts,Improvingproductionefficiencies,Maximizing throughput while reducing waste and defects, Enhancing product stewardship,100%ofyourparts,100%cleaned.PleasevisitusatBooth611andaskforustoshowyouademonstrationofourhigh-performancecleanersthatlowerscost,savestime,boostsqualityandreduceswaste,perfectly clean all the time.
MicroCraft 21298220-CBelvedereAvenueSacramento, California 95826Phone:+1916-273-1601Web: www.usamicrocraft.com Adelino Sousa, President +1916-273-1601,[email protected] of High Speed Moving Probe Testers, TDR and Latent Defect Testers. DLP Direct Legend Printers with Barcoding capability. MicroCraft alsooffers2TechnologyCentersinUSAforTestingServices.
Micron Laser Technology 230822750N.W.WagonWay,SuiteAHillsboro,Oregon97124Phone:+1503-439-9000Web: www.micronlaser.com Sig Jensen, CEO +1503-439-9000x205,[email protected] Troy Dowdy, Sales Manager +1503-439-9000x20,[email protected] material processing contract manufacturer: High speed microvia drilling (copperanddielectric),skiving(flexcircuitsandotherthinfilmsandcavities),cutting&drilling(flexcircuitsandhybridcircuits),soldermaskrepair,cutting&drilling(LTCCtape,thinmetal,rubber&plastics).
Micronic North America 19454188thStreetSE,UnitC8Loveland,Colorado80537Phone:+1760-458-4818Web:www.micronic-na.com ConradPearson,VP/GeneralManager +1760-458-4818,[email protected]
Microscan Systems Inc. 2707700SW39thStreetRenton,Washington98057Phone:+1425-226-5700Web: www.microscan.com Microscan Systems, Customer Care Team +1425-226-5700,[email protected] is a global leader in the design and manufacture of advanced Auto IDandMachineVisionsolutions.Microscanproductsserveabroadrangeofelectronics applications and have received global recognition for their high qualityandleadingedgetechnology.Fromreliabledatacapturetocomplexvisual inspection, Microscan is the preferred choice of major electronics companies around the world. New Product
MicroScreen, LLC 33151106SouthHighStreetSouthBend,Indiana46601Phone:[email protected]: www.microscreen.org Holly Wise, National Sales Manager +1574-232-4358,[email protected] LLC offers laser cut and electroformed stencils for solder pastedeposition.OptionsforLead-Freestencilsincludehigh-nickelmetaland‘green’identification.Allstencilsare100%inspectedusingScanCheckAOI. The company is a distributor of Wizard frame systems and Space Saver frame systems. Additional products include MicroWeld stencils, thick filmscreensandlargeformat/solarscreens.WeareanITARRegisteredcompany. New Product
Microtek Labs 18001435AllecStreetAnaheim,California92805Phone:+1714-999-1616Web: www.thetestlab.com Mike Shepherd, President +1800-878-6601,[email protected] Russ Sheperd, Laboratory Manager +1800-878-6601,[email protected] Laboratories specializes in printed wiring board and laminate conformancetestingandfailureanalysis.MicrotekisISO9001:2000registered,ULcertificated,andDSCCrecognizedtestfacilityservingtherequirementsofthePCB/PCBs,PCBassemblies,PCBMaterials,Laminates,Contract Mfrs and OEMs. Test capabilities include visual and dimensional inspection; electrical, mechanical, and environmental testing; as well as PCB/PCBAfailureanalysis,cross-sectionanalysis,andIPCtraining.TestingtoMIL-PRF-55110,MIL-P-50884,MIL-PRF-31032,ASTMandIPCtestmethods. New Product
EX
HIB
ITO
RS
108
www.IPCAPEXEXPO.org
Exhibitors Listing
Mid America Taping & Reel 1129121 Exchange BoulevardGlendaleHeights,Illinois60139Phone:[email protected]: www.matr.com EdWalton,VicePresident +1630-629-6646x223,[email protected] BarbPauls,Owner/President/CEO +1630-629-6646x224,[email protected],Mid-AmericaTaping&ReelingInc.hasbeentheworldleader in the electronic component automation preparation. Mid America provides SMD, radial and axial taping, lead forming, programming, baking, and dry packing. Mid America manufactures SMD Carrier tape, and a complete selection of take up reels. Mid America distributes all materials usedintheseprocesses,manufacturedintheUSA.MidAmericaisISO9001:2000andWBEregistered.
Mirae Corporation 160914526LeeRoad,Suite400Chantilly,Virginia20151Phone:[email protected]: www.apexfa.com Matthew Conway, Director +1240-293-2419,mconway@apexfa.comSince1983Miraehasbeenproducingleadingedgeequipmentandlinearmotor technology used in almost every facet of manufacturing. Since 1998 Miraehasbeenmanufacturingthehighestqualitypickandplacemachineswithspeedrangesfrom8000through42000CPHwithlarge-boardandLEDspecificmodelsavailable.MiraehasenteredintoanagreementwithApex Factory Automation. This collaboration leverages proven resources and technology to provide Apex customers with superior products and exceptional service. Apex also offers: SJ Inno Tech Screen Printers, board handling, and TSM Reflow Ovens.
MIRTEC Corp. 36373MorseRoad,Unit2AOxford,Connecticut6478Phone:+1203-881-5559Web: www.mirtecusa.com Brian D’Amico, President +1203-881-5559,[email protected] Robert Horowitz, Regional Sales Manager +1203-217-0271,[email protected],andin-lineautomatedopticalinspection systems (AOI), and Solder Paste Inspection systems (SPI). Among the many strengths are the ease of programming and the flexibility to be used anywhere in the manufacturing process.
ML System Inc. 11281860RenaissanceBoulevardSturtevant,Wisconsin53177Phone:+1262-884-4669Web:www.ml-system.us Alvie Stephenson, General Manager +1262-884-4669,als@ml-system.comMLSystemInc.providesindustrialhumidificationsolutionsforEOS/ESDcontrol. Consistently controlled RH at optimum levels results in dramatic improvement or elimination of dry air problems. Increased productivity and lowerwasteleadtoimprovedprofitabilityandqualityforyou.
MPO/MedicalDeviceNow.com Bin70HilltopRoad,3rdFloorRamsey,NewJersey07466Phone:+1201-880-2243Web:www.mpo-mag.com Howard Revitch, Group Publisher +1201-880-2243,[email protected] Patrick Browne, Online Sales Manager +1908-859-8431,[email protected] Product Outsourcing covers all aspects of medical device and outsourcing from partnership issues to regulatory concern to design and manufacturing complexities. Please sign up for a free subscription at our website www.mpo-mag.com.MedicalDeviceNow.comdeliversdetailedinformationandprovides timely editorial content and technical articles, in addition to strategic marketingopportunities.Featuresinclude:enhancedcompanyprofilesandproduct/servicereleases,breakingnews,knowledgecenters,expertcolumns,white papers, industry events and a searchable buyers guide.
mta automation inc. 301650-1RiverStreetOldSaybrook,Connecticut06475Phone:[email protected]: www.mtaautomation.com Cliff Bockard, CEO +1860-399-1141,[email protected] automation inc. is a world leader in offering a complete line of automated selective soldering and dispensing technologies covering a wide range of applications. Examples include iron and laser based top and bottomside selective soldering as well as single and two component dispensing. Additionally, the company offers complete integrated and automation solutions for the assembly process. New Product
Multiline Technology 223875RoeblingCourtRonkonkoma,NewYork11779Phone:+1631-249-8300Web: www.multiline.com JohnKidd,[email protected] leading supplier of Registration Systems: Post Etch Punches, Artwork Punches,GlassExposureFrames,PostLaminationX-RayandInspectionandall related tooling and accessories for manufacturing Multiplayer PCB’s. Multiline offers registration.
MYDATA automation Inc. 3429320NewburyportTurnpikeRowley,Massachusetts01969Phone:+1978-948-6919Web: www.mydata.com Brian Duffey, President +1978-948-6919,[email protected] John McMahon, Director Technical Services +1978-948-6919x117,[email protected] automation AB designs and builds SMT placement machines and stencil-freeprintersfortheelectronicsindustry.WithMYDATAsolutionsspecificallydesignedwithleanmanufacturinginmind–youcansavesubstantialtimeinyourproduction.Withuniquemachineconceptsandadvanced software tools, MYDATA represent the intelligent factory of the future. Our mission is to always be innovating in order to satisfy the electronic industry’s need for surface mount technology and services that meetthehighestdemandsintermsofproductivityandquality.
National Graphic Supply 22158730PrestigeCourtRanchoCucamonga,California91730Phone:+1800-779-5657Web: www.ngspcb.com Jon Weins, National Sales Manager +1909-989-5200,[email protected] Graphic Supply is a nationwide distributor for Fuji Photo Plotter Filmsandalso,weoffer2diazofilms.Our14TechnicalSpecialistsprovidea high level of technical support to assure optimum process control for your imaging department. NGS has 9 warehouses to support your supply needs.
109
Booths400-999locatedintheSailsPavilion(UpperLevel)•Booths1000+locatedinHallsA–C(GroundLevel)
Nihon Superior Co., Ltd. 3044NSBuilding,1-16-15EsakaSuita,Osaka,564-0063JapanPhone:+1573-280-2357Web: www.nihonsuperior.com KeithHowell,TechnicalDirector +1573-280-2357,[email protected] Makoto Tonomura, Overseas ManagerWiththesuccessofitsSN100Clead-freesolderalloy,NihonSuperiorhasdevelopedintoaglobalsoldersupplier.Nowinits13thyear,SN100Ccontinues to displace SAC alloys due to its high reliability and cost effectiveness. Nihon Superior continues to expand it soldering product line baseduponthebenefitsofSN100Cwithcompletelyhalogen-freeSN100CP602pasteandSN100C(044)cored-fluxchemistries.SN100Cisavailablethrough Nihon Superior’s worldwide network of subsidiaries and licensees.
New Product
Nikon Metrology, Inc. 361512701GrandRiverBrighton, Michigan 48116Phone:[email protected]: www.nikonmetrology.com KenGribble,Director,X-RayProducts +1480-486-9620,[email protected] Metrology offers the most complete metrology product portfolio, includingX-rayandComputedTomographyinspectionsystemsandstate-of-the-artvisionmeasuringinstrumentsfeaturingopticalandmechanical3Dmetrologysolutions.Theseinnovativemetrologysolutionsrespondtotheadvancedinspectionrequirementsofmanufacturersactiveinaerospace, electronics, automotive, medical, consumer and other industries.
New Product
NIX OF AMERICA 17212674NorthFirstStreet,Suite206SanJose,California95134Phone:+1408-321-8286Web: nixofamerica.com Norm Hasegawa, Sales Engineer +1408-321-8286,nikkonix@ix.netcom.comNikko-RackmagazineshavebecomearecommendedPCBcarrierforautomatedassemblylines.Ourmagazinesemployapatentedrack&pinionadjustmentsystem,enablingquickwidthchangeswhileassuringconstantparallel card guides. All models are vertically rigid for safe board handling. Recently introduced the Power Cyclone, our inline PCB cleaner.
Nordson ASYMTEK 32002747LokerAvenueWestCarlsbad,California92010Phone:[email protected]: www.nordsonasymtek.com BradPerkins,RegionalSalesManager-Southwest +1760-431-1919,[email protected] RoyCiardella,RegionalSalesManager-Northwest +1760-431-1919,[email protected] fluid dispensing, jetting and conformal coating systems from NordsonASYMTEKareidealforprecisionassemblyprocessesforPCBs,LEDs,flatpaneldisplays,automotiveproducts,medical/biotechproducts,solarproducts,semiconductorpackagingandotherelectro-mechanicaldevices.NordsonASYMTEKsetsthepaceofinnovationforbetterdispensingand conformal coating products with Spectrum™ dispensing and coating platforms and DispenseJet® and PreciseCoat™ valves and applicators, all supported by an outstanding global support network. The company is ISO 9001:2008certified.
Nordson DAGE 320848065FremontBoulevardFremont,California94538Phone:+1510-683-3930Web:www.dage-group.com Hal Hendrickson, Sales Manager Americas +1510-683-3930x101,[email protected],theleadingsupplierofX-rayinspectionsystemswillbeshowcasingtheirXD7600NTDiamondandXD7600NTRubyFPX-rayinspectionsystems.TheywillalsohighlightthenewX-Plane™SystemforthefirsttimeintheUSA.Thisrevolutionaryoptionusesaproprietary,patentappliedfor,tomosynthesis,orCTtechniquetocreate2DX-rayslicesinanyplane of a printed circuit board assembly without the need to cut or destroy theboard.Bothsystemsfeatureamaintenance-free,sealed-transmissiveX-raytube,highmagnificationreal-timeimagingandoptionalCTfor3Dmodeling. New Product
Nordson EFD 330040CatamoreBoulevardEastProvidence,RhodeIsland02914Phone:[email protected]: www.nordsonefd.com Nordson EFD LLC (formerly known as EFD, Inc.) is a leading manufacturer ofhigh-qualitysolderpastes,fluxes&precisiondispensingsystems.NordsonEFDSolderisISO9001certified&offersabroadlineofprinting&dispensingsolderpastesforimprovingyields&reducingcostsinelectronics&electro-mechanicalassemblyprocesses.Weprovideapplication-basedsolderproducts,completepastedispensingsolutions&developtechnicalpartnerships with our customers. Our precision dispensing systems apply controlled amounts of assembly fluids used in most manufacturing processes.
Nordson YESTECH 32092747LokerAvenueWestCarlsbad,California92010Phone:+1760-918-8471Web: www.nordsonyestech.com Troy Johnson, Regional Sales Manager, N America +1760-918-8471,troy.johnson@nordsonyestech.comNordsonYESTECHprovidesleadingautomatedAOIandX-RayinspectionsystemswithintegratedYieldEnhancementSolutions.High-speedFXSeriesandBXBenchtopAOIsystemsareconfigurablewith5megapixelcolorcameraimagingtechnology.TheFXSeries’onetop-downand4side-viewingcamerasinspectsolderjointsandverifycorrectpartassembly.TheX3X-Raysystem’sproprietarytechnologyprovidesunsurpassed3DinspectioncapabilityforBGAsandotherhiddensolderjointsondouble-sidedPCBs.AdvancedSPCsoftwareavailablewithallsystemsprovidesreal-timeyieldinformation. New Product
North Star Imaging, Inc. 334219875SouthDiamondLakeRoad,Suite10Rogers,Minnesota55374Phone:[email protected]: www.4nsi.com Sales +1763-463-5650,[email protected] Inspection Services Group +1763-463-5696,sales@4nsi.comNSIisthedomesticleadingmanufacturerofTurn-Key2DDigitalX-rayand3DX-rayComputedTomography(CT)systemsfortheIndustrialNondestructive Testing industry. Established in 1986, NSI’s corporate facilityisheadquarteredinRogers,MN,wheresystemsaredesignedandbuiltbyhighly-trained,innovativeengineers.Inlate2010,NSIwasacquiredbyIllinoisToolWorks(ITW).NSIhasalsojustopenedanewsales,demonstrationandserviceofficeinParis,France. New Product
EX
HIB
ITO
RS
110
www.IPCAPEXEXPO.org
Exhibitors Listing
Novagard Solutions 4285109HamiltonAvenueCleveland, Ohio 44114Phone:+1-216-881-8111Web: www.Novagard.com Craig Strachan, National Sales Manager +1216-881-8111x3344,[email protected] Solutions™, Inc. is a leading supplier of specialty chemical products providing engineered solutions to the automotive, building construction,electrical&electronics,medical,generalindustrialandproductassemblyindustrieswithpatentedinnovativeUVcurablesiliconeproductsspecificallytargetingapplicationsinpotting&encapsulating,gasketing,coatings and inks, along with other electrically or thermally conductive silicone materials. New Product Zone New Product
NPL Process Defect Clinic 5332 Fourth AvenueChelmsford, Essex, CM1 4HAUnitedKingdomPhone:+441245351502Web: defectsdatabase.npl.co.uk BobWillis,Training&Consulting +44012450351502,[email protected] your toughest challenges resolved! Take advantage of the Defect Database Clinic on the show floor in the Sails Pavilion and get free, unbiased help from international consultant and IPC course instructor Bob Willis on allofyourprocess-relatedissues.Bringboardassembliesforexaminationorprocessproblemsfordiscussion.Inspectionequipmentwillassistinunderstanding the process problem and suggested solutions. NEW THIS YEAR! Mini seminars will take place in the booth each day February28–29,11:00am,1:00pmand3:00pmandMarch1,11:00amand1:00pm.
Nujay Technologies Inc. 181626170EnterpriseWay,Suite300LakeForest,California92630Phone:+1949-215-8555Web: www.nujaytech.com Nesh Dholakia, President +1949-215-8555,[email protected] are your Global Connection for Interconnects. Nujay Technologies Inc. is avalueaddeddistributorofPrintedCircuitBoards(PCBs)andLiquidCrystalDisplays(LCDs).WehavestrategicalliancewithhighqualitysuppliersinAsia.WeofferKANBAN,Consignments,StockingandJITtoourcustomersfromourLakeForest,CAoffice/warehouse.AllproductsareinspectedbyIPCcertifiedinspectorsbeforestocking/shipping.
