![Page 1: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/1.jpg)
BioTeamThe
![Page 2: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/2.jpg)
B i o T e a mThe
A SysAdmin’s Intro to Bioinformatics
William Van Etten, PhDThe BioTeam, Inc.
November 18, 2004
![Page 3: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/3.jpg)
The BioTeam, Inc.Who are they?
• Scientists, Developers, IT Professionals• Objective, vendor agnostic
professional services• Principals– Michael Athanas– Chris Dagdigian– Stan Gloss– William Van Etten
http://bioteam.net/
![Page 4: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/4.jpg)
Session Objectives
25 min Genetics to Genomics
10 min Informatics Algorithms Compared
10 min Clustering for Informatics
15 min iNquiry Demo “Live”
30 min Q & A
![Page 5: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/5.jpg)
B i o T e a mThe
Genetics to Genomics
![Page 6: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/6.jpg)
Genetics to Genomics• 1600’s- Europe Emerges from the Dark Ages• 1866- Genetic Theory Published (Mendel)• 1869- DNA Discovered (Miescher)• 1952- DNA is Genetic Material (Hershey)• 1953- DNA Helical Structure Determined (W&C, Franklin)• 1959- Protein Structure Determined (Perutz, Kendrew )• 1966- Genetic Code (Nirenberg, Khorana)• 1977- DNA Sequenced (Sanger)• 1988- Human Genome Project Started• 2001- Human Genome Draft Finished
![Page 7: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/7.jpg)
Genetics Trivia• “Everything you are, is either protein or the result of protein action.”• Proteins: folded strings of Amino Acids (20)• Genes: [regions of DNA that define a protein]• 3 billion DNA letters (4) in the human genome• ~5% of human DNA contain genes (~35K)• 999/1000 DNA identity between any two people• Human genes are 98% similar to those of a Chimpanzee• Human genes are 50% similar to those of a Banana
![Page 8: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/8.jpg)
Origin of LifeFrancesco Redi: 1626-1697
• Prevailing Theory “Spontaneous Generation”• Life arises spontaneously from non-living
matter• Meat makes maggots, Straw makes mice...– Meat in two jars, one open one sealed. – Observe flies -> eggs -> maggots -> flies – nothing happens to the closed jar meat• Inference: Flies make flies
![Page 9: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/9.jpg)
Father of GeneticsGregor Mendel (1822-1884)
• Monk, Interested in math & gardening• Selectively bred pea plants– 28,000 plants over 7 years– 7 distinct traits• Studied one characteristic at a time:– Pea shape, color, seed-coat, flower color...• Kept pedigrees and made several
generations of crosses• Kept track of the number and type of
progeny from each cross
![Page 10: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/10.jpg)
Mendelian Genetics• Genetic “factors” (genes) determine
phenotypic traits.
• Each organism has two instances (alleles) of each gene.
• Independent assortment: One copy from from each parent is (selected at random) is passed on to each progeny.
![Page 11: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/11.jpg)
• 1943: Oswald Avery et. al. sacrifice mice to demonstrate that DNA could be the material for genes. ( to one part in 6x108)• 1952: Alfred Hershey and Martha Chase
use viruses to prove it.• “Perhaps we will be able to grind genes
in a mortar and cook them in a beaker after all.”
-Hermann Muller
DNA is the Genetic Material
![Page 12: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/12.jpg)
• 1953 - 3D Structure of DNA– Watson & Crick - model– Wilkins & Franklin -x-ray structure– Nobel in 1962
DNA Structure is a Double Helix
![Page 13: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/13.jpg)
• 1959 – 3D Structure of a Protein– Perutz & Kendrew – Structure of myoglobin & hemoglobin– Nobel in 1962
3D Protein Structure Determined
![Page 14: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/14.jpg)
• 1960’s – Genetic Code– Holley, Khorana and Nirenberg– Rosetta Stone of Life– Nobel in 1968
Genetic Code Broken
![Page 15: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/15.jpg)
Sanger DNA Sequencing• DNA of all possible lengths from a
known starting point• Each strand ends with a
radioactive “didioxy” nucleotide which terminates the chain• The strands are “weighed” using
gel electrophoresis…AGTCCTG …AGTCCT…AGTCC…AGTC …AGT…AG…A
G A T C
![Page 16: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/16.jpg)
Modern Sequencing• Accomplished in a single capillary tube• Results read via a laser spectrometer• Accurate to ~700bp• Completely automated (~$0.04 / bp)
![Page 19: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/19.jpg)
B i o T e a mThe
*omics by Cartoon
![Page 22: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/22.jpg)
Informatics Problems ...• Genetic Mapping• Sequence Analysis• Genome Annotation• Functional Genomics• Comparative Genomics
![Page 23: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/23.jpg)
Informatics Problems ...• Genetic Mapping• Sequence Analysis• Genome Annotation• Functional Genomics• Comparative Genomics• Expression Analysis
![Page 26: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/26.jpg)
Informatics Problems ...• Proteomics• Protein Folding• Crystallography• Chemical Modelling• Docking• Systems Biology
![Page 27: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/27.jpg)
B i o T e a mThe
Informatics
![Page 28: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/28.jpg)
B i o T e a mThe
Informatics“Computer Aided Scientific Data Analysis”
![Page 29: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/29.jpg)
Working TogetherOne would expect wet-lab scientists to have a healthy
skepticism of any results, knowing how often experiments fail, and how much bad data has made it out into the literature, but
many seem to have an almost mystical faith in anything produced by computation.
