FI-SL-VSR (GVAL) Special Purpose Ledger: Validation, Substitution and Rules

FI-AA-AA (AA)    Asset Accounting: Basic Functions – Master Data

                 

ANKA             Asset Classes: General Data             ANLKL

ANKP             Asset Classes: Fld Cont Dpndnt on Chart ANLKL / AFAPL

                 of Depreciation

ANKT             Asset Classes: Description              SPRAS / ANLKL

ANKV             Asset Classes: Insurance Types          ANLKL / VRSLFD

ANLA             Asset Master Record Segment             BUKRS / ANLN1 / ANLN2

ANLB             Depreciation Terms                      BUKRS / ANLN1 / ANLN2 / AFABE

                                                         / BDATU

ANLT             Asset Texts                             SPRAS / BUKRS / ANLN1 / ANLN2

ANLU             Asset Master Record User Fields         .INCLUDE /  BUKRS / ANLN1 /  ANLN2

ANLW             Insurable Values (Year Dependent)       BUKRS / ANLN1 / ANLN2 / VRSLFD /

                                                         GJAHR

ANLX             Asset Master Record Segment             BUKRS / ANLN1 / ANLN2

ANLZ             Time Dependent Asset Allocations        BUKRS / ANLN1 / ANLN2 / BDATU

FI-AA-AA (AA2)   Asset Accounting: Basic Functions – Master Data 2.0

                 

ANAR             Asset Types                             ANLAR

ANAT             Asset Type Text                         SPRAS / ANLAR

FI-AA-AA (AB)    Asset Accounting: Basic Functions –

                 Asset Accounting

ANEK             Document Header Asset Posting           BUKRS / ANLN1 / ANLN2 / GJAHR /

                                                         LNRAN

ANEP             Asset Line Items                        BUKRS / ANLN1 / ANLN2 / GJAHR /

                                                         LNRAN / AFABE

ANEV             Asset Downpymt Settlement               BUKRS / ANLN1 / ANLN2 / GJAHR /

                                                         LNRANS

ANKB             Asset Class: Depreciation Area          ANLKL / AFAPL / AFABE / BDATU

ANLC             Asset value Fields                      BUKRS / ANLN1 / ANLN2 / GJAHR /

                                                         AFABE

ANLH             Main Asset Number                       BUKRS / ANLN1

ANLP             Asset Periodic Values                   BUKRS / GJAHR / PERAF / AFBNR /

                                                         ANLN1 / ANLN2 / AFABER

                 

GB03             Validation / Substitution User          VALUSER

GB92             Substitutions                           SUBSTID

GB93             Validation                              VALID

Financial Accounting

Financial Accounting

Table Name           Description                           Important Fields

FBAS             Financial Accounting “Basis”

BKPF             Accounting Document Header              BUKRS / BELNR / GJAHR

BSEG             Accounting Document Segment             BUKRS / BELNR / GJAHR / BUZEI

BSIP             Index for Vendor Validation of Double   BUKRS / LIFNR / WAERS / BLDAT /

                 Documents                               XBLNR / WRBTR / BELNR / GJAHR / BUZEI

BVOR             Inter Company Posting Procedure         BVORG / BUKRS / GJAHR / BELNR

EBKPF            Accounting Document Header (docs from   GLSBK / BELNR / GJHAR / GLEBK

                 External Systems)

FRUN             Run Date of a Program                   PRGID

KLPA             Customer / Vendor Linking               NKULI / NBUKR / NKOAR / PNTYP

                                                         / VKULI / VBUKR / VKOAR

KNB4             Customer Payment History                KUNNR / BUKRS

KNB5             Customer Master Dunning Data            KUNNR / BUKRS / MABER

KNBK             Customer Master Bank Details            KUNNR / BANKS / BANKL / BANKN

KNC1             Customer Master Transaction Figures     KUNNR / BUKRS / GJHAR

KNC3             Customer Master Special GL Transactions KUNNR / BUKRS / GJAHR / SHBKZ

                 Figures

LFB5             Vendor Master Dunning Data              LIFNR / BUKRS / MABER

LFBK             Vendor Master Bank Details              LIFNR / BANKS / BANKL / BANKN

LFC1             Vendor Master Transaction Figures       LIFNR / BUKRS / GJHAR

LFC3             Vendor Master Special GL Transactions   LIFNR / BUKRS / GJHAR / SHBKZ

                 Figures

VBKPF            Document Header for Document Parking    AUSBK / BUKRS / BELNR / GJHAR

FBASCORE         Financial Accounting General Services “Basis”

KNB1             Customer Master (Company Code)          KUNNR / BUKRS

LFA1             Vendor Master (General Section)         LIFNR

LFB1             Vendor Master (company Code Section)    LIFNR / BUKRS

SKA1             G/L Account Master (Chart of Accounts)  KTOPL / SAKNR

SKAT             G/L Account Master (Chart of Accounts – SPRAS / KTOPL / SAKNR

                 Description)

MAHNS            Accounts Blocked by Dunning Selection   KOART / BUKRS / KONKO / MABER

MHNK             Dunning Data (Account Entries)          LAUFD / LAUFI / KOART / BUKRS /

                                                         KUNNR / LIFNR / CPDKY / SKNRZE /

                                                         SMABER / SMAHSK / BUSAB

FI-GL-GL (FBS)   General Ledger Accounting: Basic Functions- G/L Accounts

SKAS             G/L Account Master (Chart of Accounts – SPRAS / KTOPL / SAKNR / SCHLW

                 Key Word list)

FI-BL-PT-AP(FMZA)Bank Accounting: Payment Transactions – Automatic Payments

SKB1             G/L Account Master (Company Code)       BUKRS / SAKNR

FI-GL-GL (FBSC)  General Ledger Accounting: Basic

                 Functions - R/3 Customizing for G/L Accounts

FIGLREP          Settings for G/L Posting Reports        MANDT

TSAKR            Create G/L account with reference       BUKRS / SAKNR

FI-GL-GL (FFE)   General Ledger Accounting: Basic

                 Functions - Fast Data Entry

KOMU             Account Assignment Templates for G/L    KMNAM / KMZEI

                 Account items

FI-AR-AR (FBD)   Accounts Receivable: Basic Functions - Customers

                 