Nutek Americas Inc. 34211811 Lefthand Circle, Suite BLongmont,Colorado80501Phone:+1303-684-0400Web: www.nutekamericas.com ColinDrier,President/CEO +1303-684-0400,[email protected] ValorieMartinez,OfficeManager +1303-684-0400,[email protected], the worldwide leader in automation systems since its inception over 20yearsago,conceptualizesdesignsandmanufacturesrobust/flexibleautomationsystemsandishighlyregardedforitsworldclassquality.Nutek’scorebusinessismadeupofPrintedCircuitBoard(PCB)handlingequipment,Laser marking, and Barcode labeling systems.
Oak Mitsui Inc. 220080FirstStreetHoosickFalls,NewYork12090Phone:+1803-425-7900Web: www.oakmitsui.com JohnAndresakis,VPofStrategicTechnology +1518-668-8088,[email protected] JohnBlaber,SeniorVPofSales&Marketing +1803-425-7948,john.blaber@oakmitsui.comOak-MitsuiisawhollyownedsubsidiaryofMitsuiKinzoku,theworld’slargest manufacturer of copper foils and high performance products for the electronicsindustry.HeadquarteredinCamden,SC,withlocationsinHoosickFalls,NYandRiverside,CA.Oak-Mitsuispecializesinthedevelopmentandproduction of world class performance foils, Aluminum Bonded Copper, and FaradFlex® Buried Capacitance™ materials.
OEM Press Systems, Inc. 2107311SouthHighlandAvenueFullerton,California92832Phone:[email protected]: www.oempresssystems.com Mary Quinlan, Sales Manager +1714-449-7500x35,[email protected] John Copp, President +1714-449-7500,[email protected] Press Systems, Inc. offers vacuum enclosed hydraulic press systems which incorporate the latest lamination technology for high layer count PCBs, FlexibleCircuitryandRigidFlexprovidingaccurate&repeatableprocesscontrol with even pressure application, and superb temperature uniformity, over the entire surface area of the platen resulting in uniform thickness across the entire product. High temp vacuum presses are offered for LCP, Teflonbondingandhigh-tempapplications.
Ohmega Technologies Inc. 18024031ElendaStreetCulverCity,California90232Phone:+1310-559-4400Web: www.ohmega.com BruceMahler,VicePresident +1310-559-4400,[email protected] Dan Brandler, Technical Director +1310-559-4440,[email protected],thepremierembeddedresistivematerial,forover30years.Astheleaderinembeddedresistortechnology,wearecommittedtoproducingtheworld’smostefficientandreliablethinfilmresistivematerial.
OK International 164112151 Monarch StreetGarden Grove, California 92841Phone:+1714-230-2366Web: www.okinternational.com Jerry Simmons, Marketing Manager +1714-230-2366,[email protected] Brian Langley, Director of Sales, The Americas +1770-886-0776,[email protected],theexclusiveproviderofSmartHeat® Technology, willyoufindproductsthatallowyoutotapintouniqueadvantagesovercompetitivesystems.OurOKiandMetcalbrandsminimizeyourtraininginvestment, maximize your applications solutions and boost your productivity, yield and bottom line. Our soldering and desoldering, advanced package rework, fluid dispensing and fume extraction products reflect our philosophy forbest-in-classperformanceandinnovativedesign.Known.Trusted.Quality.That’sOKInternational. Sponsor
111
OLAMEF USA 37461370NightshadeRoadCarlsbad,California92011-3500Phone:[email protected] Web: www.olamefusa.com OlamefUSAistheMasterDistributorofOlamefinAmerica.WeofferComponentLeadFormingMachines,PCBDepanelers,ComponentCounters&Scales, Forming Hand Tools and Custom Part Feeders. We have been serving theelectronicsindustryforapproximately20years.Ourofficeislocatedin San Diego, California where we keep a large inventory of machines and spare parts. Our sales department is trained to offer technical support in English and Spanish. We have access to a highly experienced engineering departmentatthefactorytorespondtoanyspecialrequirementsandadditional service.
OMG Electronic Chemicals, LLC 22515630PioneerCreekDriveMaplePlain,Minnesota55359Phone:+1763-479-2008Web: www.omgi.com ChrisHrusovsky,GlobalBusinessManagerPCB,EP&F,PV +1763-479-2008,[email protected] SuzanneKelzer,Sales/MarketingCoordinator +1763-479-2008x5368,[email protected] Electronic Chemicals is a leading global developer and supplier of electroless and electroplated specialty chemicals, metallization processes, and support products for the electronics industry. We have eight manufacturing and technical centers in North America, Europe and Asia.Withover75activepatentsweprovideinnovativesolutionstoallowourcustomerstomeettechnology,cost,andenvironmentalrequirementstocompeteintoday’sbusinessenvironment.WehavefivebusinessunitsservingthePCB,EP&F,MemoryDisk,PhotoVoltaicandGMFIndustries.
New Product
Omni Training 5299513BusinessCenterDrive,SuiteJRanchoCucamonga,California91730Phone:[email protected] Web: www.OmniTraining.com KenMoore,President +1909-945-9495,KenMoore@OmniTraining.comFornearly35yearsOmniTraininghasprovidedAssembly/Soldering&ReworkCourses,TrainingKits&PCBs,Posters,Handbooks,Workbooks,CDs,ESDAwarenessmaterials&DummyComponents.AleadingIPCCertificationCenter(J-STD-001,IPC-A-610,IPC/WHMA-A-620&IPC-7711/7721).ThreemilesfromtheONTAirport.Tailored“skills-intensive”classeswithhands-ontraining/certificationatourclassroomsoron-siteatyourfacility.Rentaltools,Inspection&Consultingavailable.Stopbytodiscussyourtrainingrequirements&seetheoriginal 5S Workstation Organizer for Soldering Operators.
Omron Inspection Systems 26491 Commerce DriveSchaumburg,Illinois60173Phone:+1800-556-6766Web:www.omron247.com ChrisSpeck,AOIBusinessUnitManager +1916-749-7573,[email protected] Tim Anderson, AOI Sales Support Manager +1847-285-7330,[email protected]’s PCB inspection systems lead the AOI market with the fastest productionspeeds,3Dimaging,andpatentedtechnologyprovidingincreasedproductivityandhighqualityinspectioncapability.Omronintroducesanin-lineX-rayinspectionsystemwiththeindustry’sfastestandmostaccurateinspection capability utilizing CT technology. Omron’s comprehensive line of AOI-X-rayinspectionequipmentfrombench-toptoin-linesystemsprovidesa total SMT solution fully compatible with the QupNavi Software suite for root-causeanalysisandtotalSMTqualityimprovement.
Where Can You Go After the Show to Continue Meeting and Talking with Peers?
Keep the conversation going. Ask and answer technical questions. Help your peers and learn in the process. It’s FREE! No problems with company firewalls — it runs off basic e-mail. Visit www.ipc.org/technet and sign up today.
24/7
“I have been on this forum for several years and have always valued it so much not only with the wealth of technical information that is here but the ease of using it...”
“I have learned a lot over the years ... Thanks to all of the group for sharing your knowledge. I am happy with the forum exactly as it is...”
EX
HIB
ITO
RS
112
www.IPCAPEXEXPO.org
Exhibitors Listing
On Site Gas Systems, Inc. 295035BudneyRoadNewington,Connecticut06111Phone:+1860-667-8888Web: www.onsitegas.com Wayne Heist, Regional Sales Manager +1860-667-8888,[email protected] Mike Montesi, Regional Sales Manager+1860-667-8888,[email protected] Manufacturer of nitrogen and oxygen generation systems. Nitrogen puritiesfrom95%to99.9995%,oxygenpurities95%or99%.Generateyourown nitrogen gas on site for your selective and wave solder needs for just pennies.
Orbotech 182944 Manning RoadBillerica,Massachusetts01821Phone:+1978-667-6037Web: www.orbotech.com KenMaylor,VicePresident-SalesPCB +1978-667-6037,[email protected] live demonstrations of Orbotech’s latest Laser Direct Imaging, Inkjet LegendPrinting,AOI,AutomatedOpticalRepairandCAM/EngineeringSolutions.
Ormet Circuits, Inc. 71110080WillowCreekRoadSanDiego,California92131Phone:[email protected]: www.ormetcircuits.com Customer Service +1858-831-0010x300,[email protected] Circuits provides conductive pastes that enable electrical interconnection and thermal management in electronic substrates, components and assemblies.
Orpro Vision 344944 Manning RoadBillerica,Massachusetts01821Phone:[email protected]: www.orprovison.com Arnon Tuval, arnon.tuval@orprovision.comORPROVisionisaglobalproviderofhighperformanceAutomatedOpticalInspection(AOI)&SolderPasteInspection(SPI)systemsforelectronicsassemblymanufacturing.ThehistoryofORPROVisiondatesbackto1994whenSchuhGmbH,Germany,builtthefirst3DAOIsystemforelectronicsassembly. Now with operations in Europe, Americas, Israel and Africa; Asia is supported with sales and service through a newly formed partnership with SSI.Pleasevisitusatbooth3449toviewtheSymbionS36Plus,VantageS22,SymbionP36Plus,andthenextgenerationAOI:Insite-B,ournewbench-topAOI. New Product
Ovation Products 26283864CourtneyStreetBethlehem,Pennsylvania18017Phone:+1484-893-1028Web:www.ovation-products.com Marius Popitiu, Sales Manager Europe +40722628108,[email protected] Dave Simmons, Operations Manager, Sales +1484-893-1028,[email protected] Products is an advanced technology developer that places particular emphasisonengineeringsolutionsforimprovedequipmentefficiency,enhanced productivity and lower overall cost of ownership. Pioneer of the award-winningautomaticboardsupporttechnologiesGrid-Lok™andGrid-LokSilver™,aswellastheMagna-Print™andDeFlexsqueegeesystems,OvationProductsisenablingfast-changeoverandstreamlinedmanufacturingforprinting,placementandinspectionprocessesworldwide.Visitourboothtoday and see Ovation innovation in action.
Oxford Instruments 708300BakerAvenue,Suite150Concord,Massachusetts01742-2124Phone:[email protected]:www.oxford-instruments.comOxford Instruments offers a complete line of both handheld and bench topXRFanalysers.TheX-METhandheldXRFanalysersarespecificallydesigned for PMI, scrap sorting, alloy and hazardous material analysis. These analysers are also used for the analysis of precious metals, such as Gold. We also offer a wide range of analytical instruments for coatings thickness measurement, material composition and thickness gauging.
P. Kay Metal, Inc. 33012448 East 25th StreetLosAngeles,California90058Phone:+1323-585-5058Web: www.pkaymetal.com DanielFeinberg,VicePresident +1949-498-7866,[email protected] Gladys Flores, Sales Manager +1323-585-5058,[email protected]:MS2® Molten Solder Surfactant totally eliminates dross greatly reducing the expensive solder you have to purchase. In addition to saving money MS2 enhances the soldering process byeliminatingdrossrelateddefects,theresult;significantcostsavingsandimprovedquality.AtAPEX/ExpoP.KAYMetalwilldemonstratelivean improved and easier way to use MS2 in batch mode as well as a next generationversionofMS2.Forover25years,P.Kay’sPuretronix™solderbar, cored wire, and chemistries have been used in electronics assembly. ISO 9001:2008Cert.
PAC TECH USA, Inc. 3715328MartinAvenueSantaClara,California95050Phone:[email protected]: www.pactech.com Mausumi Sarkar, Sales Support Manager +1408-588-1925x212,[email protected] Dr. Thorsten Teutsch, President +1408-588-1925x202,teutsch@pactech-us.comPacTechbuildssolderballingandassemblyequipmentforflip-chipandchip-scalepackaging.Withsystemsforsolderjetting(SB2)andflip-chip attach (LAPLACE) Pac Tech is the leader in laser heating and reflow technology for advanced packaging applications like HGA assembly, MEMS andoptoelectronicpackaging.ThesolderbumprepairsystemSB2-Risthesolutionforlead-freeCSP/BGArework.PacTechalsoofferscontractbumping&backendservicesforquick-turnandmassproductioninSantaClara-California,Penang-MalaysiaandNauen-Germany.
PACE Incorporated 513255 Air Tool DriveSouthernPines,NorthCarolina28387Web: www.paceworldwide.com Michael Luzius, [email protected] PACE manufactures a wide range of products for hand soldering, PCB Repair, SMT/AreaArrayReworkandfumeextraction.PACEcontinuestoprovideinnovative solutions, products and training for the rework, repair and testing ofprintedcircuitassemblies.Ouruniquecapabilitiesandevolvingvisionhaveprovideduniversalsolutionstothru-holeandsurfacemountassemblyandreworkproblemsforthemostadvancedelectronics.50YearsofExperience and Industry Leadership.
113
Panasonic Factory Solutions Company 2829 of America 5201TollviewDriveRollingMeadows,Illinois60008Phone:+1847-637-9600Web: www.panasonicfa.com Mark Ragard, Sales, Group Manager +1847-637-9600,[email protected] MasaKaji,Sales,PlanningManager +1847-637-9600,Masa.Kaji@us.panasonic.comPanasonicFactorySolutionsCompanyofAmericaisallaboutyourefficiency.Our solutions are ideal no matter your mix or your volume. Want to increase hardwareassetsformaximumprofitability?NeedawinningManufacturingExecutionSystemtohelpmanageyourentireenterprise?Requireaplatformthat can grow with you and is scalable for tomorrow’s business? Seeking a sustainable,low-riskvendorthatofferstotalmanufacturingsolutions?Makethe right choice, visit Panasonic in booth 2829. Sponsor
PanaVise Products, Inc. 8187540ColbertLaneReno, Nevada 89511Phone:+1775-850-2900Web: www.panavise.com
Para Tech Coating, Inc. 370335ArgonautCircleAlisoViejo,California92656Phone:[email protected]: www.parylene.com William Gleason, General Manager +1949-855-8010,[email protected] Tech Coating Inc. provides Parylene conformal coating services, automated vacuum deposition systems and raw materials (dimer). Parylene benefitsincludecompletesurfaceconformability,pinholefreeandstressfreeapplication,dielectric/moisturebarrier,opticalclarity,enhancedlubricityandbiocompatibility.ParaTechiscertifiedtoISO9001:2008,AS9100:2009,IPC-CC-830B,ITARandMIL-I-46058C,andisRoHScompliant.ParaTechoffersproductprocessdevelopmenttomeetuniquecustomerspecificationsfocusingon providing excellent service since 1968. See website for more details.
Park Electrochemical Corp. 222148SouthServiceRoad,Suite300Melville,NewYork11747Phone:[email protected]: www.parkelectro.com MarkCarlson,DirectorofSales-Americas +1954-647-1571,[email protected] Electrochemical Corp. is a global advanced materials company which developsandmanufactureshigh-technologydigitalandRF/microwaveprinted circuit materials principally for the telecommunications and internet infrastructureandhigh-endcomputingmarketsandadvancedcompositematerials, parts and assemblies for the aerospace markets. Park’s core capabilities are in the areas of polymer chemistry formulation and coating technology. The Company’s manufacturing facilities are located in Singapore, China,France,Connecticut,Kansas,ArizonaandCalifornia.
PARMI Co., Ltd. 3543DaedukAtomicValley461-63Jeonmin-dong,Yuseong-guDaejeon,ChoongChungNam-do,305-811KoreaPhone:+84224789900Web:parmi.com/new2011/english/ Woong Jang, Sales Manager +84224789900,wjang@parmi.comPARMIisaworldleaderin3DinspectionforprintedsolderpasteonPCB’s.Ourhighinspectionspeedisaresultofourunique3Drangescansensor.Weofferbothofflineandinlinemachinesaccommodatingboardsfrom14”x10”to38”x26”.MostSPIsystemsinthemarketarerestrictedtothedetectionofdefectpadsonly.ThePARMISPIidentifiesincorrectprintersettingsanduses this information to maximize the stabilization of the printing process to improve printing yield. PARMI SPI also checks PCB shrink rate, PCB warpage and stencil mask shrink, all of which affect the printing process
PCB Planet (India) Limited 2310B-9,GIDC,ElectronicEstate,Sector-25Gandhinagar,Gujarat382044IndiaPhone:[email protected]: www.pcbplanet.com Sapan Chokshi, Engineering Manager +919898098316,[email protected],IndiatoprovideCAMsupportservicestotheglobalPCBmarket.In10yearswehavegrownintoateamof180graduateengineersfully-trainedinPCBCAMandfabricationtechnology.Our clients today include some of the most successful PCB fabricators in USA,EuropeandAsia.TheyrelyonustoprovidetheCAMsupportservicesthey need to expand their businesses and cut their costs. To our clients we areaseamlessextensiontotheirin-housefacility,available24X7X52.
PCB007 701POBox50Seaside,Oregon97138Phone:[email protected]:www.pcb007.com Angela Alexander +1408-489-8389,[email protected],anI-Connect007publication,istheonlinemagazinefortheglobalPCBfabricationindustry.Withover50,000articlespublishedsinceitsfoundingin1999,PCB007istheindustry’smostcomprehensivesourceforup-to-the-minutenews,articlesandoriginal,multimediacontent.
