8/4/2019 EMBL, bilogical data bases, bioinformatics data base

1/3

EMBL Nucleotide Sequence Database

EMBL (http://www.ebi.ac.uk/embl/ ) the nucleotide database from the EuropianBioinformatics institute (EBI). its Main sources for DNA and RNA sequences are directsubmissions from individual researchers, genome sequencing projects and patentapplications. The database is produced in an international collaboration with GenBank (USA)and the DNA Database of Japan (DDBJ). Each of the three groups collects a portion of thetotal sequence data reported worldwide, and all new and updated database entries areexchanged between the groups on a daily basis. The EMBL nucleotide sequence databaseforms part of the European Nucleotide Archive , an EBI project led by Guy Cochrane as partof the The Protein and Nucleotide Database Group (PANDA) under Ewan Birney .

The EMBL Nucleotide Sequence Database can be accessed a variety of ways Like SRSsystem ,Batch Retrival, Simple sequence retrival, FTPserver etc.Data submission is allowed

by Webin - WWW Nucleotide Sequence Submissions Sequin , Third Party Annotation (TPA)Submission, BARCODE Submission.Data search by BLAST & FASTA.

EMBL Database contained 301,588,430,608 nucleotides in 199,575,971 entries (9 th june2011).

EMBL Format

ID X64011; SV 1; linear; genomic DNA; STD; PRO; 756 BP.XXAC X64011; S78972;XXSV X64011.1XXDT 28-APR-1992 (Rel. 31, Created)DT 30-JUN-1993 (Rel. 36, Last updated, Version 6)XXDE Listeria ivanovii sod gene for superoxide dismutaseXXKW sod gene; superoxide dismutase.XXOS Listeria ivanoviiOC Bacteria; Firmicutes; Bacillus/Clostridium group;OC Bacillus/Staphylococcus group; Listeria.

XXRN [1]RX MEDLINE; 92140371.RA Haas A., Goebel W.;RT "Cloning of a superoxide dismutase gene from Listeria ivanovii byRT functional complementation in Escherichia coli and characterization oftheRT gene product.";RL Mol. Gen. Genet. 231:313-322(1992).XXRN [2]RP 1-756RA Kreft J.;

RT ;RL Submitted (21-APR-1992) to the EMBL/GenBank/DDBJ databases.

http://www.ebi.ac.uk/embl/http://www.ebi.ac.uk/embl/http://www.ebi.ac.uk/embl/http://www.ebi.ac.uk/enateam/http://www.ebi.ac.uk/enateam/http://www.ebi.ac.uk/enateam/http://www.ebi.ac.uk/Information/Staff/person_maintx.php?s_person_id=207http://www.ebi.ac.uk/Information/Staff/person_maintx.php?s_person_id=207http://www.ebi.ac.uk/panda/http://www.ebi.ac.uk/panda/http://www.ebi.ac.uk/panda/http://www.ebi.ac.uk/Information/Staff/person_maintx.php?s_person_id=90http://www.ebi.ac.uk/Information/Staff/person_maintx.php?s_person_id=90http://www.ebi.ac.uk/Information/Staff/person_maintx.php?s_person_id=90http://www.ebi.ac.uk/Information/Staff/person_maintx.php?s_person_id=90http://www.ebi.ac.uk/panda/http://www.ebi.ac.uk/Information/Staff/person_maintx.php?s_person_id=207http://www.ebi.ac.uk/enateam/http://www.ebi.ac.uk/embl/

8/4/2019 EMBL, bilogical data bases, bioinformatics data base

2/3

RL J. Kreft, Institut f. Mikrobiologie, Universitaet Wuerzburg,Biozentrum AmRL Hubland, 8700 Wuerzburg, FRGXXFH Key Location/QualifiersFH

FT source 1..756FT /db_xref="taxon:1638"FT /organism="Listeria ivanovii"FT /strain="ATCC 19119"FT /mol_type="genomic DNA"FT RBS 95..100FT /gene="sod"FT terminator 723..746FT /gene="sod"FT CDS 109..717FT /transl_table=11FT /gene="sod"FT /EC_number="1.15.1.1"

FT /db_xref="GOA:P28763"FT /db_xref="HSSP:P00448"FT /db_xref="InterPro:IPR001189"FT /db_xref="UniProtKB/Swiss-Prot:P28763"FT /product="superoxide dismutase"FT /protein_id="CAA45406.1"FT/translation="MTYELPKLPYTYDALEPNFDKETMEIHYTKHHNIYVTKLNEAVSGFTFT DVWEHAYYLKFQNRRPEYIDTFWNVINWDERNKRFDAAK"XXSQ Sequence 756 BP; 247 A; 136 C; 151 G; 222 T; 0 other;

cgttatttaa ggtgttacat agttctatgg aaatagggtc tatacctttc gccttacaat 60gtaatttctt ..........

120//

ID Identification Begins each entry1 per entrySQ Sequence Header 1 per entryDT Date 2 per entryAC Accession Number >=1 per entryDE Description >=1 per entryKW Key word >=1 per entryOS Organism Species >=1 per entryOC Organism Classification >=1 per entryRN Reference Number >=1 per entryRP Reference Position >=1 per entryRA Reference Author >=1 per entryRT Reference Title >=1 per entryRL Reference Location >=1 per entryXX Spacer line Many per entryOG Organelle 0 or 1 per entryRC Reference comment >=0 per entryDR Database cross reference >=0 per entryFH Feature table header 0 or 2 per entry

FT Feature table data >=0 per entryCC Comment or notes >=0 per entry

8/4/2019 EMBL, bilogical data bases, bioinformatics data base

3/3