KNKA             Customer Master Credit Management :     KUNNR

                 Central Data

KNKK             Customer Master Credit Management :     KUNNR / KKBER

                 Control Area Data

KNKKF1           Credit Management : FI Status data      LOGSYS / KUNNR / KKBER / REGUL

RFRR             Accounting Data – A/R and A/P           RELID / SRTFD / SRTF2

                 Information System

FI-BL-PT         Bank Accounting: Payment (BFIBL_CHECK_D)  Transactions – General Sections

PAYR             Payment Medium File                     ZBUKR / HBKID / HKTID / RZAWE /

                                                         CHECT

PCEC             Pre-numbered Check                      ZBUKR / HBKID / HKTID / STAPL

                 

F111G            Global Settings for Payment Program for MANDT

                 Payment Requests

FDZA             Cash Management Line Items in Payment   KEYNO

                 Requests

PAYRQ            Payment Requests                        KEYNO

What is the table name for G/L Master data, when we create centrally (T.Code - FS00)?

As far as general ledger master data is concerned, the following tables are involved :

Table name :  SKB1 : G/L Account Master ( Company Code) 

Fields: 

     BUKRS : Company Code  

     SAKNR : G/L Account 

Table name :  SKA1 : G/L Account Master ( Chart of Accounts ) 

Fields:  

     KTOPL : Char of Accounts  

     SAKNR : G/L Account 

Table name :  SKAT : G/L Account Master Record ( Chart of Accounts : Description ) 

Fields: 

     SPRAS : Language 

     KTOPL : Char of Accounts  

     SAKNR : G/L Account                        *-- Viji Balakrishnan

Controlling

Table Name           Description                       Important Fields

AUSP                 Characteristic Values             MANDT / OBJEK / ATINN / ATZHL

CO-KBAS              Overhead Cost Controlling

A132                 Price per Cost Center             MANDT / KAPPL / KSCHL / KOKRS

A136                 Price per Controlling Area        MANDT / KAPPL / KSCHL / KOKRS

A137                 Price per Country / Region        MANDT / KAPPL / KSCHL / KOKRS

COSC                 CO Objects: Assignment of Origina MANDT / OBJNR / SCTYP / VERSN

CSSK                 Cost Center / Cost Element        MANDT / VERSN / KOKRS / GJAHR

CSSL                 Cost Center / Activity Type       MANDT / KOKRS / KOSTL / LSTAR

KAPS                 CO Period Locks                   MANDT / KOKRS / GJAHR / VERSN

CO-KBASCORE          Overhead Cost Controlling: General Services

CSKA                 Cost Elements (Data Dependent on  MANDT / KTOPL / KSTAR

CSKB                 Cost Elements (Data Dependent on  MANDT / KOKRS / KSTAR / DATBI

CSKS                 Cost Center Master Data           MANDT / KOKRS / KOSTL / DATBI

CSLA                 Activity Master                   MANDT / KOKRS / LSTAR / DATBI

CO-OM (KACC)         Overhead Cost Controlling

COBK                 CO Object: Document Header        MANDT / KOKRS / BELNR

COEJ                 CO Object: Line Items (by Fiscal  MANDT / KOKRS / BELNR / BUZEI

COEJL                CO Object: Line Items for Activit MANDT / KOKRS / BELNR / BUZEI

COEJR                CO Object: Line Items for SKF (by MANDT / KOKRS / BELNR / BUZEI

COEJT                CO Object: Line Items for Prices  MANDT / KOKRS / BELNR / BUZEI

COEP                 CO Object: Line Items (by Period) MANDT / KOKRS / BELNR / BUZEI

COEPL                CO Object: Line Items for Activit MANDT / KOKRS / BELNR / BUZEI

COEPR                CO Object: Line Items for SKF (by MANDT / KOKRS / BELNR / BUZEI

COEPT                CO Object: Line Items for Prices  MANDT / KOKRS / BELNR / BUZEI

COKA                 CO Object: Control Data for Cost  MANDT / OBJNR / GJAHR / KSTAR

COKL                 CO Object: Control Data for Activ MANDT / LEDNR / OBJNR / GJAHR

COKP                 CO Object: Control Data for Prima MANDT / LEDNR / OBJNR / GJAHR

COKR                 CO Object: Control Data for Stati MANDT / LEDNR / OBJNR / GJAHR

COKS                 CO Object: Control Data for Secon MANDT / LEDNR / OBJNR / GJAHR

CO-OM-CEL (KKAL)     Cost Element Accounting (Reconciliation Ledger)

COFI01               Object Table for Reconciliation L MANDT / OBJNR

COFI02               Transaction Dependent Fields for  MANDT / OBJNR

COFIP                Single Plan Items for Reconciliat RCLNT / GL_SIRID

COFIS                Actual Line Items for Reconciliat RCLNT / GL_SIRID

CO-OM-CCA            Cost Center Accounting (Cost Accounting Planning RK-S) – What is RK-S

A138                 Price per Company Code            MANDT / KAPPL / KSCHL / KOKRS

A139                 Price per Profit Center           MANDT / KAPPL / KSCHL / KOKRS

CO-OM-OPA (KABR)     Overhead Orders: Application Development R/3 Cost Accounting Settlement

AUAA                 Settlement Document: Receiver Seg MANDT / BELNR / LFDNR

AUAB                 Settlement Document: Distribution MANDT / BELNR / BUREG / LFDNR

AUAI                 Settlement Rules per Depreciation MANDT / BELNR / LFDNR / AFABE