PCBCafe Supporter496 Salmar AvenueCampbell,California95008Phone:+1408-850-9246Web: www.pcbcafe.com Graham Bell, Director +1408-850-9246,[email protected]é.comtolearnaboutthe latest company news and research the latest design tools and services. Asthe#1PCBandEDAportalitattractsmorethan25,000uniquevisitorseach month to its interesting audio, video, and text resources. TechJobsCafe.comisalsolinkedtobringyoutargetedjobopportunities.AndourCaféNewsletterreachesouttomorethan30,000+designprofessionalseveryday.
EX
HIB
ITO
RS
114
www.IPCAPEXEXPO.org
Exhibitors Listing
PCQR2 - A Partnership between CAT & IPC 194112231AcademyRoad.NE,Suite301Albuquerque,NewMexico87111Phone:[email protected]:www.pcbquality.com DavidWolf,VP-TechnicalMarketing +1952-652-9033,[email protected] TimothyA.Estes,Chairman&CEO ®
+1505-797-0100,[email protected],Inc.isaglobalproviderofmarket-criticaldatautilizedbydesigners,purchasers, assemblers and manufacturers of printed boards (including rigid,rigid-flexandflexible),andbymaterialandequipmentsupplierstotheprintedboardindustry.Theproductsandservicesprovidequantitativedataonprintedboardmanufacturingcapability,qualityandreliability.Formoreinformationvisitthefollowingwebsites:www.cat-test.info;www.pcbquality.com;andwww.hats-tester.com.
PDQ Precision Inc. 7121433RooseveltAvenueNationalCity,California91950Phone:[email protected]: www.minimaxcleaner.com Jose Gonzalez, General Manager +1619-474-3600,[email protected] Precision Inc.’s patented precision steam cleaning technology enables manufacturers and industrial machinery users to remove a wide variety of contaminantsfromadiversearrayofparts,assemblies,andequipment,suchascircuitboards,mechanicalequipment,andmanufacturingparts.WhenusedinconjunctionwithPDQ’spatentedArma-Sol® rust inhibitor formula, theMini-Max® line of steam cleaners are able to clean more effectively than the competing technology, which uses solvents, citric acid, or ultrasonic vibration.
PDR 5143869DividendDrive,Suite1Shingle Springs, California 95682Phone:+1530-676-6262Web:www.pdr-rework.com LarryHartman,PDROperationsManager/RSM +1530-676-6262x14,[email protected] DavidWhite,President/CEO +1530-676-6262,[email protected],BGA,QFNreworksystemsandstations available worldwide. Our BGA rework stations use PDR’s Focused IRtechnologydevelopedspecificallytodeliverthehighestperformanceandsolderingqualityasdemandedbyour4000+customers,manyoftheworld’stop names in electronics manufacturing. Applications include:•MobilePhone,PDA,Laptop,Desktop,Serverrepair•Consumerelectronics,Set-top,LCD,GameConsolerepair•Aerospace,Weapons,Avionics,Automotive,Transportelectronics•Controlandsystemsrepair,R&D,assemblyandrepairrework
New Product
Pemtron Technology 13212525VistaIndustrialCompton,California90221Phone:[email protected]: www.pemtron.com Steven Wongsonvanee, General Manager +1800-850-8764x101,[email protected] KevinHahm,GlobalSalesManager +1800-850-8764,kevin@pemtron.comPemtronCorporationisapremiermanufacturerof3DSolderPasteInspectionEquipmentemphasizingthelatesttechnologyvs.lowestcostofownershipintoday’sversatilemanufacturingenvironment.Newfor2012istheTROI2200Series3DSPIBench-topSystemandDuelProjection5700Series.Allavailable for demonstration at the booth. New Product
Pentagon EMS 112010950S.W.5thStreet,Suite275Beaverton,Oregon97005Phone:+1503-924-2747Web:www.pentagon-ems.com Randy Morrison, Marketing Manager +1503-924-2747x222,[email protected] ChadHaima,VicePresident,Sales +1503-924-2747x226,[email protected] PCB assembly process tooling design and manufacture. Wave solderpallets,SMTtooling,pressfitandconformalcoattoolingandmore.Industry-leadingturntimes,no-faultguarantee.Additionalservicesincludecontractprecisionmachiningandcomplexmechanicalassemblybox-builds,lowvolumetohighproduction.VisitusandseewhyPentagonisyourbestassemblytooling,box-buildandmachinedpartchoice. New Product
Phibro-Tech, Inc. 18208851 Dice RoadSantaFeSprings,California90670Phone:562-698-8036Web:www.phibro-tech.com Laurie Lanham, [email protected] of etchants, including alkaline and cupric chloride; recycling services for etchants and other metal bearing wastes; copper sulfate and other metal salts and inorganic acids. Patented TFT® technology.
Photo Stencil 24194725CentennialBoulevardColoradoSprings,Colorado80919Phone:+1719-599-4305Web: www.photostencil.com RachelMiller-Short,VicePresidentofSales +1719-304-4224,rshort@photostencil.comPhotoStencilisafull-serviceproviderofSMTstencilsandtooling,includingthepatentedAMTXE-FABelectroformedstencils,andhighperformanceNicAlloy,laserandchem-etchstencils.Relatedtoolingincludessqueegeeblades,thickfilmandmetalmaskscreens.PhotoStencilalsoofferscomprehensive design and support services.
Pillarhouse USA Inc. 3001201LivelyBlvdElkGrove,Illinois60007Phone:[email protected]: www.pillarhouseusa.com AdrianDe’Ath,VicePresident +1847-893-9080x121,[email protected] Jon Wol, President +1847-593-9080x117,jwol@pillarhouseusa.comPillarhousewillshowcaseselectivesolderequipmentrangingfrominexpensive hand load solutions to high speed automated flexible lines, handlingproductsfrom1x1”to24x48”.PillarhousewillreleasethetwopotJadeMKIIItheJadeDuplexwithautopotchangerplusacartandwarmingstation.Ondisplay,theawardwinningJadeHandexwithtop&bottompreheat,InlineOrissaSynchrodexwithmodularfluxer/preheatercombo.Optionsinclude,offlineprogramming,fiducialrecognition,boardwarpagedetection,closed loop wave height monitoring and encoded axis. New Product
Plasma Etch, Inc. 20403522ArrowheadDriveCarsonCity,Nevada89706Phone:[email protected]: www.plasmaetch.com Steven Rothstein, Sales Manager +1773-883-1336,[email protected] RonBruckel,CaliforniaRegionalSalesOffice +1818-790-6684,[email protected]!---Worldwidesales,parts&service.---30+yearsmanufacturing reliable, effective and repeatable plasma etching, cleaning andreactiveionetching(RIE)equipmentfortheindustry.RigidandFlex.Customconfigurationsaspecialty.Calloremailtodayforaquote!
phoenix|x-ray systemsVisit booth #829 on the upper level
• x|aminer provides high-resolution failure analysis
• v|tomexoffersflexible2Dx-rayand3Danalysis
• microme|x for real time X-ray inspection of solder joints and electronic components
EX
HIB
ITO
RS
116
www.IPCAPEXEXPO.org
Exhibitors Listing
Pluritec North America Ltd. 21481556 Ocean Avenue, Suite 18Bohemia,NewYork11716Phone:+1714-767-6367Web: www.pluritec.com KurtWeber,NationalSalesManager +1714-767-6367,[email protected] CarolinaGilio,OfficeManager +1631-981-3000,[email protected] North America provides sales, service and spare parts for Pluritec drilling,routingandx-rayequipment.
Polar Instruments, Inc. 221418649 SW Farmington RoadBeaverton,Oregon97007Phone:[email protected] Web: www.polarinstruments.com KenTaylor +1503-356-5270,[email protected] Instruments provides innovative, easy to use software tools and utilities for the design and manufacture of PCBs. Impedance control and signal integrity is our specialty. Polars intuitive graphic interface and predeterminedstructuresallowyoutoquicklyandaccuratelyshortenyourdesigncycleandcompleteboardswithcompleteerror-freedocumentation.From transmission line modeling to layer stackup for rigid, or flex boards and coupon generation. Detailed sensitivity analysis, extraction of RLGC matrices,s-parameters,graphingandmore. New Product
Polyonics 2705867Route12,Unit4Westmoreland,NewHampshire3467Phone:+1603-352-1415Web: www.polyonics.com Bill Johnston, Sales Manager +1603-352-1415,[email protected] Levi Dow, Asian Sales Manager +1656-542-5484,[email protected] is a renowned manufacturer of high performance label, tape andfilmmaterialsforextremetemperaturesandharshenvironments.Thematerials are used by converters and OEMs throughout the electronics, aerospace, automotive and medical industries to solve problems related to managing temperature, protecting sensitive components from ESD, tracking barcodesandpreventingthepropagationoffire,amongothers.Allmaterialsare REACH and RoHS compliant and the Polyonics proprietary manufacturing processisISO9001:2008registered.
Posalux SA 192918, rue F. OpplingerP.O.Box6075Biel-Bienne,BernCH-3298SwitzerlandPhone:+41323447672Web: www.posalux.net SueKlay,DirectorSales&Marketing +41323447672,[email protected] is a major worldwide supplier of automatic machine tools for: Drillingandroutingofprintedcircuitboardsandnon-ferrousmaterials,Electrical discharge machining of nozzles for diesel and gasoline injection nozzles, spinnerets, etc. Faceting, engraving and milling in the watch andjewelryindustry.PosaluxisheadquarteredinBiel-Bienne,oneofthemost important cities of Switzerland, which is famous not only as a watch metropolis, but also as one of the most important centers for advanced technologies.
Precision Placement Machines 1221326MainStreet,Unit11Fremont,NewHampshire03044Phone:[email protected]: www.goppm.com Thomas Nisbet, President +1603-895-5112,[email protected] Sharon Breault, Sales +1603-895-5112,[email protected] is a worldwide leader in the buying, selling, and remanufacturing of surfacemountequipment.WespecializeinQuadSMTequipmentaswellasMPMscreenprinters,HellerReflowOvens,UniversalThru-holeandCamalotdispensers.PPMprovidesqualityrefurbishedequipment,newandused spare parts, backed by knowledgeable technical support to ensure that allproductsbecomeaprofitableinvestment.WearedeterminedtobuildonthemanyyearsdevotedtotheQuad/Tycoproductlinebyreinvestinginourpeople and products. New Product
Printed Circuit Design & FAB 434P.O.Box470Canton,Georgia30169Phone:678-817-1286Web: www.pcdandf.com Mike Buetow, [email protected]&FABistheleadingmagazineservingthePCB design and fabrication markets. It covers the latest PCB design and fabricationtechnologies,techniques,processesandmarketconditions.Themagazine’s30,000readersincludeengineers,designers,managers,executivesandfabricatorsatOEMs,designservicebureausandmerchant/captivefabricationfacilities,andtheirsuppliers.PCD&Fisfreetoqualifiedprofessionals. To subscribe, visit www.pcdandf.com.
Printed Circuit Girls and Geeks 623134VintagePark,Suite130Houston,Texas77070Phone:[email protected] Web: www.pcgandg.com Marissa Oskarsen, President, CEO +1713-472-4475,[email protected](PCB) printed circuit board fabrication
Printed Circuit Journal 8382-20-1AmanumaSuginami-kuTokyo,167-0032JapanPhone:+81333931341Web: www.pcjcorp.jp ToshioKataoka,President +81333931341,[email protected] Mariko Nakazawa, Editor Japanese PWB industry News from Tokyo. First published in 1965, issued everytendays,bringsyouthemostup-todatemarketinformationontheJapanese Printed Circuit market.
Production Solutions 140012675DanielsonCourt,Suite403Poway,California92064Phone:+1858-486-1088Web:www.production-solutions.com Douglas Farlow, President +1619-871-3007,[email protected] Lori Rosenblatt, Inside Sales +1858-486-1088,[email protected] Solutions is a manufacturer of universal substrate support tooling systemsfortheelectronicsindustry.ProductsincludethepatentedRed-E-Setsystem which substantially Reduces Changeover Time, Improves Quality andEliminatesComponentDamageforpick&place,screenprinters,anddispensers.
117
Booths400-999locatedintheSailsPavilion(UpperLevel)•Booths1000+locatedinHallsA–C(GroundLevel)
ProEx Device Programming 34087842South1300WestWestJordan,Utah84088Phone:+1801-569-8500Web: www.proex1.com RobMcCombs,Operations/ProductionManager +1801-569-8500,[email protected] Greg Norton, COO +1801-569-8500,[email protected] offers worldwide Device Programming and Tape and Reel Services. Weareyoursolution-Extensivedevicesupport-capacityover80millionprogrammablesperyear-fastestturntimesintheindustry.StopbytheProEx booth to learn more. www.proex1.com
PROMATION, Inc. 12289522-58thPlace,Suite100Kenosha,Wisconsin53144Phone:[email protected]:www.pro-mation-inc.com Gary Goldberg, President +1262-764-4832,[email protected] Michael Goldberg, +1262-764-4832x112,[email protected] is a leader in PCB and pallet Handling Systems (Conveyors), RoboticSolderingSolutions(TableTop,RotaryTable,In-lineandCustomCells)andothertypesofMaterialHandlingsolutions.Atthisyear’sIPC/APEXshow PROMATION will introduce our new Table Top Soldering Robot and our Three Operator Hand Assembly Work Station with LCD Instructional Displays.
New Product
Prototron Circuits 225015225 N.E. 95th StreetRedmond,Washington98052Phone:[email protected]: www.prototron.com Russ Adams, Sales Manager +1425-823-7000x232,[email protected] Dave Ryder, President +1425-823-7000,daver@prototron.comPrototronCircuitsisafullservicequickturnPCBmanufacturerwithfacilitiesinRedmond,WAandTucson,AZ.Standardleadtimeoncommercialboardsisfivedays,expedite.servicestartingat24hrs.WeofferIPC6012ClassIIIbuilds, Controlled Impedance modeling, specialty materials, various surface finishes,andRoHS-compliantboards.BothfacilitiesareISOCertifiedandITAR Registered. For more information, visit www.prototron.com.
PVA 2451One Mustang DriveCohoes,NewYork12047Phone:[email protected]: www.pva.net Frank Hart, Sales and Marketing Manager +1518-371-2684x229,[email protected] David Gomez, Regional Sales Manager +1281-217-7247,dgomez@pva.netPVAisaglobalmanufacturerofmulti-axisroboticsolutionsforselectiveconformalcoatingandfluiddispensingapplicationsincludingmeter-mix,potting, bonding, gasketing, solder paste, and surface mount adhesive processes.PVAplatformsarealsointegratedforcustomautomationincludingroboticsoldering,sprayflux,andautomaticscrew-drivingcells.Allsystems are backed by a global service network, including regionally trained technicians, for fast response times. New Product
Q 1 Test Inc. 3733780S.RochesterStreet,SuiteDOntario,California91701Phone:[email protected]:www.q1testinc.comJasonRiley,[email protected]
Q Corporation 3002301RiverStreetDerby,Kansas67037Phone:+1800-835-1099Web:www.qcorporation.com Ben Swigart, President, Sales Manager +1800-835-1099,[email protected] TimPauls,VicePresident +1800-835-1099,[email protected] Corporation is a recognized world leader in component handling for surface mounttechnologyandmassleadtrimming.For40years,companiesthroughouttheworldhavedependedonQqualitytomeetthemostdemandingproductionschedules.QCorporationhaspartneredwithFritsch,aGermanyequipmentmanufacturetobringyouafulllineofmanual,semi-automatic,andautomaticpickandplaceequipment.WearetheexclusiveNorthAmericandistributor,and we will provide all sales and support on these machines.
QA Technology Company, Inc. 2822110TowleFarmRoadHampton,NewHampshire3842Phone:[email protected]:www.qatech.com Wendy Wing, Marketing Specialist +1603-601-0128,[email protected] Jeff Smith, North America Sales Manager +1603-601-0166,jsmith@qatech.comQATechnologyisamanufacturerofhighqualitytestprobesandsocketsused in the ATE industry. Our Advanced Steel Razor Tip Styles solve today’s testchallengessuchasOSP,LeadFreeandNo-Clean.Thisfamilyoftipstyles can help lower your board test costs, reduce board flex and improve electricalcontact.OurXProbeSocketlessSeriesallowsforalargertestprobe to be mounted on closer centers while maintaining reliable electrical contact on smaller boards.
Qualectron Systems Corporation 2412555 Aldo AvenueSantaClara,California95054Phone:[email protected]:www.qualectron.com Ricky Ma, Sales Manager +1408-476-6636,[email protected],3DSPImachine,AOImachine,ICTandFunctionaltester.OurX-raymachineisaverycosteffectivewaytoinspectBGA,PCBandwirebondingwithXYZ,rotateandtiltfunctions.Fordetailfailureanalysis,weoffer3DCTX-raymachinewithoutdestroyyourproduct.Forour3DSPIofflinemachine,weofferin-lineandtabletopmachinewhichcanmeasure down to 1 micro solder height.