AUAK                 Document Header for Settlement    MANDT / BELNR

AUAO                 Document Segment: CO Objects to b MANDT / BELNR / LFDNR

AUAV                 Document Segment: Transactions    MANDT / BELNR / LFDNR

COBRA                Settlement Rule for Order Settlem MANDT / OBJNR

COBRB                Distribution Rules Settlement Rul MANDT / OBJNR / BUREG / LFDNR

CO-OM-OPA (KAUF)     Overhead Orders: Cost Accounting Orders

AUFK                 Order Master Data                 MANDT / AUFNR

AUFLAY0              Enttity Table: Order Layouts      MANDT / LAYOUT

EC-PCA (KE1)         Profit Center Accounting

CEPC                 Profit Center Master Data Table   MANDT / PRCTR / DATBI / KOKRS

CEPCT                Texts for Profit Center Master Da MANDT / SPRAS / PRCTR / DATBI

CEPC_BUKRS           Assignment of Profit Center to a  MANDT / KOKRS / PRCTR / BUKRS

GLPCA                EC-PCA: Actual Line Items         RCLNT / GL_SIRID

GLPCC                EC-PCA: Transaction Attributes    MANDT / OBJNR

GLPCO                EC-PCA: Object Table for Account  MANDT / OBJNR

GLPCP                EC-PCA: Plan Line Items           RCLNT / GL_SIRID

EC-PCA BS (KE1C)     PCA Basic Settings: Customizing for Profit Center Accounting

A141                 Dependent on Material and Receive MANDT / KAPPL / KSCHL / KOKRS

A142                 Dependent on Material             MANDT / KAPPL / KSCHL / WERKS

A143                 Dependent on Material Group       MANDT / KAPPL / KSCHL / WERKS

01236789

11141519212223244157

167168169376377416

2001200220032006

AxxxA004ADCPADDR_KEYADIRACCESSADR2ADR6ADR10ADRCADRPAENRAFABAFFHAFFLAFFT

Table Name

AFFVAFFWAFIHAFKOAFKO_LAUFNAFPOAFRCAFRDAFRHAFRUAFRVAFVCAFVGDAFVUAFVVAFWIAGKOANARANATANEKANEPANEVANKTANLAANLBANLCANLHANLZAPQDAPQIAPQLARC_PARAMSAT02TAT02AAT10AT10TAUFKAUFMAUSPBBP_USR01

BDS_CL_DOCBGMKBGMP

BBP_FUNCTION_MAP

BGMSBGMTBGMZBKDFBKORMBKPFBLPKBLPPBLPRBNKABPEGBP000BPBKBPEGBPEJBPEPBPGEBPJABSADBSAKBSASBSECBSEDBSEGBSETBSEUBSIDBSIKBSIMBSISCABNCABNTCATACATFCATGCATPCATRCATSCOCATSDBCATSHRCATSMMCATSPMCATSPSCATUCATV

CATWCATXCAUFVCAUFVDCAWNCDHDRCDPOSCE1xxxxCEPCCEPCTCIF_IMCHARCKMLCRCKMLHDCKMLMV001COBKCOBLCOBRACOBRBCOCHCOEPCOKACOSPCOSSCOSTCOVPCRCACRCOCRHDCRHH

CRMPAROLTPCRTXCSBOMEXCSCMATCSDATACSKACSKBCSKSCSKTCSKUCSLACSSL

CRMD_ORDERADM_H

CRMD_ORDERADM_I

CSTMATD010SINFD010TABD020SDBTABLOGDD01LDD01VDD02LDD02TDD03LDD03TDD04LDD04TDD04VDD07LDD07TDEVACCESSDGTMDDOKTLE070E070CE071E071TEBANEBKNECONF_OUTEDIDCEDIDDEDID2EDIDOEDIDOTEDIDSEDIMSGEDIPOEDISYNEDIVRSEDP13EDP21EDSEAEEWBEIKPEINAEINEEIPOEKAB

EKANEKBEEKEHEKEKEKESEKETEKKNEKKOEKOMDEKPOENLFDIREORDEQKTEQSTEQUIEQUZESKNESLLESSRFEBEPFPLAFPLTGB901GB931GLPCTGLT0HIKOHRS1000IFLOIFLOTIFLOTXIHGNSIHPAIHSGIKPFILOAIMAKIMAVIMPRIMPTTIMPUIMRGIMTPIMZOINDX

INOBISEGITCPOJCDSJESTJSTOKAKOKBEDKBEZKDSTKEKOKEPHKLAHKLATKNA1KNASKNB1KNB4KNB5KNBKKNC1KNC3KNKAKNKKKNVAKNVPKNVVKOMGKOMKKOMPKOMVDKONDDKONHKONMKONPKONVKSMLKSSKLEINLFA1LFASLFB1LFB5LFBKLFC1

LFM1LIKPLIPSLQUALTAKLTAPLTBKLTBPM_BUPAAM_ORDNAMACKWMAHNVMAKTMAPLMAPRMARAMARCMARDMARDHMARMMARVMASTMBEWMCHAMCHBMCH1MDKPMC29MMDEZMDKPMDLVMDPAMDPMMDPSMDRSMDSMMEANMG03STEUERMGEFMKALMKOLMKPFMKUBMLGNMODSAP

MSICHTAUSWMSEGMSEGO2MSKAMSKUMSLBMSPRMTCOMMTCORMVKEMVERNASTNRIVOBJKOBJSUBONR00ONRORP44VPAxxxPBEDPBIMPCL1PCL2PEKKOPEKPOPEKPOSPEKPOVPERNRPGANPGMIPGZUPKHDPLAFPLASPLKOPLKODPLMKPLMWPLPOPLPODPLSCPMCOPRHIPROJPROP

PRPSPVBEQALSQMATQMELQMFEQMFELQMIHQMKSTQMMAQMSMQMURQPCTQPGRQPGTQPMKQPMZQPMTRC27MRC68KRCR01REGUTREQACCTREQHEADREQLINEREQLINEMAREQREFRESBRKPFRM06PRM61RRMMG1RMMG1_REFS021S022SADRSDOKDOCSPSETHEADERSETLEAFSKA1SKATSKB1SLGHSMOF*SOC3

SOFMSOODSSM_RFCSSM_VARSTKOSTPOSTPOASTPOXSTXHSTXLSTZUSWORT000T000MDT001T001BT001GT001KT001LT001PT001ST001TT001WT002TT003OT003PT003TT004T005T005ST005TT005UT005XT006T006AT007KT007ST087JT009T009BT011T012T012KT014T015L

T015MT022DT023T024T024DT024ET024FT025T027AT027BT030T042T042IT042ZT051AT052T052UT074TT074UT077DT100T134T134MT156T156FT156MT156NT156ST157HT158BT161NT161TT163DT163MT163YT165PT166AT166CT166KT166PT166TT166UT173T179T185

T237T247T300T301T302T311T329AT329DT329FT329PT329ST331T333BT352RT353I_TT356T357GT357G_TT370AT399DT405T418T438MT445BT457TT459VT462T462TT500LT500PT502TT503T503TT508AT510T510AT510FT510WT511T512TT512WT512ZT527XT528T

T529A

T529TT530T530TT549AT549QT550AT550ST551ST552AT554CT554ST554TT558BT569VT588M

T588Z

T5K8CT604T604TT615T615TT646GT646HT681VT74FAT74FCT777AT800ST880TACTTACTZTADIRTAPRFTTBD05TBDBETBDLSTBDMETBRGTBSLTBSLT

TBTCJOB

TBTCO

TBTCPTC04TC26TC52TCA01TCA08TCA09TCC08TCLATCLATTCLAXTCLCTCLOI5TCLOI6TCLTTCO09TCS03TCSPRTCURMTCURXTCURRTCVIEWTDDATTDEVCTTECSTEDS1TEDS2TEDS3TFACDTFACSTFDIRTFTITTGSBTHEADTHRPCLASSTHRSCLASSTINCTJ02TJ30TKA01TKA09TKVS

TLICTLINETMC4TMFGTMSI2TNAD7TNAPRTOA_DARATPAERTPARATPGPTPOOLTQ05TQ15TQ32TRDIRTRDIRT

TSE05

TSOUXTSP01TSP02TSP03TSP03DTSP03LTSP06TSP1DTSPATSPOLTSTATHTSTATHTTSTCTSTCTTSTCATSTCCLASSTTDSTTGRTTXSTTXIDTTXITTTZCUTUTYPTUZUSTVARV

TVBURTVDIRTVGRTVGRTTVKBZTVKOTVKOSTVKOTTVKOVTVKWZTVLKTVROTVROTTVSBTVSBTTVSTTVSTTTVTATVTWTVTYTTVV*TVZBTTWLADTWPURLSVRTXCOMTZB0TTZPATTZONETZONTUS930USH02USH04USH10USH12USOBTUSOBT_CUSOBXUSOBX_CUSPARAMUSR01USR02USR03USR04USR05USR06

USR14USR21USR40USRURLPRSUSRURLSVRVARIDVARITVBAKVBAPVBBEVBC03VBDKLVBEPVBFAVBFSVBKDVBPAVBRKVBRPVBSEGSVBSKVBUKVBUPVEIAVVEKPVEPOVFKNVFKPVIAUFKSTVRSDVRSX2VTADD01VTBFHAVTBFHAPOVTBFHAZUVTBFINKOVTFAVTIDERIVTIFHAVTIFHAPOVTIFHAZUVTIOFVTPAVTTKVTTKVB

VTTPVTTSVTTS_TXTVWPANLAVWPCUSTOMCWRPLWYT3

DescriptionActions (Infotypes)Org. Assignment (Infotypes)Personal Data (Infotypes)Payroll status (Infotypes)Addresses (Infotypes)Planned Working Time (Infotypes)Basic pay (Infotypes)Bank details (Infotypes)Ext. Bank Transfer (Infotypes)Recurring Benefits/Deductions (Infotypes)Additional Payments (Infotypes)Monitoring of Dates (Infotypes)Family (Infotypes)Education (Infotypes)Previous employment (Infotypes)Qualifications (Infotypes)Date Specifications (Infotypes)Membership Fees (Infotypes)Health Care Plans (Infotypes)Insurance Plans (Infotypes)Savings plans (Infotypes)Medical Benefits Data (Infotypes)Misc. Plans (Infotypes)Time Quota CompensationAbsences (Infotypes)Attendances (Infotypes)Substitutions (Infotypes)Absence QuotasCondition record keysMaterial (pooled table)Person/Address assignment (central address administration) (system)Structure with reference key fields and address typeTable to store keys for TADIR objects (system)Telephone numbers (central address admin.) (system)SMTP numbers (central address admin.)Printer (central address management)Addresses ; central address adminPersons (central address administation) (system)Change masterNetwork - relationships (PM/SM/SD/PS)PRT assignment data for the work order (PM/SM/SD)Work order sequence (PM/SM/SD)Order process instructions (PM/SM/SD)

Order process instruction values (PM/SM/SD)Goods movements with errors from confirmations (PM/SM/SD)Maintenance order header (PM/SM/SD)Order header data PP orders (PM/SM/SD)View: Leading order for order n° for coll. orderOrder item (PM/SM/SD)Table of planned changes to conf. : automatic goods receipt (PM/SM/SD)Default values for collective confirmation (PM/SM/SD)Header information for confirmation pool (PM/SM/SD)Order completion confirmations (PM/SM/SD)Pool of confirmations (PM/SM/SD)Operation within an order (PM/SM/SD)Order: Dialog table for Table AFVG (order operation)DB structure of the user fields of the operation (PM/SM/SD)DB of the quantities/dates/values in the operation (PM/SM/SD)Subsequently posted goods movements for confirmations (PM/SM/SD)Cleared accounts (FI/CO)Asset types (FI/CO)Asset type text (FI/CO)Asset document header (FI/CO)Asset document items (FI/CO)Asset downpymnt settlement (FI/CO)Asset text (FI/CO)Asset master (FI/CO)Asset - depreciation terms (FI/CO)Asset values (FI/CO)Main asset number (FI/CO)Time-dependent asset allocationData definition queue (Batch inputs) (system)Queue info definition (Batch inputs) (system)Batch input log directoryImageLink structureTransaction activity category : description (FI/CO)Transaction code for menu TIMN (FI/CO)Transaction type (FI/CO)Name of transaction type (FI/CO)Order master data (PM/SM/SD) - billable orders (CO)Goods movement for order (PM/SM/SD)Characteristic valuesBBP users (BBP)