EX
HIB
ITO
RS
118
www.IPCAPEXEXPO.org
Exhibitors Listing
Qualitek International, Inc. 2820315FairbankStreetAddison,Illinois60101Phone:[email protected]:www.quailitek.com Debbie Liguori, Marketing Dept. +1630-628-8083x122,[email protected] Phodi Han, Technical Director +1630-628-8083,[email protected]&LeadFreeAlloys,Halogen Free Materials, Solder Paste, Flux, Bar, Wire, BGA Spheres, Dross Eliminators, Stencil Cleaners, Residue Removers, Rework Materials, Wave Solder Oil, Ceasolder Masks and Chemicals. JT Lead Free Wave Soldering SystemsandReflowOvens.BGAReworkStations.Metalsreclamation&SolderCheckupprograms,technicalsupport.QS9000andISO9001:2008certified. New Product
Quality Systems Integrated Corp. 7066720CobraWaySan Diego, California 92121Phone:+1858-587-9797Web:www.qsic.com CandaceCouture,Marketing/Jr.ProgramManager +1858-587-9797x227,[email protected] JohnLe,Sales/ProgramManager +1858-587-9797,[email protected] Systems Integrated Corporation is an electronic contract manufacturing company specializing in assembly, distribution, engineering, rework and testing services. Quality Systems, manufacturing to your high standards.
Quality Tech Tool Inc. 2137550BennettRoadElkGroveVillage,Illinois60007Phone:+1847-952-0999Web:www.qualitytechtool.com ZoranDenic,President +1847-952-0999,[email protected]
Quasys AG 1315Allmendstrasse 11Steinhausen,6312SwitzerlandPhone:[email protected]:www.quasys.ch Rolf Nussbaumer, Managing Director +41417402060,[email protected] Neil Burtt, North American Sales Representative +1603-227-5240,nburtt@youpromote.bizQUASYSmanufactureshigh-qualityFeederforJEDECTraysandfor2“and4”Wafflepacks.TheFeeders,originallyinventedandmanufacturedbyLaurier,havebeenacquiredbyQUASYSandarenowmadeinSwitzerlandand Germany. They can easily be integrated into many handler. Two different modules of JEDEC Feeders will be exhibited as running products, the JTF2 TrayStackerandtheJTF3RandomAccessFeeder. New Product
Quik-Tool, LLC 333510TanglewoodRoadPlainville,Massachusetts2762Phone:+1508-699-9077Web:www.quik-tool.com Jim Bernhard, Managing Partner +1508-699-9077,[email protected]“GoldStandard”inautomaticcompliantSMTToolingforprintersandplacementequipment!10yearsago,weintroducedaconceptto the industry that was the standard in SMT tooling. Now, we have done it again! Our tooling is all High Density at the lowest entry cost in the market. Our patent pending tooling is the easiest to use with “set it and forgetit”technology,inmanualorautomaticmodes.Quik-toolisvirtuallyzero maintenance with hands down the lowest ownership cost. Ask about “StarterKits”whichgetthetoolinginonyourexpense(notcapital)budget.
New Product
QxQ, Inc. 281644113S.GrimmerBoulevardFremont,California94538Phone:+1510-252-1522Web:www.qxq.com Corey Schwartz, Sales Manager +1970-405-7148,[email protected] Roger Quan, President +1510-252-1522,roger@qxq.comICTFixturesinaslittleas3days.Functionalfixturesinaslittleas4days.Local, direct company support in North America and Asia. QxQ consistently providesthequickestturntimesintheindustry.Utilizingourinnovativesoftwareanddesigntoolsandoperatingthelargestsetofequipmentensurestheshortestturntimesavailable.ICTfixturessystemverifiedforQuality.Durablefixturematerialsforlongevity.LargestbandwidthforQuickturns.FEA/StrainGaugeTesting.ITARRegistered.QualityfixturesQuickly-QxQ.
RBP Chemical Technology, Inc. 1900150South118thStreetMilwaukee,Wisconsin53214-0069Phone:+1414-258-0911Web: www.rbpchemical.com RobColeman,DirectorofSales&Marketing +1630-881-6819,[email protected] Nancy Antonicci, Customer Service Manager +1414-258-0911,[email protected] Chemical Technology is a global supplier of proprietary chemicals used in the electronics and printing industries. These products are manufactured atitsheadquartersinMilwaukee,Wisconsin,USA,itswhollyownedsubsidiary RBP Technology Pvt. Ltd. in Mumbai, India and by approved partnersinThailandandSouthKorea.RBPproductsaresoldandservicedbyfactory-trainedsalesandservicerepresentativesanddistributorsinNorthAmerica, Asia and Europe. RBP Chemical Technology was founded in 1954 andisISO9001:2008certified.
RC Precision Engineering Sdn Bhd 620No 15 Lintang Beringin 6Off Jalan Permatang Damar LautBayanLepas,Penang11960MalaysiaPhone:+1604-626-3448Web: www.rcprecision.com.my Ravichandran Manikam Achari, Managing Director +60124332462,[email protected] KaiSeeChew,Director +60124022332,[email protected] Precision Engineering Sdn Bhd is a global one stop engineering serviceprovider,incorporatedin1993.RCaggressivelycultivatesdesign&developmenttalentsandpersistentlyprovidesonthesubcontractmanufacturing services and being technical representative for OEM manufacturers. Combining its advanced technological prowess, RC has built itsuniquecompetitiveedgetoprovidecustomerstime-to-market,highvalueaddedandmostcostcompetitivetotalservices.RCwascertifiedasISO9001:2000inAugust2006bySIRIMQASInternationalandfollowedbyISO9001:2008inAugust2009bySIRA. New Product
119
Booths400-999locatedintheSailsPavilion(UpperLevel)•Booths1000+locatedinHallsA–C(GroundLevel)
Real-Time With...IPC 701P.O.Box50Seaside,Oregon97138Phone:+1916-608-0660Web:www.iconnect007.com Barb Hockaday, Editor +1916-608-0660,[email protected] Angela Alexander, Editor +1480-489-8389,[email protected](www.realtimewith.com).Watchvideointerviews with industry leaders, read show articles, view our extensive photogalleryandmore.RealTimewith…IPC/APEXisproducedbyI-Connect007,homeofSMTMagazine,SMTOnline,Flex007,MilAero007,PCBDesign007,ThePCBMagazineandPCB007.Theseglobalonlinemagazines are the electronic manufacturing industry’s most comprehensive source for news, articles and original, multimedia editorial. Come see us at Booth#701www.iconnect007.com.
RNS International, Inc. 7155001SirusLaneCharlotte,NorthCarolina28208Phone:[email protected]:www.rns-usa.com SvenFrischen-Nocher,VicePresident +1704-329-0444,[email protected]&serviceprovider:-TestequipmentforICT,FCT&SpecialTestApplications-ExclusiveDistributorforIngunTestProbesofferingthelargestassortmentoftest probes for:-AnyapplicationICT,FCT,Special-High-Frequency-High-Current,CableHarness,Thermal-Pneumatic,Switching,Rotating-BatteryContacts-Standard&customizedTools/Accessories-ExclusiveDistributorWriteNow!SeriesISPProgrammingsolutions-ExclusiveDistributorDigitalLEDAnalyzer-Engineering,CNCMachining,Assembly&Wiring-Fixturekits,componentsforTest/Measurement New Product
Rogers Corporation 2101100SouthRooseveltAvenueChandler, Arizona 85226Phone:[email protected]: www.rogerscorp.com Sheryl Long, Sr. Marketing Communications Specialist +1480-961-8256,[email protected] Advanced Circuit Materials Division is a global technology leader in the development of high performance printed circuit materials for use in a wide range of markets, including portable communications, communications infrastructure,aerospaceanddefense.KeyproductsincludeRO4000®, RO3000®,andRT/duroid®,highfrequencylaminatematerialsalongwithrecently introduced Theta®printedcircuitboardmaterial,anext-generationhalogen-freelaminatethataddressesmarketneedsforalead-freeassemblycompatible,CAF-resistantmaterialidealforhigh-speeddigitalcircuits.
RPS Automation 14443808N.SullivanRoad,Building14-JSpokaneValley,Washington99216Phone:+1509-891-1680Web: www.rpsautomation.com Reid Henry, Director of Engineering and Operations +1509-891-1680x253,[email protected] designs and manufactures a complete line of automated selective soldering,leadtinningandsolderabilitytestequipmentforcircuitboardassembly, component manufacturing and component inspection and authentication. RPS provides industry leadership in engineering, precision andsolderingperformance.RPSequipmentismadeintheUSAanddeployedinover500installationsatmorethan350globalcustomers.
Saki America, Inc. 33292378WalshAvenueSantaClara,California95051Phone:+1408-567-0300Web: www.sakicorp.com Norihisa Isomura, General Manager +810851855570,[email protected]/benchtopAOI,3DAOI,3DSPI,2DX-ray,3DCTX-rayIn-lineautoinspection system, Conformal coating inspection.
Samsung/Dynatech 16292370YorkRoad,BuildingC-3Jamison, Pennsylvania 18929Phone:+1267-483-5535Web:www.samsung-smt.com Mike Foster, General Manager +1267-483-5535,[email protected] Jonny Nichols, National Sales Manager +1919-606-3707,[email protected] Technology features the full line of Samsung SMT assembly equipmentincludingscreenprinters,intelligentplacementsystems,reflowovensandboardhandlingequipment,allbackedbyDynatech’scommitmenttocustomersatisfactionandSamsung’sworld-classglobalsupportnetwork.
Sanmina-SCI 6292700N.FirstStreetSanJose,California95134Phone:[email protected]:sanmina-sci.com SalesSanmina-SCI,SalesatSanmina-SCI +1408-964-3500,info@sanmina-sci.comSanmina-SCImakessomeofthemostcomplexandvaluableelectronicandmechanicalproductsintheworldproducinghighquality/highperformancecomponentsincludingcomplexmulti-layeredPCBsandbackplanes.InthePCBarena,Sanmina-SCIofferscomplex,multilayerPCBs,includingquick-turn services complemented by decades of expertise in Microvia Laser, PlasmaandPhototechnologies.Wealsoprovideupto60layers,multiplesurfacefinishes,high-speedlaminates,aswellasaspectratiosgreaterthan20:1and31”x52”largeformatbackplanes.Visitwww.sanmina-sci.com.
Saturn Electronics Corporation 300628450NorthlineRoadRomulus,Michigan48174Phone:+1734-941-8100Web:saturnelectronics.com/clemens/signup.php Jonathan Rimanelli, Business Development +1734-941-8100,[email protected] Smith, Business Development (Flexible PCB)+1770-521-2881,geoff@saturnflex.comSaturnElectronicsCorporationisaminority-owned(MBE),domesticprintedcircuit board manufacturer managing the nuances between prototype and production(rigid/flex).Saturn’sadvancedPCBtechnologiesincludemetalcore(MCPCBs) for LED Applications (go to our site and register to view our free webinaron-demand),heavycoppermultilayers,blind/buriedvias,andPTFEhybridsforradiofrequency/microwave(RFMW).AnITAR-registeredfabricator,SaturnisalsoAS9100,TS16949,andUL-certifiedforthermalmanagement.
EX
HIB
ITO
RS
120
www.IPCAPEXEXPO.org
Exhibitors Listing
ScanCAD International, Inc. 242212779WestBelleviewAvenueLittleton,Colorado80127-6207Phone:[email protected]: www.scancad.com BillLoving,President&CEO +1303-697-8888,[email protected] Jeff Rupert, Director of Advanced Technology +1734-994-8626,[email protected],scanner-basedsystems&softwaresince1990.PROCESS MGMT TOOLS: #1 ranked Mfg Work Instruction Software in the world. A dynamic blend of Process Control and Mfg Execution Software (MES).INSPECTION:100%opticalinspectionofstencils,screens,PCBs,BGAballs,solderpaste,adhesive,LTCC,holes&phototools.PCBFABRICATION&DESIGN:Re-createGerber,CAD&schematicsfromexistingfilms/boardswithexactform,fit&function.PCBASSEMBLY:NPI,Stencil,solderpaste&1starticleinspection,offlinegenerationofplacement&componentvisionlibraryfiles. New Product
Scheugenpflug, Inc. 609975CobbPlaceBoulevard,Suite101Kennesaw,Georgia30144Phone:+1770-218-0835Web:www.scheugenpflug-usa.com MatthewGriffin,DirectorofSales-Americas +1770-218-0835,matthew.griffin@scheugenpflug-usa.comScheugenpflug-USAislocatedinKennesaw,justoutsideAtlanta,GA.Scheugenpflugmanufacturesautomationanddispensingequipment.Weoffer a complete line of capabilities from hand working stations to fully automatedproductionlines,equippedtomeetyourproductionrequirements(suchaspick&place,plasmatreatment,dispensingandcuringstations).Welook forward to working with you to improve your manufacturing process.
Schleuniger, Inc. 113287ColinDriveManchester,NewHampshire03103Phone:+1603-668-8117Web:www.schleunigher-na.com Steve Bridgewater, Direct Sales Representative +1603-668-8117,[email protected] Darren Teasck, National Sales Manager +1603-668-8117,[email protected]’sstate-of-the-artautomaticandsemi-automaticwireprocessingmachines are designed to cut, strip, crimp, seal and mark wire and cable ofalltypes,includingsingleconductorwire,coaxial,multi-conductor,POF,flatflexibleandfiberopticcables.Integrativepre-andpost-processingaccessories for wire feeding, coiling, stacking, labeling and tying are also available. Companies worldwide utilize Schleuniger for their most demanding wireprocessingprojects.Visitourboothandfindoutwhy.
Schmid Systems Inc. USA 2029440HaywardAvenueNorthOakdale, Minnesota 55128Phone:+1651-714-8402Web:www.schmid-group.com Fred Johnson, President +1651-714-8402x100,[email protected]/service/sparepartsforGebr.Schmid,GermanyofHorizontalProcessingEquipmentfor:SURFACETECHNOLOGY--Brushing,ChemicalCleaning,OxideReplacement,ChemicalTin,SBULeveling;RESISTTECHNOLOGY--Cut-SheetLamination,Developing,Etching(Alkaline&CuCL),ResistStripping,MetalStripping(DES/SES);PTHTECHNOLOGY--Desmear,ElectrolessCopper,Electro-PlatingCopper(SegmentalforDCand/orPRPP);AUTOMATION;LCDTECHNOLOGY.
Scienscope International 15375751SchaeferAvenueChino,California91710Phone:+1909-590-7273Web: www.scienscope.com DanKelsey,GeneralManager +1909-590-7273x15,[email protected] Eddy Lin, President +1909-590-7273,ScienscopeisaleadingmanufacturerofNDTtestandinspectionequipmentsuchasX-Raymachines,XRFspectrometers,stereozoommicroscopes,video inspection systems, and video measurement systems. As well, video measurementsoftwareforFieldofViewmeasurementandlightingandoptical components are displayed. New Product
SEHO North America, Inc. 35211420JamikeDrive,#300Erlanger,Kentucky41018Phone:[email protected]: www.sehona.com Christian Ott, Sen. Sales and Project Manager +1859-371-7346,[email protected] Desiree Buchanan +1859-371-7346,[email protected] Systems is a world class manufacturer and supplier of Selective, Wave,andReflowsolderingequipment.AtSEHOwecombineinnovativeengineeringandprocessknowhowtodeliverequipmentmanufacturedtothehighestqualitystandards,ensuringareliableandrepeatablesolderingprocess. We offer a complete product line of Selective, Wave and Reflow solderingmachinestomeetyourproductionrequirementsforbothlead-freeandtin/leadsolderingapplications.VisitourboothatAPEXtofindthesolution for your soldering process. New Product
SEICA USA 272950ANorthwesternDrive,Suite10Salem,NewHampshire3079Phone:+1603-890-6002Web:www.seica-na.com David Levine, National Sales Manager +1603-890-6002,[email protected] DavidSigillo,VicePresident +1603-890-6002,[email protected]&measurementequipmentdesignandservices.Withofficesworldwide,SeicacansupportyounomatterwhereyourNPIcentersorproductionfacilitiesarelocated.Frombareboard/substratetestingtotraditionalin-circuitandfunctionaltesting,SeicaistheonlyATEcompanythat provides solutions to both the substrate and loaded board markets.
Seika Machinery, Inc. 24013528TorranceBlvd.,Suite100Torrance,California90503Phone:+1310-540-7310Web: www.seikausa.com KoichiKoba,ExecutiveVicePresident +1310-540-7310x127,[email protected] Michelle Ogihara, Senior Sales Manager +1310-540-7310x120,[email protected] Seika Solder Paste Recycling System; Sawa Wiper Roll Cleaner; SawaLow-VOCFullyAutomaticStencilCleaner;SeitecSelectiveSolderingSystem;McDryLow-HumidityStorageCases-NewRFIDFeederCabinetsand Baking Cabinet; Hioki Flying Probe ICT and Solder Joint Integrity InspectionSystem;SayakaPCBRouters,Hirox3DDigitalMicroscopes,YJLink Conveyor and More.
121
Booths400-999locatedintheSailsPavilion(UpperLevel)•Booths1000+locatedinHallsA–C(GroundLevel)
Semblant 2151Cambridge Technology CentreMelbourn Royston, Hertfordshire, SG8 6DPUnitedKingdomPhone:[email protected]: www.semblantglobal.com Gregg Barnes, Product Management +1480-278-7015,[email protected] Steven Lowder, CEO +1480-278-7015,Info@semblantglobal.comSEMBLANTevolvedin2009fromthetechnologyincubationcompanyCrombie123withtheprimarypurposeoffinalizingandcommercializingarevolutionary plasma coating. Years of research and product development have setthestageforSEMBLANTtotransformtheelectronicsindustry.Thefirstproduct,anenvironmentallyfriendly,superiorelectronicfinalsurfacefinish,willservea$1B+market.AdditionalSEMBLANTproductsbasedonthissametechnology will serve additional large electronics industry markets. Semblant is wholly owned by Ipex Capital Management Limited. New Product
New Product Zone
Semco Packaging & Applications Systems 294512780SanFernandoRoadSylmar,California91342Phone:+1818-362-6711Web: www.semcopackaging.com Barry Wolf +1818-362-6711,[email protected] Jim Enochs, Segment Manager +1310-766-3828,[email protected]®Packaging&ApplicationSystemsisaworldleaderinthemanufactureofcartridges,syringes,nozzlesandapplicationequipment.Ourproductlinenowincludesaunique500gramsolderpastejarwithroundedcornersandaquarterturnlockinglidthatcanbecustomizedwithyourcompanylogo.AllSemcoproductsaremadeintheUSA.Semcoisalsoaleadingspecialtypackagerofliquidandpastematerialswithawiderangeofpackagingoptions.For more information, visit www.semcopackaging.com. New Product
Senju Comtek Corp. 26161999S.BascomAvenue,Suite340Campbell,California95008Phone:[email protected]: www.senju.com ShoichiUsui,GeneralManager,Sales +1858-268-2440,[email protected] Derek Daily, General Manager, Advanced Technology +1(408-963-5310,[email protected] Metal Industry Co. (SMIC) is a global leader in solder materials and relatedequipments.Senju’slatestECOSolder™featurescustomizedalloysforbothsurfacemountandwavetechnologiestomeetspecificapplicationneedssuchaslow-silver,energy-saving,andhighreliability.Waveandselective soldering systems incorporates innovative pump technology for the highestandmoststablewavepressure,andourcost-savingdrossrecyclingsystem effectively separates solder from dross for reuse. With technical expertiseandsupport,wedeliveracutting-edgeECOSolderingSolution™.
Sponsor
Shanghai Fast-PCB Circuit Technology 1152 Corp. Limited No.699,XingQingRoad,JiadingIndustrialParkShanghai,201807ChinaPhone:+1800-820-2796Web: www. chinafastpcb.com
Shengyi Technology Co., Ltd/ 1806 Paramount Laminates 2143N.GlassellStreetOrange, California 92865Phone:[email protected]:www.paramount-usa.com MindyChen,OfficeManager +1714-921-1132,[email protected] the biggest copper clad laminate company in China, Shengyi is the only one in Dongguan which has a research and development center which has achievednationallevelrecognition.ShengyiiscurrentlymanufacturingFR-4,CEM-1,CEM-3andPrepreg,amongotheradvancedproducts.Paramountengages in the sourcing and distribution of copper clad laminates and printedcircuitboardmaterials.WeofferhighqualityPCBmaterials,stockingoptions,andproductsupporttomanufacturersintheUnitedStates.Paramount is a key strategic partner for printed circuit board manufacturers.
SHENMAO Technology, Inc. 29462156 Ringwood AvenueSanJose,California95131Phone:+1408-943-1755Web: www.shenmao.com Julian Chen, General Manager +1408-943-1755,julian_chen@shenmao.comWithover35yearsofexperienceinsoldermaterialindustry,SHENMAOTechnology has successfully supplied electronics assembly materials, such assolderpastes,BGASphere,solderwire,solderbar,fluxandPb-Freesolder alloys to worldwide electronic industries. Customer satisfaction and sustainablehighqualityarealwaysourpriority.TheprinciplesofSHENMAOare sincere, dependable, and creative and they will always be how we operate our business. And this is how SHENMAO has become the most valuable global Solder material provider.
Shenzhen Kunqi Xinhua Technology 2917 Co., Ltd.5F E building, Youji Industrial Park Bantian,LonggangShenzhen, Guangdong, Guangdong 518129ChinaPhone:+86-755-89586020Web:www.szkqxh.com Yongnong Yan, Chairman [email protected] MinZhou,Manager +86-18923487396,[email protected].,Ltd.(KQXH)wasestablishedin2006.It is one of the national high tech enterprises in China, the main compiler of StandardsofAnti-oxidationReducerforSolderDross,thewinnerofNewRecords of Shenzhen Enterprises, and a member of IPC, SMTA, SMT China, Federation of Shenzhen Industries, and Promotion Association of Shenzhen SME. Focusing on the electronic manufacturing industry and based on environmentalprotectionandenergysaving,KQXHisaprofessionalsolutionsupplier towards problems in the industry with the strategy of specialization, branding. New Product
Shenzhen Wellink Industrial Development co. BinRoom2301-2302,ChuangzhanCentre,No.6007,ShennanFutian District, Shenzhen City, [email protected]
EX
HIB
ITO
RS
122
www.IPCAPEXEXPO.org
Exhibitors Listing
Shin-Etsu Silicones of America, Inc. 6111150DamarDriveAkron,Ohio44305Phone:[email protected]: www.shinetsusilicones.com Eric Bishop, North America Marketing Manager +1513-232-8917,ebishop@shinetsusilicones.comShin-EtsuSiliconesisaleadingglobalmanufacturerofsiliconematerialsfortheelectronicsindustry.Shin-Etsu’sassortmentofproductsprotectssensitiveelectronicsfromdamagingenvironmentsandinsuresthereliable,long-lasting performance of your components. Our products include adhesives sealants,die-bond,pottingencapsulants,conformalcoatings,thermalinterface materials, and SIFEL elastomers for corrosive environments. AllmaterialsaremanufacturedtoexactingspecificationsinISOcertifiedfacilitiesthroughouttheglobe;somecanbetailoredtoyourspecificapplication.
Siemens PLM Software 11085800GraniteParkway,Suite600Plano,Texas75024Phone:[email protected] Web:www.plm.automation.siemens.com/en_us/products/tecnomatix/industry/hte/index.shtml MariaMosto,IndustryMgr-ElectronicsMfgSolutions +1603-766-9547,[email protected] PLM Software, a business unit of the Siemens Industry Automation Division, is a leading global provider of software applications for the High Tech&Electronicsindustry.Providingthemostwidelyusedsolutionsformanaging and controlling the delivery of product data to the manufacturing shop floor, preparing and optimizing product data for manufacturing, and collectingcriticalas-builtprocess,qualityandtraceabilityinformationforevery product assembly. New Product
SiFO 14045036CommercialCircle,UnitEConcord,California94520Phone:[email protected]:www.sifo-us.com Adam Holden, Senior Account Manger +1925-395-3796,[email protected] Harold Ng +1408-667-5162,bob_warford@sifo-ltd.comSiFOsimplifiesoutsourcingbyprovidingskilledtalentyoucantrustintheU.S.andAsia.NooneismoreexperiencedthanSiFOindeveloping,fabricatingandoverseeingproductiontestatyourChina-basedcontractmanufacturer,deliveringreliable,highfaultcoveragein-circuittestprogramsfor complex boards on popular ATE systems, and turnkey functional test systemsandfixtures—allbuiltfortherigorsoftheproductionfloor.SiFO’slocal, fast response resources assist you solving problems as you manage significantchange.
Simplimatic Automation 122078CorporateWayEvington,Virginia24550Phone:+1434-385-9181Web: www.simplimatic.com JeremyVaughan,DirectorofProjects +1434-385-9181x1095,[email protected] PaulMcKinney,ProjectManager +1434-385-9181x1013,[email protected]® Automation provides conveyors, customer support, and accessories that allow complete integration of electronics assembly lines. Productsincludeconnectingconveyor,FIFO/LIFObuffers,inverters,elevators,shuttles, gates, turns, work stations, magazine handlers, magazines, pallet handling, and custom automation systems.
Smart Sonic Stencil Cleaning Systems 13206724EtonAvenueCanogaPark,California91303Phone:+1818-610-7900Web: www.SmartSonic.com Bill Schreiber, President +1818-610-7900,[email protected] Jim Taylor, Engineering Manager +1818-610-7900,[email protected]&palletcleaningsystemandtheonlysystemverifiedenvironmentallysafe,usersafeandeffectivebytheU.S.EPA.Acomplete turnkey process that is guaranteed to clean any type of solder pastefromanyfine-pitchstencil.Usedbyover1000SMTassemblersworldwideandtime-testedsince1990.Also,AOIinspectionsystemsforstencil/screenaccuracy,materialdepositionandPCBassembly.IntroducingEnviroGuard100%closed-loopstencilcleaners!
SMT Hybrid Packaging 2012 3743Mesago Messe Frankfurt GmbHRotebuehlstr.83-85Stuttgart,Baden-Wurttemberg,70178GermanyPhone:+4971161946-75Web:www.smt-exhibition.com Nora Sollfrank, Project Manager +4971161946-75,[email protected] Anthula Parashoudi, Deputy Head of Division +4971161946-34,[email protected] Hybrid Packaging is Europe’s leading exhibition and conference for System Integration in Micro Electronics. The event will provide a comprehensive overview of the sector from design and development, PCB production, electronic manufacturing services, component parts, placement technologies,throughtotestingequipmentandthelatestprocesses.
SMT Magazine 701POBox50Seaside,Oregon97138Phone:+1503-738-6610Web: www.smtonline.com Barb Hockaday +1916-608-0660,[email protected],anI-Connect007publication,isthemagazineforthePCBassemblycommunity.Providingthehighestqualitytechnicalandbusinesscoverage in the industry, SMT Magazine has the vital information you need to succeed in a challenging global manufacturing environment. Come see us atBooth#701orsubscribeatwww.smtonline.com.
SMT North America, Inc. 26415905NewHarvardPlaceGlenAllen,Virginia23059Phone:+1804-360-0144Web: www.smtna.com Manfred Maehl, President +1804-360-0144,[email protected] is one of the world leading manufacturers of thermal process equipmentincludingreflowsoldering,vacuum,tailormadecuring,drying,conformalcoatingsystems.SMToffersworld-classheattransfercapability,sophisticatednitrogencontrol,energyefficiency,outstandingperformanceinprocessgascleaninganduniquevacuumtechnology.WearealsoinvolvedinthefieldofPhotovoltaic/Solar.
SMTNet 71098 Elm StreetPortland,Maine04101Phone:+1207-780-0887Web: www.smtnet.com Roland Girouard, Managing Director +1207-780-0887,[email protected] 1995 SMTnet.com has been a free industry portal site bringing together providers and users of the products, services, and information related to electronicsmanufacturing.OurVision:Tocreateacommunityinwhichindustryprofessionals can exchange their knowledge, services and products.
123
Booths400-999locatedintheSailsPavilion(UpperLevel)•Booths1000+locatedinHallsA–C(GroundLevel)
SMTS LTD. 30501160MageeStreetElmira,NewYork14901Phone:[email protected]: www.smtsales.com Robert Brill, President +1607-426-4846,smtsalesllc@gmail.comSurfaceMountandThroughHoleequipmentsupplier.Feeders,Machineryandservicetoallmajorbrandsofelectronicassemblyequipment.FulllineofFontonBGAReworkanddesolderingEquipment.Spareparts,ServiceandEquipment.
SmtXtra LTD. 1104Unit2CromptonRoadBusinessParkWheatley Hall RoadDoncaster, South Yorkshire, DN2 4PAUnitedKingdomPhone:[email protected]: www.smtxtra.com Sean Cassidy, Engineering Director +447823323657,[email protected] VictorVega,SalesManager +447789984990,[email protected],providingproductivityenhancingsolutions for the global Surface Mount electronic assembly sector. We areaEuropeancompanywithofficesinHungary,theUKandChinaplusrepresentativeofficeinUSA,Canada,MexicoandBrazil.WesupporttheSMT electronics industry globally and have proudly built up our customer basenowexceeding500smalltolargeOEMandCEMs.Wesupplyfeeders,nozzlesandsparepartsforallSMTEquipment.Wealsosell&buyusedequipmentatbestpricesinthemarket.Wecanhelpyoutoreduceyourbudget costs. New Product
Sono-Tek Corporation 37002012Route9WMilton,NewYork12547Phone:[email protected]: www.sprayfluxing.com Bennett Bruntil +1845-795-2020x126,[email protected] Brian Booth +1845-795-2020x131,bbooth@sono-tek.comSono-Tekoffersafulllineofsprayfluxingsystemsforbothselectiveandedge-to-edgePCBfluxing.Compatiblewithallfluxes,oursystemsreducemaintenance and provide uniform coverage, all while cutting flux consumption byupto80%.Thisiswhathasmadeustheworldleaderinsprayfluxingforover25years,withthousandsofsystemsinstalledworldwide.Sono-TekalsoofferstheEVSsolderrecoverysystemwhichtypicallyreducessolderconsumptionby50%whilereducingde-drossingtimes. New Product
Sonoscan, Inc. 13372149 East Pratt BoulevardElkGroveVillage,Illinois60007Phone:[email protected] Web: www.sonoscan.com James Ries, Western Regional Sales Manager +1623-362-1695,[email protected] Steven Martell, Technical Support Services Manager +1847-437-6400x240,[email protected],Sonoscan®, Inc. is a worldwide leader and innovator in Acoustic Micro Imaging (AMI) technology. Sonoscan offers acoustic microscopes and contract services for nondestructive inspection of products for hidden internal defects such as poor bonding, delaminations between layers, cracks and voids.
SPEA America 14292609S.SWLoop323Tyler,Texas75701Phone:+1903-595-4433Web: www.spea.com David Buhrkuhl, President +1903-595-4433x101,[email protected] HeidiLockridge,OfficeAdministrator +1903-595-4433,[email protected],SPEAisaworldleadingcompanyinthefieldofautomatictestequipmentforelectronicboards.Productportfolioincludesthehighlysuccessful4060,4030and4020flyingprobetesters,andthe3030seriesin-circuittesters.Alltestersaredesignedtoprovidebestthroughputandmulti-functiontestcapabilities,includingfullin-circuit,functionaltest,nodal impedance test, boundary scan, optical test. Flying probers are based onauniquelinearmotiontechnology,withlinearopticalencodersfortruepositioning feedback and absolute accuracy. New Product Sponsor
Specialty Coating Systems 26357645WoodlandDriveIndianapolis,Indiana46278Phone:+1317-244-1200Web:www.scsequip.com BillBoyd,WWEquipmentProgramManager +1317-472-1248,[email protected] Carla Gillespie, Marketing Comm. Manager +1317-472-1290,[email protected] Coating Systems will be exhibiting the SCS Precisioncoat spray and dispense system. Stop by the booth to see the system’s programmable tiltandrotate,needlecalibration,andfiducialrecognitionsysteminaction,in addition to the system’s offline programming capabilities. SCS will also be exhibiting Ionograph®ioniccontaminationtestsystemswithnewon-boardcomputer.
Spectrum Assembly, Inc. 5126300YarrowDrive,Suite100Carlsbad,California92011Phone:[email protected]: www.saicorp.com WallyJohnson,VP,Sales&Marketing +1760-930-4000x28,[email protected] MikeBaldwin,VP/GM +1760-930-4000x21,[email protected],SpectrumAssemblyInc.providesa full range of contract manufacturing services including medical device manufacturing, PCB assembly, cable assembly, harnesses, and box builds. ThecompanyisbothISO9001:2008andISO13485:2003certified,andregistered with the FDA and the State of California.
Speedline Technologies, Inc. 324816 Forge ParkFranklin,Massachusetts02038Phone:+1508-520-0083Web: www.speedlinetech.com Erica Candela, Marketing Coordinator +1508-541-4749,[email protected] Michele Collins, Marketing Coordinator +1573-317-3077,[email protected] Technologies is the global leader in process knowledge and expertise for the PCB assembly and semiconductor industries.
EX
HIB
ITO
RS
124 Exhibitors Listing
Spindle Dynamics LLC 2112700627thStreetW,SuiteDUniversityPlace,Washington98466Phone:[email protected]: www.SpindleDynamics.com RichardLong,OperationsManager/President +1253-507-8529,[email protected] RonSerfass,ServiceManager/VicePresident +1253-507-8529,[email protected]’reknownforprovidinghighqualityspindlerepairandrebuildservicefor PCB drilling and routing spindle motors. Our competitive price, timely turnaround,andexceptionalcustomerservicefillagenuineindustryneed.We also supply precision aftermarket replacement PCB collets, exchange spindles, vacuum accessories, tool change components and consumable toolingdesignedtomeetorexceedOEMspecsforquality,wearandcompatibility.Withover60yearsofcombinedexperienceinthedesignandrepairofhighspeedrotatingequipment,wearequicklybecomingtheprovider of choice.