Check BAPI versions for BP (Meta BAPI Dispatching) (BBP)

Document Types (.doc, .exe.,...)Master warranty header (PM/SM/SD)Master warranty item (PM/SM/SD)

Text item master warranty (PM/SM/SD)Master warranty text (PM/SM/SD)Warranty counter information (PM/SM/SD)Document header supplement for recurring entry (FI/CO)Accounting correspondence requests (FI/CO)Accounting document header (FI/CO)Document log header (FI/CO)Document log item (FI/CO)Document log index and planned order (backflush) (FI/CO)Bank master record (FI/CO)Line item total values controlling objBusiness partner master (general data) (FI/CO)Budget revision text (FI/CO)Budget revision header (FI/CO)Budget revision header (FI/CO)Line item period values (FI/CO)Overall/annual budget (FI/CO)Overall/annual budget (FI/CO)Accounting secondary index for customers ; cleared items (FI/CO)Accounting secondary index for vendors ; cleared items (FI/CO)Accounting secondary index for G/L accounts ; cleared items (FI/CO)One-time account data document segment (FI/CO)Bill of exchange fields document segmentAccounting document segment Detail (BKPF)Tax data document segmentLine item additional information (update)Accounting : secondary index for customers (FI/CO)Accounting secondary index for vendors (FI/CO)Secondary index, documents for material (FI/CO)Accounting secondary index for G/L accounts (FI/CO)CharacteristicCharacteristic descriptionsCATT : general test run dataCATT : subsequent test run dataCATT : Basic texts for test procedureCATT : parameters and variantsCATT : reset table changesCross-Application time sheet (CATS) : transfer to COCATS : Database for time recording sheetCross-Application Time sheet (CATS) : transfer to HRCross-Application Time sheet (CATS) : transfer to MMCross-Application Time sheet (CATS) : transfer to PM/SMCross-Application Time sheet (CATS) : transfer to PSCATT : variantsCATT : variable texts

CATT test statusCATT : save files externallyView order headers PP/CODialog structure for order headers and itemsCharacteristics valuesChange document header (change log summary/header)Change document item (change log detail)Where xxxx = CO/PA ledger ; amountsProfit center master data (FI/CO)Texts for profit center master data (FI/CO)Imod reference table for classificationMaterial ledger : period totals records valuesMaterial ledger : header recordProcurement alternatives (KKF6)CO/PA ; document headerCoding blockSettlement rule for orders (FI/CO)Distribution settlement rules (FI/CO)Process management : control recipe headerCO/PA ; line items by period (FI/CO) - CO documentsCO Object : cost element control data (FI/CO)Cost Totals - External Postings (FI/CO)Cost Totals - Internal postings (FI/CO)CO object : standard rate totals (FI/CO)CO : View between COBK and COEP (FI/CO)Work center capacity allocationAssignment of work center to cost center (FI/CO)Work center header (PM/SM/SD)Hierarchy header data

Header data for local purchase orders (BBP)

Item data for local purchase orders (BBP)

Main parameter file on the OLTP-side (CRM)Text for the work center or production resource/tool (PM/SM/SD)Interface for BOM display module pool/abap programsBOM explosion : materialsBOM help fieldsCost elements ; data dependent upon chart of accounts (FI/CO)Cost Elements(data dependent upon controlling area) (FI/CO)Cost Center Master DataCost Center TextsCost element texts (FI/CO)Activity master (FI/CO)Cost center / activity (FI/CO)

Start material display for BOM explosionsABAP/4 : Information about ABAP/4 program source code (system)Tables that are used in a programTable with for all programs the screensIf checked on in the dictionary all changes are logged in table DBTABLOGDomainsDD : domain header with textSAP tablesR/3 DD : SAP table textsTable fieldsField textsData elementsR/3 DD : Data element textsDD : header and short text for data elementsR/3 DD : values for the domainsDD : texts for domain fixed values (language-dependent)Developper keysDG : dangerous goods masterDocumentation of ABAP/4 programsWBO and transport : header of requests/tasksWBO and transport : source/target client of requests/tasksWBO + transport : Object entries of requests/tasks (system)WBO + transport : Short texts for requests/tasks (system)Purchase requisition (PP)Purchase requisition account assignment (PP)Characteristic Attributes per Document ItemIDOC control tableData record (IDOC)IDOC data (1056 bytes)Value table for IDOC typesShort description of IDOC typesIDOC statusLogical message typesTable for description of ports for EDIDocumentation table of IDOC'sTable of all segmentsPartner profile : outboundPartner profile : inboundEDI : Table of all segments of current releaseEasy Enhancement Workbench (CRM, SAP-ISU)Foreign trade : export/import header dataPurchasing info record ; general data (MM)Purchasing info record : purchasing organization data (MM)Foreign trade : export/import item dataRelease documentation (PP)