Stellar Technical Products 523707E.GardenaBoulevardGardena,California90248Phone:[email protected]: www.stellartechnical.com Alan Sherry, President +1310-660-0140,[email protected] Roy Sawyer, Field Sales Engineer +1310-660-0140,roy@stellartechnical.comStellarTechnicalProductsisamajorU.S.supplierofSolderingMaterials&Production Supplies servicing electronics and industrial markets. Materials stockedincludeSolderBar,Wire,PasteandFluxes,solderingequipment,hand tools, static protection supplies, cleaning chemicals and more. We specialize in helping electronics manufacturers with their process results, providing technical support and material recommendations.
STI Electronics, Inc. 2921261 Palmer RoadMadison,Alabama35758Phone:[email protected] Web: www.stielectronicsinc.com DianaBradford,VicePresident,Operations/TrainingReso +1256-705-5504,[email protected] DavidRaby,President/CEO +1256-461-9191,[email protected] Electronics, a total solutions partner for the electronics manufacturing industry,offersstate-of-the-artAnalyticalandPrototypeLabservicesaswellas full materials, construction and failure analysis services. STI is highly adeptatmanufacturingspecialty,high-densityassembliesformilitaryandaerospace applications. STI is a distributor for electronic assembly and industrialtools/suppliesincludingBGAreballers.Additionally,thecompanyis an approved IPC Training Center and offers a full range of solder training kits and dummy components.
Stoelting 2418502Highway67Kiel,Wisconsin53042Phone:+1920-894-2293Web: www.stoeltingcleaning.com JimTimler,Sales&MarketingManager +1920-894-2293,[email protected] Tom Gordon, Senior Sales Engineer +1920-894-2293,[email protected]’sCleaningEquipmentDivisiondesignsandmanufacturesacompletelineofcleaningequipment,includingin-linecleanersfortheelectronicsassemblyandsemi-conductorpackagingindustries.Superiorcleaninganddryingresults,andthevarietyofconfigurations,willprovideyouacosteffectivesolutiontoyourspecificwashingneeds.AskusaboutourLiquidLockTechnology!
Stone Mountain Tool 536480GeesMillBusinessCourtConyers,Georgia30013Phone:+1770-929-0166Web: www.stonemountaintool.com Steve Hughes +1800-624-8665x113,[email protected]
Taconic 2208136CoonbrookRoadPetersburg,NewYork12138Phone:+1518-658-3202Web: www.4taconic.com Stacey Sears, Marketing Manager +1518-658-3202x245,[email protected]
Taiwan External Trade Development Council 24003660WilshireBoulevardLosAngeles,California90010Web: www.taitra.org.tw
Taiwan Printed Circuit Association (TPCA) 737No.147,Sec.2,GootieN.Road,DayuanTaoyuan,33743Taiwan, ROCPhone:+88633177272Web: www.tpca.org.tw Mary Hsu, Specialist +88633177272,[email protected] Thomas Chen, Manager +88633177272,[email protected] Taiwan Printed Circuit Association (TPCA) was established in 1998. The TPCA is the only PCB industry organization approved by the government of Taiwanserving540membercompanies.TPCAaimstoprovidethelatestmarket information, promote information exchange and resources among members through collaborative efforts, and attend international conventions.
Taiwan Union Technology Corporation 1906830Bo-aiStreetJhubei,HsinchuCounty,302-65TaiwanPhone:+88635551103Web: www.tuc.com.tw GeorgeHsin,Director,InternationalSales/Marketing +88635551103,[email protected] Iliang Lin, Manager, International Sales +88635551103,iliang.lin@tuc.com.twTUCusesthebestrawmaterialsandmanufacturingstandardstoproduceconsistent and reliable advanced materials and advanced mass lamination service to the global electronics industry. Products include high speed low loss,environmentallyfriendly-leadfreecompatibleandhalogenfree,lowCTEandsuperiorchemicalandthermalresistance,andrigid-flexapplicationsprepregs.TUC’sproprietaryprocessingresultsinconsistent,nearlyvoid-freeproducts(ULVPTM)withimprovedCAFresistance,betterimpedancecontroland elimination of striations and dryness. New Product
Taiyo America, Inc. 23072675AntlerDriveCarsonCity,Nevada89701-1451Phone:+1775-885-9959Web:www.taiyo-america.com MelanieWylieBinzel,Sales&MarketingAdministrator +1775-885-9959x139,[email protected] JohnFix,Mgr&Dir,SlsandMktg +1775-885-9959x118,[email protected] America, Inc. is a subsidiary of TAIYO HOLDINGS. CO., LTD., the world’s leading manufacturer of specialty inks and solder masks for printed circuit boards.BasedonTaiyo’sownproprietarytechnology,TAIYO’sPSR-4000liquidphotoimageablesoldermaskproductshavebeenpatentedthroughoutthe world. We now offer conductive inks for manufacturing printed electronics, solar cells and other applications.
125
Booths400-999locatedintheSailsPavilion(UpperLevel)•Booths1000+locatedinHallsA–C(GroundLevel)
TAMURA H.A./EUNIL H.A. 630861HaroldPlace,Suite107ChulaVista,California91914Phone:+1619-661-8275Web:www.tamura-ha.com/www.eunil-ha.com PeterKim,SalesManager +1619-661-8275x111,[email protected] Haruki Takahashi, General Manager +1619-661-8275x110,[email protected] H.A. Machinery distributes and services the complete line of TamuraWave,ReflowandSelectiveSolderingequipmentforelectronicsmanufacturingindustries.Pioneersandpromotersofthelead-freesolderingprocess,Tamuraenables100%lead-freeproductioninmanyoftheworld’slargestelectronicsmanufacturingcompanies.Eunilisaworld-wideleaderin the Factory Automation Industry as a manufacturer of SMD peripheral equipment.AtEunilH.A.,Americas,Inc.weprideourselvesonprovidingthebest customer service in the industry. New Product
Tapco Circuit Supply 22091225 Greenbriar DriveAddison,Illinois60101Phone:[email protected]: www.tapcocircuitsupply.com ToddPalmer,VPSales&Marketing +1612-369-6117,[email protected] Lisa Qualey, Customer Service Manager +1763-390-1071,[email protected] Circuit Supply is a leading national supplier of materials and process solutions to the printed circuit board industry. We are proud to represent severalpremierequipmentlinesanddistributelaminates,prepreg,processchemistries, imaging, lamination and drill products. Tapco Circuit Supply is committed to provide every customer with the highest level of service, convenienceandreliability.Pleasevisitusatbooth2209orexploreourwebsite at www.tapcocircuitsupply.com.
TDI International, Inc. 8203351E.HemisphereLoopTucson,Arizona85706Phone:[email protected]: www.tdiinternational.com Bill DeJean, President +1520-799-8000,[email protected] International, Inc. is a major provider of cleanroom and assembly precisionhandtoolsandequipment.Weofferoneofthelargestselectionsof tweezers, cutters and pliers, diamond scribes, screwdrivers and probes in the industry. TDI also supplies acrylic and stainless steel desiccator cabinets, acrylic gloveboxes, cleanroom chairs, workstations and carts.
TDK - Lambda Americas 1408405EssexRoadNeptune,NewJersey7753Phone:[email protected]:www.us.tdk-lambda.com/hp John Breickner, Product Manager +1732-922-9300x230,[email protected]™programmableAC/DCpower.750Wto15kW,Outputs7.5to600VDC,currentto1000A.WorldwideInputs,RS-232/485Standard.AdvancedParallelOperation-fourlikeunitsinparallelfor60kW.Commonfamily controls. Flexible, reliable power for critical test systems and OEM products.RoHSCompliant.GPIB&LANOptionsavailable.
TEAM A.T.E. 11231039IncaStreetDenver,Colorado80204Phone:[email protected]:www.team-ate.com MikeBlackler,V.P.ofSalesandMarketing +1303-628-7946x150,[email protected] VictorGoldbaum,AccountManager +1303-628-7946x152,[email protected].,isaninternationaldealerofpre-ownedelectronicsmanufacturingequipmentspecializinginautomatictestequipmentusedtotest semiconductors and printed circuit boards in the manufacturing process. Webuy,sell,andrentabroadrangeoftestequipment;offeringupgrades&exchangesonmanysystems,wecancustomconfiguretestsystemstomeetyourspecificrequirements.WeofferanextensiveinventoryofAgilent,GenRadandTeradynesparepartsat:www.partstore.team-ate.com.Bookmarkthissite,to take advantage of the many great sales promotions we offer online!
Technic Inc. 223647MolterStreetCranston,RhodeIsland2910Phone:+1401-781-6100Web: www.technic.com Eric Stafstrom, Global Product Manager +1401-784-4801,[email protected] Tom Horigome, Imagining Product Manager +1516-349-0700,[email protected] a full line of PCB process chemistry, primary imaging products, soldermask,legendink,controllers,processequipmentandongoingtechnical support. North American representative for Alfachimici and Nippon Paint products. Supplier of Automated Plating Systems, customized hoist and continuous vertical processing systems for panel, pattern and flexible materials. New Product
Technical Devices Company 3723560AlaskaAvenueTorrance,California90503Phone:+1310-618-8437Web: www.TechnicalDev.com Julio Montjoy, International Sales +1310-618-8437,[email protected] Roger Trovato, Director of Sales +1310-618-8437,roger@technicaldev.comTheleadingmanufacturerofBATCHandINLINEAQUEOUSCLEANINGEQUIPMENT.TheNU/CLEANLineofTouchScreenControlledAqueousInlineand Batch Cleaners can handle any cleaning challenge from complex circuit boardstoglasslensestobatteries.Weevenofferahybrid-naturalgasmodel to meet your environmental and economical needs. We also offer the Nu/EraCVlineofWaveSolderingMachinesalongwithunmatchedserviceand support. Established in 1952, no other company in the world can match the technical know how and the superior customer service of TECHNICAL DEVICESCOMPANY.
Test Research USA, Inc. 1441500LaurelwoodRoad,Suite1SantaClara,California95054Phone:+1408-567-9898Web: www.tri.com.tw StephenChang,SalesVP&GM +1408-0667-4752,[email protected] Floyd Conner, Technical Engineering Manager +1408-567-9898,[email protected],Inc.(TRI)providescomprehensiveboardtestandinspection solutions for electronics manufacturers across a diverse range of industries. With over two decades of innovation and a commanding market position in Greater China—the global hub for electronics manufacturing—TRI possesses the expertise and experience to offer the right solutions for AOI,SPIAXI,MDA,ICTandFunctionalTestsystemsatanoptimalprice/performance ratio. We encourage you to visit us at booth# 1441 and learn about our comprehensive PCBA test and inspection capabilities.
New Product
EX
HIB
ITO
RS
126
www.IPCAPEXEXPO.org
Exhibitors Listing
Texmac/Takaya Inc. 34033370MontgomeryDriveSantaClara,California95054Phone:+1408-970-9171Web: www.texmac.com RoyMcKenzie,SalesManager +1408-970-9171x19,[email protected] John Oaf, Sr, Application Engineering Manager +1847-393-6001,joaf@texmacusa.comInventorandworldleaderinfixturelessloadedboardtesters.Takayafixturelesstestersofferunmatchedreliability,accuracy,easeofuseandprogramming for complete detection of manufacturing faults on loaded p.c. boards as well as power up capability, Boundary Scan, AOI and other inspection tools.
Ticer Technologies 20222555WestFairviewStreet,Suite101Chandler, Arizona 85224Phone:+1480-223-0891Web: www.ticertechnologies.com David Burgess, President +1480-223-0891,[email protected] Technologies manufactures TCR®,asputteredthinfilmresistorcopperfoilthatisusedforembeddingin-traceresistorsintomultilayerPWBs.Benefitsofembeddedresistorsinclude:freedsurfacespaceforactivedevices,improvedperformanceandsignalquality,andreducedPWBsize.Availableinsheetresistancesof25,50,100,250,and1000ohmspersquare,TCRisthermallystableandprovidesreliableperformanceafterPWB fabrication processes. It can be ordered on several laminate platforms through your laminate material supplier.
Tintronics Industries 5282122 Metro CircleP.O.Box18335Huntsville,Alabama35801Phone:[email protected] Web: www.tintronics.com Tom Ott, Sales Manager +1256-650-0220,tom.ott@tintronics.comOfferingTurn-KeyValueaddservicestoIndustrySpecifications.RoboticHot Solder Dip, Tin mitigation, gold removal, solderability enhancement, Pb freeconversions,BGAreballandalloyconversion,tape&reel,leadform&excise,solderabilitytesting,anddry-packagingservices.AnAS9100Rev.C/ISO9001:2008Company.
TMP Inc. A Division of French 21141035W.GreeneStreetPOBox920Piqua,Ohio45356Phone:[email protected] Web:www.techmach.com/cblam.html Douglas Smith, Sales Engineer +1937-773-3420,[email protected] DaveSledz,VicePresident +1216-281-9500,[email protected] Inc., A Division of French designs, manufactures and supports Hydraulic VacuumLaminationPresses,fromprototypetofullyautomatedsystems.Aleaderinhightemperature,tighttolerancepresses,TMPcustom-designspresses to meet customer’s needs with design enhancements for PTFE, ceramic,flex,highfrequencyandmicrowavematerials.TMPalsooffersmachinerebuildingandretrofitsforautomation,improvedproductqualityand process control. TMP’s proven technology and dedicated service will give youhigherqualityboardsandincreasedproductionwithreducedcosts.
TongLing Chao Yuan Precision 2139 Electronics Co. EconomicDevelopmentZoneIndustrialParkTongling,AnHui244000China
TopLine 130195 Highway 22 WestMilledgeville,Georgia31061Phone:[email protected]: www.topline.tv Jared Wilson, Sales Manager +1800-776-9888,sales@topline.tvDaisyChainDummyComponentsandPracticeKits.Lead-FreeandTin-Leaddummycomponents.PCBoardsforMachineRun&SolderPractice.BGA,CSP,WLPWaferLevelBGAandfinepitch.eWLPembeddeddaisychaindieforbuildupPCB.Opencavity(air-cavity)QFNformountinglivedie.QFPLeadStraightenertool.DaisyChainBGAwith0.3mmand0.4mmpitch.CCGApinsavailable. New Product
Toshi Technology Inc. 372922152 Paseo Del SurLaguna Beach, California 92651Phone:+1818-4483Web: www.toshitech.com ToshikoKikuzaki,President +1818-512-4483,[email protected],hasbeenausedelectronicPCBassemblyequipmentdealer since 1989. We are a specialist in buying and selling used electronic PCBassemblyequipment,andusedfullyautomaticICtestequipmentbothnationally and internationally. We will offer you a fair price for your used surplusequipment,andwehavealistofcurrentusedequipmentforsaleandlooking to purchase.
Total Parts Plus 814709AnchorsStreetNWFt.WaltonBeach,Florida32548Phone:[email protected]: www.totalpartsplus.com KeithBiggs,CEO +1850-244-7293,[email protected] Mark Guttierez, Sales +1850-244-7293x250,[email protected] Parts Plus specializes in environmental compliance and obsolescence managementsolutionsintheformofdatacontentandweb-basedsolutions.TPP’s suite of products and services provide information and reporting forRoHSCompliance,REACH/SVHC,ConflictMinerals,ObsolescenceManagement,IPC-175xreporting,AlternateEquivalentsandSourcinginformation, PCN Alerts and Life Cycle Predictions.Our mission is to help our customers grow their businesses by providing critical component content services, resulting in substantial cost savings relating to component management. New Product
Totech Super Dry 506235ColovistaParkwayAustin,Texas78602Phone:[email protected]: www.superdry.info Richard Heimsch, Director +1312-513-3513,[email protected] Jos Brehler, CEO +31321330239,[email protected] and storage solutions for Moisture Sensitive Devices. A wide rangeofdesiccantcabinetsdesignedtoexceedIPC/JEDECJ-STD-033B.1.
New Product
127
Transition Automation Inc. 27035 Trader Circle, Building DTyngsboro,Massachusetts01879Phone:[email protected]: www.transitionautomation.com AldenLewis,VicePresidentofSales +1978-649-2400,[email protected] Mark Curtin, President +1978-649-2400,[email protected] Automation, Inc. is a pioneer in the manufacturing and sales of PermalexEdgeMetalSqueegees,andPrinTEKSMTprintingsystems.ThePermalexEdgeMetalSqueegeeshaveadvancedthecapabilityofmanylargeandsmallcorporationswhohavechallengingfinepitchSMTassembly.OurPermalexmetalsqueegeesareknownforlonglastingstableperformanceindemandingfinepitchprintingapplications.Thisyear,TransitionAutomationintroducesaredesigneddesktopSMTprinter:thePrinTEKISMTprinter:Forhigh capability, high mix SMT processing. All Products are Fully Guaranteed.
New Product
TUV Rheinland 37311300MassachusettsAvenue,Suite103Boxborough,Massachusetts01719Web: www.tuv.com KatherineRussian,[email protected]
U.S. Tech 72110GayStreetPhoenixville,Pennsylvania19460Phone:+1610-783-6100Web:www.us-tech.com Walter Salm, Editor +1732-616-4716,[email protected] Jacob Fattal, Publisher +1610-783-6100,[email protected],amonthlyinternationalhi-techelectronicspublicationreachesover400,000designengineers,manufacturing&productionmanagers,buyers,productspecifiers,andcorporatemanagementontheweb,inprintandviaApple&Androidaps.WefocusonnewinnovationsinSMT,PCBdesign&fabrication,contractassembly,testequipment,components&distribution.Alsoavailableasadigitalpage-turnpublication.