Vendor Address: Purchasing DocumentHistory of Purchasing Document (PP)Scheduling Agreement Release DocumentationHeader Data for Scheduling Agreement ReleasesVendor confirmationsScheduling agreement schedule lines (PP)Account assingment in purchasing document (PP)Purchasing document ; header (PP)Contract Master Conditions Structure for PrintoutPurchasing document ; item (PP)Additional Attributes for Function Modules (system)Purchasing source listEquipment short texts (PM/SM/SD)Equipment link to BOM (PM/SM/SD)Equipment master data (PM/SM/SD)Equipment time segment (PM/SM/SD)Account assignment in Service Package (SES)Lines of Service Package = SES, Service Entry SheetsService Entry Sheet Header data (SES)Electronic bank statement line items (FI/CO)Billing plan (FI/CO)Billing plan : dates (FI/CO)Boolean formula data (for validations/substitutions) (FI/GL/SL)Validation/Substitutions activities (FI/GL/SL)EC-PCA : totals table (FI/CO)G/L account master record transaction figuresOrder master data history (PM/SM/SD)Workflow/Task Definition (Workflow)Functional location (view) (PM/SM/SD)Functional location (table) (PM/SM/SD)Functional location : short texts (PM/SM/SD)Plant maintenance : permit segment (PM/SM/SD)Plant maintenance : partners (PM/SM/SD)Object-related permits in plant maintenance (PM/SM/SD)Header : physical inventory document (PP)PM object location and account assignment (PM/SM/SD)Network - Relationships (PS)Appropriation requests (PS)Capital Investment Program Positions (PS)Measuring point (table) (PM/SM/SD)Texts for cap. inv. program positions (PS)Measurement document (PM/SM/SD)Capital Investment Programs (PS)CO object assignment (PS)System table INDX (system)

Link between internal number and objectPhysical inventory document items (PP)SAPscript output interfaceChange documents for system/user statuses (table JEST)Object statusStatus object informationCapacity header segment (PM/SM/SD)Capacity requirement recordsAdd. data for table KBED (for indiv. capacities/splits)Sales order to BOM linkProduct costing - header dataProduct costing ; cost components for cost of goods MfdClass header dataClasses : long textsGeneral data in customer masterCustomer master ; VAT registration numbers general sectionCustomer master ; company codeCustomer payment historyCustomer master : dunning dataCustomer master : bank detailsCustomer master ; transaction figuresCustomer master ; special G/L transaction figuresCustomer master : credit management ; central dataCustomer master : credit management ; control area dataCustomer master loading pointsCustomer master partner functions (ship to, sold to,...)Customer master sales dataAllowed fields for Condition StructuresPricing communication header (FI/CO)Pricing communication item (FI/CO)Price Determination Communication -Cond.Record for PrintingMaterial substitution : data divisionConditions ; headerConditions : 1-dimensional quantity scaleConditions ; item (PM/SM/SD)Conditions (transaction data) (PM/SM/SD)Characteristics of a classAllocation table : object to classStorage unit header recordsVendor master ; general sectionVendor master (VAT registration numbers general section)Vendor master ; company codeVendor master (dunning data)Vendor master : bank detailsVendor master : transaction figures

Vendor master record purchasing organization dataSD document : delivery header dataSD document : delivery item dataQuantsWM transfer order headerTransfer order itemTransfer requirement headerTransfer requirement itemMatchcode table for Business Partners (SAP-ISU)View of leading orderMaterial plant view on costingManagement records for the dunning program (FI/CO)Material descriptions (MM)Assignment of task lists to materialsMaterial index for forecastGeneral material data (MM)Plants data for material (MM)Storage location data for material (MM)Material master storage location segment ; historyUnits of measur for materialsMaterial control recordMaterial to BOM link (MM)Material valuation (MM) = accounting view for materialsBatchesBatch stocksBatches (if batch management cross-plant)Header data for MRP documentMaterial master record table : BOM's - group dataIndividual lines of the MRP elementsHeader data for MRP documentCustomizing MRP areaView of planned order/dummy conponents for BOM explosionView of Material Components in the Planned OrderItem in MRP documentReading view of dep.reqmt/material reservationSimulative dependent requirementsInternational article numbers (EAN's) for materialControl TableHazardous materialsProduction versions of materialSpecial stock from vendorMaterial document ; header (MM)Material provided by customerMaterial data for each warehouse numberContains the SAP enchancements & user-exits

Help Structure for View Selection: Material MasterDocument segment : material (MM) - material documentsMaterial document quantities in additional units of measure (MM) - transaction MB03Sales order stockInventory Balances at Customer (Special stocks, like consignment)Special stocks with vendorProject stockMaterial master communicationMaterial master view ; return codesSales data for materialMaterial Consumption (MM)Message status (system)Number range intervals (PP)Plant maintenance object list (PM/SM/SD)Subojects (projects)General object numberObject number index, orderPlanning versionsTables for infotypesIndependent requirements dataIndependent requirements for materialHR cluster 1HR cluster 2Auxiliary Fields, Purchasing Document Header PrintoutAuxiliary Fields, Purchasing Document Item PrintoutGeneric Article Fields for Printing of Purchasing DocumentVariant Fields for Printing of Purchasing DocumentsStandard Selections for HR Master Data Reporting (Structure)Proportional factors per planning object relation (SOP/LIS)Product group/member allocationProduct group/member quantity conversionsControl cyclePlanned ordersTask list - selection of operations/activitiesTask list ; headerI/O table for task list headersInspection plan characteristicsMAPL-dependent charac. specifications ; inspection planTask list - operation/activityI/O table for task list operations and network activitiesPlanning scenarios in long-term planningCost structure of maintenace order (PS)WBS Hierarchy (PS)Projects (PS)Forecast parameters

Work Breakdown structures (PS)Supply areaInspection lot recordInspection type - material parametersQuality notification (PM/SM/SD)Quality notification - items (PM/SM/SD)Defect data records for the inspection lotQuality message - maintenance data excerpt (PM/SM/SD)Characteristic control indicatorsQuality notification - activities (PM/SM/SD)Notification - tasks (PM/SM/SD)Quality notification - causes (PM/SM/SD)Code textsInspection catalog code groupsCode group textsInspection characteristic masterAssignment table - inspection methods/master inspection characteristicsMaster inspection characteristics textsMaterial master view for routingsI/O fields for capacityView of work center from task listsTemSe- administration data (FI/CO)Accounting data for shopping basketHeader data and status from Shopping BasketItem data and status from Shopping BasketData for shopping baskets that have not been transferredEntries from Shopping Basket ; reference documentsReservation/dependent requirements (PP)Document header : reservation (MM)Auxiliary Fields for Purchasing Document PrintoutIn/output fieldsMat. Master Maintenance: Initial Parameters - Orig. MaterialMaterial Master Maintenance: Initial Param. - Ref. MaterialSFIS : order item data for materialSFIS : order operation data for work centerAddress management : company dataIntegrating Knowledge Warehouse & Workplace serverHeader information for a Set (FI/GL/SL)Values for a Set (FI/GL/SL)G/L account master ; chart of accounts (FI/CO)G/L account master record (chart of accounts: descr.) (FI/CO)G/L account master ; company code (FI/CO)Elements of stock populationR/3 <-> CRM tablesSAP-office DB for objects (import/export)

SAP-office : folder contentsSAP-office : object definitionVariables for RFC destinations ; Workplace serverVariables for URL generation ; Workplace serverBOM headerBOM itemName is does not have an A at the end ; BOM itemsBOM items (extended for list displays)STXD Sapscript text file header (system)STXD SAP script text file lines (system)Permanent BOM dataClassification system : catchwordsClientsMRP at MRP area levelCompany codes (PM/SM/SD)Permitted posting periodsCompany code-dependent standard textsValuation areaStorage locations (PM/SM/SD)Personnel Area/SubareaAccounting clerksCompany code-dependent textsPlants/branches (PM/SM/SD)Language key textsOrder types (PM/SM/SD)Order type descriptionsDocument type texts (FI/CO)Directory of charts of accountsCountry codes (system)Taxes : Region (Province) Key (system)Country descriptionsTaxes : Region Key : Texts (system)Country specific , or .Units of measurment (system)Assign Internal to Language-Dependent UnitTable for grouping tax basis balancesTax code names (FI/CO)Text (investments) (FI/CO)Fiscal year variantsFiscal year variant periodsFinancial statement versionsHouse banksHouse bank accountsCredit control areasSCB Ratios

Names of the months (system)Spool : print control translationMaterial groups (MM)Purchasing groupsMRP controllersPurchasing OrganizationsProduction schedulerValuation classsesShipping Instructions, PurchasingTexts: Shipping InstructionsFi configuration - automatic postings -> show accounts (FI/CO)Parameters for payment transactionsAccount determination for payment programPayment methods for automatic paymentAccount balances for statutory reportingPayment terms FIOwn explanations for terms of paymentsSpecial G/L indicator namesSpecial G/L indicator propertiesCustomer account groups (PM/SM/SD)MessagesMaterial typesControl of Qty/value updateMovement types (MM)Fields in quantity stringPosting string : quantityNext movement typeMovement type : quantities/value postingHelp texts for movement types (MM)Check table : movement type for transaction codeMessage Determination Schemas: AssignmentText for purchasing document types (PP)Assignment Internal/External Confirmation CategoryConfirmation Control Keys: DescriptionTexts for item categoriesCopying Options: Item textsSupplement Text in Purchasing Document PrintoutsPrint Relevant Purchasing Document ChangesHeader Texts in Purchasing Document PrintoutsItem Texts in Purchasing Document PrintoutsChange Texts in Purchasing Document PrintoutsHeadings in Purchasing Document PrintoutRoutes : mode of transport for each shipping typeMaterials : product hierarchiesSubscreen user-exit

Table with formulas for CO/PAMonth name and short text (system)WM warehouse numbersWM storage typesWM storage sectionsDefinition of WM groupsPrint pool definitonsTransfer order printer controlPrint control tableTransfer order print parametersPrint control table for multiple processing proceduresStorage type controlTexts for transfer typesMaintenance revisions (PM/SM/SD)Maintenance activity type description (PM/SM/SD)Priorities (PM/SM/SD)Permits (PM/SM/SD)Table 357G texts (PM/SM/SD)Activity category for PM lists (PM/SM/SD)Control parameters for MRPPurchasing value keyItem categoriesControl parameters for MRP - material levelUser parameters for planning typeDescription of MRP elementsVersionstableCustomizing table selection rule / display filtersText table for T462 : customizing selection rulePersonnel Country GroupingPersonnel AreasMarital Status DesignatorsEmployee Groups / SubgroupsEmployee Subgroups NamesWork Schedule RulesPay Scale GroupsPay Scale TypesAssign pay scale --> CurrencyPay Scale -> Period Parameter AssignmentWage TypesWage type textsWage Type ValuationPermissibility of Wage Taypes per InfotypeOrganizational UnitsPosition Texts

Personnel Action TextsReason for actionReason for Action TextsPayroll Accounting AreasPayroll PeriodsDaily Work SchedulesDaily Work Schedule TextsPeriod Work Schedule TextsMonthly Work scheduleAbsence ValuationAbsence and Attendance TypesAbsence and Attendance TextsPayroll Account Transfer : Payroll PeriodsPayroll Control RecordsControls fields that appear on HR screens (PA)

Transfer ext. payroll results into Canadian specific tablesForeign trade : commodity code/import code numberForeign trade : commodity code/import code no. descriptionForeign trade : customs officesForeign trade : customs offices descriptionsHazardous material warningsTexts for hazardous material warningsCondition techniquesBenefits insurance planBenefits Calculation Rule for Insurance Coverage FormulaBuilding Addresses (system)FI-SL set tableTrading partners (Global company data for KONS ledger)All possible activities for profilesAll valid activities for each authorization objectDirectory of R/3 repository objects (system)Text tab. for investment profile (FI/CO)Distribution model + filters (IDOC)find functions, object type, method, idoc type, message type, ... (IDOC)Logical systemALE supplement data for EDI message typeDefinition of authorization groupsPosting keysPosting key names

governs the foreground sequence of infotypes the system will use to prompt the user during online and batch processing. You will have to code your BDC to follow that sequence of creating infotypes.

governs the dynamic event processing that will only take place during online user inputs. For BDC's you will have to create separate BDC's to handle any infotypes that are inserted dynamically by this table.