Ucamco USA 21103112ndStreet,Suite502Oakland,California94607Phone:+1949-632-6895Web: www.ucamco.com LucMaesen,PresidentUcamcoUSA +1949-632-6895,[email protected] KarelTavernier,ManagingDirectorUcamco +1329-216-9901,Karel.Tavernier@Ucamco.comUCAMCONVisamarketleaderinthedesignandmanufacturingofPCBCAMandlaserphoto-plottingsystems.Wehavemorethan25yearscontinuousexperiencedeveloping,supplyingandsupportingleading-edgefront-endtoolingsolutionsfortheglobalPCBindustry.Wehelpfabricatorsworld-wideraiseyields,increasefactoryproductivity,andcutenterpriserisksandcosts.For25yearsourproductgoalshavebeenbest-in-classperformance,long-termreliability,andcontinuousdevelopmenttokeepeachuseratthecutting-edgeofhischosentechnology.
UL (Underwriters Laboratories) 607333PfingstenRoadNorthbrook,Illinois60062Phone:[email protected] Web: ul.com Ovidiu Munteanu, Business Development Manager [email protected] ULisanindependent,not-for-profit,globalproductsafetytestingandcertificationorganization.Visitourbooth#607ontheupperlevel,orUL.comformoreinformationonourlatestdevelopmentsandhowULcanassistyouwithyourproductsafetycertification.AskusaboutourIndustryAssociationGroup meeting to be held during the show, where you can hear what is new and provide feedback on the market and your company’s needs.
Unicomp Technology USA 8018260E.ArabianTrail,Unit278Scottsdale, Arizona 85258Phone:+1909-996-8689Web: www.unicomp.cn Todd La Marche, CTO +1909-996-8689,[email protected] KurtRoth,NorthAmericaManager +1630-532-2072,krothsales@aol.comUnicompTechnologyisadesignerandmanufacturerofinspectionmachines,stencil cleaners and rework machines. This includes:*AX-6080Manualx-rayforbasicBGAandSMTinspection*AX-7100LManualx-rayforhighresolutionBGAandSMTinspection*AX-8200Semi-automatedx-rayforhighresolutionBGAandSMT
inspection*UT-900BPre-reflowinlineAOIincludingSPCreporting*UT-R600CBGAreworkmachinewith“AutoProfile”feature*SC-P2/SC-PL1Pneumaticstencilcleanersforsolderpaste,glueandsiliconremoval. Our machines are high performance with aggressive pricing!
New Product
UNICOTE - Halco LLC 2319105Route101A,Unit7Amherst,NewHampshire3031Phone:+1603-883-1183Web:www.unicote-halco.com Ray Rose, President +1603-883-1022,[email protected] Annie St. Peter, Operations Manager +1603-883-1183,annie@unicote-halco.comUNICOTE-HalcoLLCwithcorporateofficesinAmherst,NHmanufacturesHorizontalHotAirLevelingEquipmentbenefitingthePCBIndustrywithequipmentsalesandbysupplyingaLeadFreefinalfinishproductthroughourownservicebureauunderthenameofUNICOTE-FinishesLLC.Eachoperation is positioned to support both rigid and flexible products.
United Resin Corporation 11444359NormancyCourtRoyalOak,Michigan48073Phone:+1800-521-4757Web: www.unitedresincorp.com John Los, [email protected] Global Manufacturer of epoxies for electronic potting, insulating, adhering and coating applications. Specializing in ROHS and REACH compliant materials used in thermally conductive, technology advanced adhesives, one-componentandULapprovedsystems.Specialsystemsincludeoptoelectronic,COBandSMTmaterials.Weofferover3,000materialcombinations,allowingthesystemtobecustomizedtoyourspecificneeds.
Universal Instruments Corporation 273733BroomeCorporateParkwayConklin,NewYork13748Phone:+1607-779-5806Web: www.uic.com KristiSchilloff,TradeShowCoordinator +1607-779-5806,[email protected] DebboraAhlgren,VicePresident,Marketing +1607-779-7960,ahlgren@uic.comUniversalInstrumentsisacompletesolutionsproviderandcanassistwithevery aspect of your products life cycle, ranging from applied materials selection, prototype production builds, factory layout, and applications design and development. New Product
EX
HIB
ITO
RS
128
www.IPCAPEXEXPO.org
Exhibitors ListingUPA Technology 33178963Cincinnati-ColumbusRoadWestChester,Ohio45069Phone:+1513-755-1280Web: www.upa.com Mike Justice, President +1513-755-1280,mjustice@upa.comUPATechnologyprovidesinstrumentsandthicknessstandardsformeasuringcoating&platingthicknessforthePCB&Electronicsindustries.UPAalsoprovidesXRFsystemsforRoHSandmaterialanalysis.Instrumentsinclude:X-Rayforplatingthickness,RoHSandrestrictedelementanalysis.HandheldBeta Backscatter instruments for measurement of coatings and platings on PC boards, wafers and electronics. CopperDerm systems are also available for measuring surface copper thickness on laminate.
Uyemura International Corporation 19013990ConcoursStreet,Suite425Ontario,California91764Phone:+1909-466-5635Web: www.uyemura.com Anthony Revier, President +1909-466-5635,[email protected] DonaldWalsh,NationalSalesManager/DirectorofOpera +1860-793-4011,[email protected]:NEWelectrolessnickel/immersiongold,RGAimmersionsilver,NEWRMKimmersiontinandDIGimmersiongoldovercopper.Uyemura’selectroless gold and palladium(ENEPIG) products; high throw electrolytic nickel;acidcoppers(includingmarketleadingviafillcopper-EVF);UmicoreGalvanotechnik’s precious metal electrolytic plating processes and MEC’s NEWevenhighertechnology/morecostefficientlineofspecialtycopperetching processes.
V-TEK, Inc. 1307751SummitAvenueMankato,Minnesota56001Phone:[email protected]: www.vtekusa.com Andrea Nelson, Sales and Marketing Administrator +1507-345-0171,[email protected] Molly Robinson, Administrative Assistant +1507-345-0120,m.robinson@vtekusa.comMorethan25yearsofexperiencehasearnedV-TEKareputationasaglobal leader in the SMD industry. From a broad range of automatic and manual machines, to tape and reel materials, and packaging and processing solutions,V-TEKproductsandservicesareinoperationworldwide.Togetmoreinformation,pleasevisitV-TEK’swebsiteatwww.vtekusa.com.
New Product
Ventec-USA 2145311HighlandAvenueFullerton,California92832Phone:+1978-521-9700Web: www.globallaminates.com BruceHurley,VicePresident +1978-521-9700,[email protected]
Vi TECHNOLOGY 2749903N.BowserRoad,Suite202Richardson,,Texas75081Phone:[email protected] Web: www.vitechnology.com ErinKrikstone,AdministrationManager-Sales +1972-235-1170,[email protected] Jean-MarcPeallat,President-Americas +1972-235-1170,[email protected],manufactures,andsupportsturnkeyAOIsolutionsfor PCB assembly, incoming inspection and process control applications. Create value to our customers is our goal by bringing technological breakthrough to reduce defective parts assembly, maximize the ROI and decreasethecost-of-ownership.Serveourcustomerstoreachasustainableexcellence and Total Customer Satisfaction is our mission. New Product
Virtual Industries, Inc. 6282130VictorPlaceColoradoSprings,Colorado80915Phone:[email protected]:www.virtual-ii.comVirtualIndustriesisamanufacturerofvacuumtweezersandaccessories.ProductsincludethePEN-VAC®familyofself-containedvacuumtweezers,theTWEEZER-VAC® line of benchtop AC powered systems that can handle partsassmallas.005”(.127mm)towellover12”(305mm).AlsoavailableisthepopularPORTA-VAC®andPORTA-WAND® units that are battery operated andcanhandlewafersupto300mm,and,acompleteofferingofwaferhandlingwands,tipsandhoses.AllproductsaremanufacturedintheUSA.
Viscom Inc. 36291775BreckinridgeParkway,Suite500Duluth,Georgia30096Phone:+1678-966-9835Web: www.viscom.com VerenaZurhausen,MarcomManager +1678-966-9835,[email protected] Ed Moll, Western Regional Manager +1678-966-9835,[email protected](SPIandAOI),automaticX-ray(AXI)inspectionequipmentforPCBassembly.In-lineInspectionofPaste,Placement,Post-Reflow,Post-Wave,andSelectiveSolder.100%SolderJointInspection,includinglead-free,toIPCstandards.Highspeedandhighperformancesolutions,3D.Microelectronicsinspectionequipmentforbond,thickfilm,andconductive glue.
Vision Engineering 3735570DanburyRoadNewMilford,Connecticut6776Phone:+1860-355-3776Web: www.visioneng.us Tammy Clinton, Marketing Manager +1860-355-3776,tclinton@visioneng.comVisionEngineeringisaworldleaderinergonomiceyepiecelessstereomicroscopes(MantisandLynx)andnon-contactmeasurementsystems(Kestrel,FalconandHawk),combiningqualitycontrolaccuracyandrepeatability.Visit:www.visioneng.us. New Product
Vistana 42920362WindrowDriveLakeForest,California92630Phone:[email protected]: www.vistanagroup.com Chris Miller, Product Manager +1603-237-3013,[email protected] John Lee, Marketing +1949-340-8434,jlee@insulectro.comVistanasupportsthePrintedElectronicsmarketsbyofferinga“one-stop-shop”ofthelatestinnovativematerialsfrom“best-in-class”vendorsparticularly inks, substrates, and consumables.Ourstate-of-theartproducts,unparalleledtechnicalsupportandworld-classcustomer service assure our customers that our products are the highest qualitypossiblethroughournationaldistributionfootprint.
Vitronics Soltec 350945054CorteValleTemecula, California 92592Phone:+1603-772-7778Web:www.vitronics-soltec.com Mick Austin, Americas Director of Sales +1603-502-1792,[email protected],reflowandselectivesolderingtechnologiesfeaturingbrandssuchastheawardwinningXPMseriesreflowovens featuring Autoset the automatic oven recipe generator; Delta series wavesolderingfeaturingthelowestdrossgenerationintheindustry;67series Selective soldering systems featuring EasyTeach program creation software with multi wave and select wave soldering options for all your selective needs.
129
ViTrox Technologies Sdn Bhd 135185-ALintangBayanLepas11Bayan Lepas Industrial Park, Phase 4BayanLepas,Penang,11900MalaysiaPhone:[email protected]: www.vitrox.com KahKhimWee,VP&GM(PCAAOI/AXI) +1604-646-6227,[email protected] Sam Chai, PCA Business Development Manager +1604-646-6227,meng-hong.chai@vitrox.comViTroxTechnologiesprovidesanextensiverangeofAutomatedOpticalInspection(AOI)andAutomatedX-RayInspection(AXI)machineswhichcaterfor printed circuit board assemblies (PCBA) inspection. With the exceptional performanceofourAOIandAXImachinesthroughdeployingstateofarttechnologies,manufacturerswillbenefitfromexcellentproductionqualityandefficiencyandmaximizedcostreductionandmanufacturingthroughput. In return, this will transform into attractive return on investment.
New Product
VJ Electronix, Inc. 3051234TaylorStreetLittleton,Massachusetts01460Phone:+1978-486-4777x1200Web: www.vjelectronix.com AlCabral,Marketing&SalesManager +1978-486-4777x1247,[email protected] Don Naugler, General Manager +1978-486-4777x1215,[email protected],Inc.,istheleaderinReworktechnologiesandglobalproviderofadvancedX-Rayinspectionsystems.VJElectronix,Inc.manufacturesproductionreadyReworkandX-rayinspectionsolutionswithadvancedcapabilities. The company primarily serves the Electronics Assembly and SemiconductorPackagingindustries.VJElectronixalsoiscapableofdeveloping complete turnkey custom solutions. Operator and maintenance training, comprehensive service contracts, technical support, and spare parts, are available to simplify all aspects of owning and using all of our systems.
WAGO Corporation 3721N120W19129FreistadtRoadGermantown,Wisconsin53022Phone:[email protected] Web: www.wago.us DeanNorton,V.P.ofMarketing +1262-255-6222,[email protected] Corporation’s connection technology streamlines electronics engineering, design and assembly. A leader in PCB components, Wago innovationsincludetool-free,lever-operatedandpush-buttonterminalblocksthat minimize installer strain and ensure reliability. Connections utilize Wago’s Cage Clamp Spring Pressure Technology, preventing vibration and temperature cycling from loosening wire connections. This makes connections reliable, corrosion-resistantandtrulymaintenance-free.WAGOalsoprovideselectronicinterface,chassis&DIN-railterminalblock,automationtechnology.
Weller 12291000LufkinRoadApex,NorthCarolina27539Phone:[email protected]:www.apexhandtools.com/weller Linda Rowland, Manager +1919-387-2514,[email protected] Glenn Schindo, Director, Electronics +1919-387-2617,[email protected], the name synonymous with soldering technology innovation, is once again leading the way with application solutions to your most complex electronicsmanufacturingchallenges.ThenewWX2solderingplatformis an innovation that we owe to input from our customers. From its high power performance to the glass touchscreen, Weller has raised the bar on performance again. Our fume extraction systems are perfect examples of Weller responding to current industry trends and anticipating the future direction of occupationalsafetyandhealthawareness.Visitustofindoutmore.
Wiring Harness News BinPOBox527Richmond,Illinois60071Phone:+1815-337-7885Web: www.wiringharnessnews.com KathyFreund,Circulation/AdvertisingSales +1815-337-7885,[email protected] Marilyn Magowan, Editor +1877-315-8333,marilynmagowan@yahoo.comWiringHarnessNewsisabi-monthlytabloidtradenewspaperservingthewire,cableandfiber-opticprocessor.Ittargetswiringharnessandcableassembly shops, cord set manufacturers, and thousands of companies that process electric wire and cable for use in their own product.
Wise srl 2100ViaMartinella100/AAlberiDiParma,Italia43024ItalyPhone:[email protected]: www.wisecompany.it Stefano Gatti, Sales Manager +393482805812,[email protected] is consolidated company with flexible organisation who have knowledge of market needs. WISE can supply new machines covering the complete range of horizontal wetprocessingandpre-treatmentequipment,requestedbyPCBandFPCmanufacturers. In terms of machine construction and performance, our productsareofuttermosthighlevelquality,availableonthemarket.Allthat,thanks to experience gained over the years it is able to offer solutions with hightechnologicalcontentandhighoperationalefficiency. New Product
World Equipment Source Owned By: 1414 R-1 Source, Inc. 8655 Production Avenue, Suite BSan Diego, California 92121Phone:[email protected] Web: www.wesource.com Thomas Rone, CEO +1858-693-1991,[email protected] ToddStromenger,VPSales +1858-693-1991,[email protected](OwnedbyR-1Source)IsyourBESTSourcetoSAVE$$onPre-ownedSMT,ProductionandTestEquipment.Withover$5,000,000instock,WespecializesinLargeVolumePurchases-WePasstheSavingstoYou!WebuyandsellqualitySMT,ProductionandBenchTopandWirelessCommunicationsTestEquipment.Save30%to70%offListPrice! Why spend more! Call us today! Global Asset Management, Auctions, Liquidations,LeadFreeApplications,WaveSolder,Pick&Place,ScreenPrinter,AqueousCleaners,X-Rayandmanymore.WorldEquipmentSourceisYour Global One Stop Solution.
X-Line Asset Management 29231161RingwoodCourt,#50SanJose,California95131Phone:+1408-690-6725Web: www.xlineassets.com AndrewJoos,VicePresident +1408-690-6725,andrew@xlineassets.comX-LineAssetManagementisaleadingproviderofdispositionandauctionserviceswhichhelpcustomersliquidatesurplusassetstotheglobalmarketplace for the highest value. Whether organizations are in the market topurchase,sell,orvalueassets,X-linecanofferflexiblesolutionsformaximumbenefitstoyourorganization.
EX
HIB
ITO
RS
130
www.IPCAPEXEXPO.org
Exhibitors Listing
XACT PCB 1912Saville ExchangeNorthShields,Tyne&Wear,NE301SEUnitedKingdomPhone:[email protected]: www.xactpcb.com LesAnderson,ApplicationsManagerUSA +447894165325,[email protected] AndrewKelley,TechnicalDirector +447882680859,[email protected]’sleadinginnovatorintechnologiesforthecontrolandprediction of PCB registration.
XJTAG 1121St. John’s Innovation Centre, Cowley RoadCambridge, Cambs, CB4 OWSUnitedKingdomPhone:+44(0)1223223007Web: www.xjtag.com Simon Payne, CEO +144(0)1223223007,[email protected](JTAG,IEEE1149.x)boundaryscantrialanddiscoverhowyoucansignificantlyreducedebugginganddevelopmenttime.Ifyoudesignboards with BGAs, have hardware that include FPGAs, CPLDs, DSPs or microprocessors and you would like to debug your boards, detect faults and proveyourdesignquicklyandeasilythenXJTAGcanhelpyou.Wecanofferyouafree30daytrialonyourownelectronics.Yes,that’sright;XJTAGcandothesetuponyourelectronichardwareforfreewhenyoutakea30daytrial.Applytodayatbooth1121orvisitwww.XJTAG.com.