Structure for transferring job header data (BI-API)Job status overview table (system)R = Active jobs, P = Scheduled jobs, A = Cancelled jobs, S = Released jobs, F = ReadyBatch job step overview (system)Applic.Specific criteria for alternative determinationCapactity categoryControl recipe destinationsTask list typesLanguage dependent texts for sequence categoriesTaks list applicationsEngineering change management : control dataClass typesClass types textsClassificationClassification statusMethod for planned order selection by work centersTarget system with destination and function for data uploadClassifiable objectsCIM order : text IDs of objects in ordersModification parameters/Defaults for BOM'sUser profile for BOM'sCustomizing MM configurationDecimal places in currenciesExchange ratesTable control views (user settings)Assingment of tables to authorization groupsTexts for development classesMaster effectivity objectIDOC status valuesShort description of IDOC status valuesEDI status : assignment to Sts Grps, Suitabilityy f. ArchiviFactory calendarFactory calendar (display)Contains all Functions + description (system)Function module short text (system)Business areaSAPscript : Text headerGUI classification for workflow (customer) ; Workplace serverGUI classification for workflow (standard) ; Workplace serverCustomers ; incoterms (PM/SM/SD)System statusUser statusControlling area's (FI/CO)Basic settings for versions (FI/CO)CO versions (FI/CO)

Tax exemption licenseSAPscript : text linesGlobal control elements : LIS info structureMaterial freight groupsProcessing Key for Sub ItemsOutput control printer per storage locationAll output documents + formatting programSAP ArchiveLink structure of a DARA lineBusiness partner : functions in partner determination processParameter-ID'sABAP authorization groupsMaster record, LIFO poolsQM certificate categories for procurementInspection catalog type indexAssignment of inspection type to originContains all programs,...Texts for TRDIR

authorization for mailboxes (Workflow)Spool requestsSpool : print requestsSpool : printer declarationprinter informationSpool : Long device namesSpool : sequences for handling paperSpool : formatOrganizational unit : sales divisionsText descriptions for LIFO poolsStatus fields for an activity in a projectTexts for an activity in a projectSAP transaction codes (system)Transaction Code Texts (system)Check table for transaction codesGUI classification for transactionsOrganizational unit : transportation scheduling pointDelivery scheduling : transportation groupsText processing : text type in text proc. -> access sequenc. (pooled table)Valid text IDsTexts on text IDsTime zonesUser types in the R/3 system (system)Special versions (system)Table of variables in selection criteria (system)

Can add parameters to the INSERT COMMAND (IC). Then, when you insert command, your info appears in the editor. Useful for comment blocks, common section of code, etc.

Organizational unit : sales officesView Directory (system)Organizational unit : sales groupOrganizational unit : sales group textsOrg. unit : sales office ; assignment to organizational unitOrganizational unit : sales organizations (PM/SM/SD)Organizational unit : divisions per sales organisation (PM/SM/SD)Organizational unit : sales organizations texts (PM/SM/SD)Org. unit : distribution channels per sales organization (PM/SM/SD)Organization unit : allowed plants per sales organizationDelivery typesRoutesRoutes : textShipping conditionsShipping conditions : textsOrganizational unit : shipping pointsOrganizational unit : shipping points textsOrganizational unit : sales area(s) (PM/SM/SD)Organizational unit : distribution channelsPackaging material types : designationsCustomer groupsCustomers : terms of payment textsDetermination of address from plant and storage locationWeb server definitionsDefine R/2 -> R/3 connections ; communication tableFlow types text table (FI/CO)Financial assets management product type texts (FI/CO)Customers : regional zoneCustomers : regional zone textsData relevant to measurment for user master record (system)Change history for logon dataChange history for authorizationsChange history for authorization profilesChange history for authorization valuesDefault values for authorization objectsCustomer table -> fill with transaction SU25Which authorization checks must be performed for a transactionCustomer table -> fill with transaction SU25User : parameter transfer structureUser master record ; runtime data (system)Logon data (system)User address dataUser master authorizations (system)User master parameter IDAdditional data per user (system)

Surchargeable language versions per user (system)Assign user name address key (system)Reserved passwordsGUI classification for special users ; Workplace serverWeb server definitions for special usersVariant catalogVariant catalog textsSales document : header dataSales document : item dataSales requirements : individual recordsSales doc. access methods : key fields : document printingDocument header view for delivery noteSales document : schedule line dataSales document flow (find preceeding and subsequent documents)Error log for collective processingSales document : business dataSales document : partnerBilling ; header dataBilling ; item dataPreliminary posting doc. segment for G/L accts (FI/CO)Collective processing for a sales document headerSales document : header status and administrative dataSales document : item statusIntrastat receipt/dispatchHandling unit - header tablePacking : handling unit item (contents)Account determination in shipment costs itemShipment costs : item dataOrder selection view (PM/SM/SD)Version managementCentral version control tableChecking table supplementTransaction (FI/CO)Transaction flow (FI/CO)Transaction activity (FI/CO)Transaction condition (FI/CO)Shipping document flowMaster data listed options and futures (FI/CO)Underlying transaction (FI/CO)Underlying transaction flows (FI/CO)Underlying transaction status table (FI/CO)Futures and options (FI/CO)Shipping : partner (TM)Shipment header (TM)Shipment header for logging (TM)

Shipment : item (TM)Stage of shipmentDescriptions for legAsset master (FI/CO)General Workplace settingsReplenishment : quantities per customer/materialPartner functions