Yamaha Motor IM America, Inc. 17471270ChastainRdKennesaw,Georgia30144Phone:[email protected]:www.yamaha-motor-im.com [email protected] ScottZerkle,GeneralManager +1(770)420-5825,[email protected] Motor IM America, Inc. sells and supports perfect solutions for the SMT market from Screen Printing and Dispensing solutions to AOI. Our management software suite provides solutions for the pursuit of productivity. Ourflagshipplacementmachinethe“YS24”hastheworld’shighestareaproductivity(34000CPHper1sq.m*2).ThismachineisalsocapableofverylargeboardsofuptoL700XW460mm.Yamaha’ssurfacemountersarehighlyacclaimedinthemarketfortheir“moduleconcept”andthereareover30,000unitsinstalled.Comeseetheultimatemachineatourbooth!
YJ Link America, Inc. 80728120RidgethorneRanchoPalosVerdes,California90275Web: www.yjlink.com New Product
YXLON 26293400GilchristRoadMogadore,Ohio44260Phone:+1330-798-4800Web: www.yxlon.com JayBurdette,DirectorofSales&Marketing +1330-798-4828,[email protected] Sheri Martin, FeinFocus Product Line Manager +1330-798-4838,sheri.martin@yxlon.comYXLONistheleadingsupplierofindustrialX-RayinspectionandCTsolutionsforthenon-destructivetestingofmaterialsandelectronics.TheYXLONproduct portfolio includes the Y.Cheetah and Y.Cougar which offer effortless high-qualityX-Rayimagingforawiderangeofcontinuousinspectiontasks.The Y.Cheetah and Y.Cougar combine proprietary FeinFocus technology withadvancedhigh-speedflatpaneldetectortechnology.Withinseconds,thesystemsadaptbetweeninspectiontasks-failureanalysis,researchanddevelopment, process control and product testing including QuickScan mode.
ZESTRON 362111285 Assett LoopManassas,Virginia20109Phone:[email protected]: www.zestron.com Sal Sparacino, Technical Marketing Manager +1703-393-9880,[email protected] MichaelMcCutchen,VicePresidentAmericas&SouthAsia +1703-393-9880,[email protected],Virginia,andoperatinginmorethan35countries,ZESTRONisthegloballyleadingproviderofhighprecisioncleaning products, services and training solutions for the electronics manufacturingindustry.Withfiveworldwidetechnicalcentersandthelargestteamofchemicalengineersintheindustry,ZESTRON’scommitmentto ensuring that its customers surpass even the most stringent cleaning requirementsiswithoutequal.Foradditionalinformationortotouroneof our unparalleled technical centers, please visit www.zestron.com.
New Product Zone New Product
Zymet 5217GreatMeadowLaneEastHanover,NewJersey07936Phone:[email protected] Web: www.zymet.com Sean Sandage, Customer Service Manager +1973-428-5245x11,[email protected] and encapsulants for electronics and optoelectronics assembly. Products include electrically conductive, thermally conductive adhesives, ultra-lowstressadhesives,anisotropicallyconductiveadhesives,UVcurableglobtopencapsulantsandunderfillencapsulantsforflipchips,CSPsandBGAs,includingreworkableunderfillencapsulants.
Advanced Chemical Company. . . . . .67Advanced Electronic Technology . . .47 HKLtd.Aiscent Technologies, Inc. . . . . . . . .33Circuits Assembly and Printed . . . . .64 Circuit Design & Fab Alpha-CooksonElectronics . . . . . . . . 21CPCA . . . . . . . . . . . . . . . . . . . . . . . . . 56Dow Electronic Materials . . . . . . . . .13EMChina.org.cn . . . . . . . . . . . . . . . .131
EMSNow . . . . . . . . . . . . . . . . . . . . . .34EMTWorldwide . . . . . . . . . . . . . . . . .78EuroAsia Semiconductor . . . . . . . . . . 62GardienServicesUSAInc. . . . . . . . . 22GEMeasurement&Control . . . . . . 115Global SMT & Packaging . . . . . . . . . 26GPD Global Inc. . . . . . . . inside front cover
I•Connect007 . . . . . . . . . . . . . . . . . . 48INVENTECPerformanceChemicals .71Isola Group . . . . . . . . . . . . . . . . . . . .17
JTech Solutions Inc. . . . . . . . . . . . . .73Microscan Systems Inc. . . . . . . . . . .77+PlasticElectronics . . . . . . . . . . . . . 81RealTime with . . . . . . . . . . . . . . . . . . 18SchmidSystemsInc.USA . . . . . . . . . . 5Simplimatic Automation . . . . . . . . . . 25Total Parts Plus . . . . . . . . . . . . . . . . .37WorldEquipmentSource . . . . . . . . . 59 OwnedBy:R-1Source,Inc.ZESTRON . . . . . . . . . . . . . . . . . . . . . .53
Advertisers Index
www.IPCAPEXEXPO.org
Exhibit Hall Floor PlansE
XH
IBIT
HA
LL
1100 1101
1104
1106
1108
1111
1112
1120 1121
1123
1128 1129
1131
1132
1136
1137
1138
1144
1146
1148
1152
1220 1221
1228 1229
1232 1233
1301
1303
1307
1315
1317
1320 1321
1328 1329
1332
1337
1345
1351
1400 1401
1402
1404
1407
1408
1414
1421
1429
1435
1436
1441
1444
1529
1537
1601
1609
1617
1629
1636
1641
1701
1703
1707
1709
1715
1721
1747
1800 1801
1802
1806 1807
1813
1814
1816
1819
1820
1822
1829
1837
1900 1901
1906 1907
1912 1913
1919
1921
1929
1935
1941
1945
1951
2001
2009
2011
2018 2019
2022
2029
2037
2040
2043
2044
2049
2050
2053
2100 2101
2107
2108 2109
2110
2112
2114 2115
2117
2121
2129
2136 2137
2139
2142
2145
2148
2151
2152
2200 2201
2202
2206
2208 2209
2214 2215
2216
2221
2229
2235
2236
2238
2241
2244
2250 2251
2301
2303
2307
2308
2310
2313
2319
2321
2323
2329
2335
2400 2401
2402
2412 2413
2418 2419
2422 2423
2428 2429
2434 2435
2440
2445
2450 2451
2518
2520
2529
2535
2545
2547
2551
2600
2611
2616
2628 2629
2635
2641
2644
2649
2650
2701
2703
2705
2707
2711
2717
2721
2729
2737
2749
2800 2801
2804
2809
2816 2817
2818
2820
2822
2829
2841
2847
2851
2901
2903
2905
2907
2917
2919
2921
2923
2945
2946 2947
2950 2951
3000 3001
3002
3004
3006
3009
3015
3016
3018
3020
3029
3035
3044 3045
3050 3051
3200
3208 3209
3218
3228
3242
3248
3300 3301
3305
3307
3315
3317
3321
3329
3335
3342
3345
3351
3400
3403
3404
3406
3408 3409
3414 3415
3416
3421
3429
3443
3444
3449
3509
3521
3543
3615
3621
3629
3637
3700
3702
3703
3705
3706
3707
3709
3715
3717
3719
3721
3723
3727
3729
3731
3733
3735
3741
3742
3743
3744
3746
400
401
402
403407409413
414418
419
420
421
428
429
430
431433
434
437439441
500
501
502506
507
508512
513
514518520
521523
528
529
530
531
532
533
536538
539
540
601607609611
612
617619
620622
623
628
629
630634
635
700
701
706708710
711
712
713715
716718
719
720
721729731735737739741
801807
810
813
814818
819
820828
829
830834836
837
838
839
840
841
912
913929931933935
936
937
938
939
940
941
Concessions &Seating
Restaurant Information
Center
Registration
First Aid Starbucks®
MainEntrance
Remote Exhibitor Service Center
Connection Zone Show Office
IPCBookstore
Hand Soldering
CompetitionArea
Con
cess
ions
and
Sea
ting
Are
a
William ShatnerBook Signing
Printed Electronics
New Product Zone
Ent
ranc
e
Mai
n A
isle
MainEntrance
Publication Bins
SAILS PAVILION Upper Level
Put IPC Membership to Work for YOU
®
Association Connecting Electronics Industries
For more than 50 years, company leaders have looked to IPC — Association Connecting Electronics Industries® for the tools, information and forums they need to thrive in the ever-changing electronic interconnect industry.
As a member-driven organization and leading source for industry standards, training, market research and public policy advocacy, IPC supports programs to meet the needs of the estimated $2.2 trillion global electronics industry.
Whether your company is a small start-up, a mid-size organization poised for growth, a Fortune® 500 firm or an educational or government institution — you can join more than 3,200 members worldwide that enjoy access to unparalleled opportunities to participate in and shape the direction of our collective future.
SAVE 25% on first year dues when you join during the show! Visit IPC booth 635 for details!
To learn more about IPC membership, visit www.ipc.org or contact:
Neal Bender Director of Membership Bannockburn, IL USA Tel: +1 847-597-2808 Fax: +1 847-615-5608 [email protected]
IPC maintains additional offices in:
IPC China (Shanghai/Shenzhen/Beijing/Suzhou) Leesha Peng Lixia [email protected] Paul Zong [email protected] www.ipc.org.cn
IPC India (Bangalore) C.S. Nagaraj [email protected] www.ipc.org/india
IPC Europe (Stockholm) Lars-Olof Wallin [email protected]
IPC Russia (Moscow) Yuri Kovalevsky [email protected]
• STAY CURRENT
• GET CONNECTED
• SHAPE THE INDUSTRY
• TRAIN YOUR STAFF
• MARKET YOUR BUSINESS
• CONTAIN COSTS
• JOIN THE LEADERS IN IPC
Serving the printed board and electronics assembly industries, their customers and suppliers
www.ipc.org
134
www.IPCAPEXEXPO.org
1100 1101
1104
1106
1108
1111
1112
1120 1121
1123
1128 1129
1131
1132
1136
1137
1138
1144
1146
1148
1152
1220 1221
1228 1229
1232 1233
1301
1303
1307
1315
1317
1320 1321
1328 1329
1332
1337
1345
1351
1400 1401
1402
1404
1407
1408
1414
1421
1429
1435
1436
1441
1444
1529
1537
1601
1609
1617
1629
1636
1641
1701
1703
1707
1709
1715
1721
1747
1800 1801
1802
1806 1807
1813
1814
1816
1819
1820
1822
1829
1837
1900 1901
1906 1907
1912 1913
1919
1921
1929
1935
1941
1945
1951
2001
2009
2011
2018 2019
2022
2029
2037
2040
2043
2044
2049
2050
2053
2100 2101
2107
2108 2109
2110
2112
2114 2115
2117
2121
2129
2136 2137
2139
2142
2145
2148
2151
2152
2200 2201
2202
2206
2208 2209
2214 2215
2216
2221
2229
2235
2236
2238
2241
2244
2250 2251
2301
2303
2307
2308
2310
2313
2319
2321
2323
2329
2335
2400 2401
2402
2412 2413
2418 2419
2422 2423
2428 2429
2434 2435
2440
2445
2450 2451
2518
2520
2529
2535
2545
2547
2551
2600
2611
2616
2628 2629
2635
2641
2644
2649
2650
2701
2703
2705
2707
2711
2717
2721
2729
2737
2749
2800 2801
2804
2809
2816 2817
2818
2820
2822
2829
2841
2847
2851
2901
2903
2905
2907
2917
2919
2921
2923
2945
2946 2947
2950 2951
3000 3001
3002
3004
3006
3009
3015
3016
3018
3020
3029
3035
3044 3045
3050 3051
3200
3208 3209
3218
3228
3242
3248
3300 3301
3305
3307
3315
3317
3321
3329
3335
3342
3345
3351
3400
3403
3404
3406
3408 3409
3414 3415
3416
3421
3429
3443
3444
3449
3509
3521
3543
3615
3621
3629
3637
3700
3702
3703
3705
3706
3707
3709
3715
3717
3719
3721
3723
3727
3729
3731
3733
3735
3741
3742
3743
3744
3746
400
401
402
403407409413
414418
419
420
421
428
429
430
431433
434
437439441
500
501
502506
507
508512
513
514518520
521523
528
529
530
531
532
533
536538
539
540
601607609611
612
617619
620622
623
628
629
630634
635
700
701
706708710
711
712
713715
716718
719
720
721729731735737739741
801807
810
813
814818
819
820828
829
830834836
837
838
839
840
841
912
913929931933935
936
937
938
939
940
941
Concessions &Seating
Restaurant Information
Center
Registration
First Aid Starbucks®
MainEntrance
Remote Exhibitor Service Center
Connection Zone Show Office
IPCBookstore
Hand Soldering
CompetitionArea
Con
cess
ions
and
Sea
ting
Are
a
William ShatnerBook Signing
Printed Electronics
New Product Zone
Ent
ranc
e
Mai
n A
isle
MainEntrance
Publication Bins
SAN DIEGO CONVENTION CENTER Halls A, B & C Ground Level
EX
HIB
IT H
ALL
135
1100 1101
1104
1106
1108
1111
1112
1120 1121
1123
1128 1129
1131
1132
1136
1137
1138
1144
1146
1148
1152
1220 1221
1228 1229
1232 1233
1301
1303
1307
1315
1317
1320 1321
1328 1329
1332
1337
1345
1351
1400 1401
1402
1404
1407
1408
1414
1421
1429
1435
1436
1441
1444
1529
1537
1601
1609
1617
1629
1636
1641
1701
1703
1707
1709
1715
1721
1747
1800 1801
1802
1806 1807
1813
1814
1816
1819
1820
1822
1829
1837
1900 1901
1906 1907
1912 1913
1919
1921
1929
1935
1941
1945
1951
2001
2009
2011
2018 2019
2022
2029
2037
2040
2043
2044
2049
2050
2053
2100 2101
2107
2108 2109
2110
2112
2114 2115
2117
2121
2129
2136 2137
2139
2142
2145
2148
2151
2152
2200 2201
2202
2206
2208 2209
2214 2215
2216
2221
2229
2235
2236
2238
2241
2244
2250 2251
2301
2303
2307
2308
2310
2313
2319
2321
2323
2329
2335
2400 2401
2402
2412 2413
2418 2419
2422 2423
2428 2429
2434 2435
2440
2445
2450 2451
2518
2520
2529
2535
2545
2547
2551
2600
2611
2616
2628 2629
2635
2641
2644
2649
2650
2701
2703
2705
2707
2711
2717
2721
2729
2737
2749
2800 2801
2804
2809
2816 2817
2818
2820
2822
2829
2841
2847
2851
2901
2903
2905
2907
2917
2919
2921
2923
2945
2946 2947
2950 2951
3000 3001
3002
3004
3006
3009
3015
3016
3018
3020
3029
3035
3044 3045
3050 3051
3200
3208 3209
3218
3228
3242
3248
3300 3301
3305
3307
3315
3317
3321
3329
3335
3342
3345
3351
3400
3403
3404
3406
3408 3409
3414 3415
3416
3421
3429
3443
3444
3449
3509
3521
3543
3615
3621
3629
3637
3700
3702
3703
3705
3706
3707
3709
3715
3717
3719
3721
3723
3727
3729
3731
3733
3735
3741
3742
3743
3744
3746
400
401
402
403407409413
414418
419
420
421
428
429
430
431433
434
437439441
500
501
502506
507
508512
513
514518520
521523
528
529
530
531
532
533
536538
539
540
601607609611
612
617619
620622
623
628
629
630634
635
700
701
706708710
711
712
713715
716718
719
720
721729731735737739741
801807
810
813
814818
819
820828
829
830834836
837
838
839
840
841
912
913929931933935
936
937
938
939
940
941
Concessions &Seating
Restaurant Information
Center
Registration
First Aid Starbucks®
MainEntrance
Remote Exhibitor Service Center
Connection Zone Show Office
IPCBookstore
Hand Soldering
CompetitionArea
Con
cess
ions
and
Sea
ting
Are
a
William ShatnerBook Signing
Printed Electronics
New Product Zone
Ent
ranc
e
Mai
n A
isle
MainEntrance
Publication Bins
SAN DIEGO CONVENTION CENTER Halls A, B & C Ground Level
Booths400-999locatedintheSailsPavilion(UpperLevel)•Booths1000+locatedinHallsA–C(GroundLevel)
SMARTER!WORK
Conference & Exhibition August 22–23, 2012
Renaissance Schaumburg Hotel & Convention Center
Schaumburg, Illinois
Sign up for the one show in the Midwest focused on printed boards and electronics manufacturing! Convenient, accessible and located in the beautiful facilities of the Renaissance Schaumburg Hotel and Convention Center.
Mark your calendar!FREE EXHIBIT HALL REGISTRATION for pre-registrantswww.IPCMidwestShow.org
A VERY SPECIAL THANK YOU TO OUR Volunteers, Supporters, Sponsors, Exhibitors, Instructors, Speakers, Committee Leaders and Committee Members. And thanks for making IPC APEX EXPO Your Show!
Exhibition & Conference February 19–21, 2013San Diego Convention CenterSan Diego, California
SEE YOU NEXT YEAR!
TM