On the other hand, computational people seem to have an almost mystical faith in wet-lab verification---expecting
experiments to be neat, quick deterministic tests like "if" statements in code.
- Gordon D. Pusch
![Page 30: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/30.jpg)
B i o T e a mThe
The Data
![Page 32: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/32.jpg)
DNA/RNA Code
A --> adenosine M --> A C (amino)C --> cytidine S --> G C (strong)G --> guanine W --> A T (weak)T --> thymidine B --> G T CU --> uridine D --> G A TR --> G A (purine) H --> A C TY --> T C (pyrimidine) V --> G C AK --> G T (keto) N --> A G C T (any) - gap of ? length
![Page 33: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/33.jpg)
Amino Acid CodeA alanine P prolineB D or N Q glutamineC cystine R arginineD aspartate S serineE glutamate T threonineF phenylalanine U selenocysteineG glycine V valineH histidine W tryptophanI isoleucine Y tyrosineK lysine Z E or QL leucine X anyM methionine * translation stopN asparagine - gap of ? length
![Page 34: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/34.jpg)
Genetic CodeTTT FTTC TTA LTTG
TCT STCC TCA TCG
TAT YTAC TAA STOPTAG STOP
TGT CTGC TGA STOPTGG W
CTT LCTC CTA CTG
CCT PCCC CCA CCG
CAT HCAC CAA QCAG
CGT RCGC CGA CGG
ATT IATC ATA ATG M
ACT TACC ACA ACG
AAT NAAC AAA KAAG
AGT SAGC AGA RAGG
GTT VGTC GTA GTG
GCT AGCC GCA GCG
GAT DGAC GAA EGAG
GGT GGGC GGA GGG
![Page 35: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/35.jpg)
B i o T e a mThe
Sequence Searching AlgorithmsCompared
![Page 36: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/36.jpg)
BLAT• Simple, “grep-like”, character matching algorithm• Identifies matches > 90% identity
• chop database sequences into overlapping N-mers• create an indexed HASH table of each database sequence
• chop query sequence into overlapping N-mers• create a HASH table of query sequence words
• positive hit when >90% of query HASH entries are in DB HASH entry
![Page 37: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/37.jpg)
BLAST• Simple character matching algorithm• Everything that BLAT does• Plus...•
• Identifies similarities (with gaps) of relative statistical significance•
• After identifying significant query/database HASH overlap•
• Extend matches, allowing gaps
![Page 38: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/38.jpg)
HMMer ...• Not like BLAT or BLAST
• More sophisticated, pattern matching algorithm• “Voice recognition-like”
• Build statistical model of a multiple sequence alignment• Search sequence databases with models• Search model databases with sequences
![Page 39: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/39.jpg)
Hmmer ...• Build an HMM model from 50 globins– % hmmbuild globin.hmm globins50.msf• Calibrate the model– % hmmcalibrate globin.hmm• Search shrimp sequence DB with model– % hmmsearch globin.hmm Artemia.fa• Search model database with shrimp sequence– % hmmpfam globin.hmm Artemia.fa
![Page 41: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/41.jpg)
MSF FormatDNA_MULTIPLE_ALIGNMENT 1.0 Three anthropoidea MSF: 50 Type: N Check: 2666 ..
Name: Homo_sapiens Len: 50 Check: 8318 Weight: 1.00 Name: Pan_paniscus Len: 50 Check: 7854 Weight: 1.00 Name: Gorilla_gorilla Len: 50 Check: 7778 Weight: 1.00
//
Homo_sapiens AGUCGAGUC...GCAGAAAC Pan_paniscus AGUCGCGUCG..GCAGAAAC Gorilla_gorilla AGUCGCGUCG..GCAGAUAC
Homo_sapiens GCAUGAC.GACCACAUUUU. Pan_paniscus GCAUGACGGACCACAUCAU. Gorilla_gorilla GCAUCACGGAC.ACAUCAUC
Homo_sapiens CCUUGCAAAG Pan_paniscus CCUUGCAAAG Gorilla_gorilla CCUCGCAGAG
![Page 43: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/43.jpg)
FASTA Format
>gi|532319|pir|TVFV2E|TVFV2E envelope proteinELRLRYCAPAGFALLKCNDADYDGFKTNCSNVSVVHCTNLMNTTVTTGLLLNGSYSENRTQIWQKHRTSNDSALILLNKHYNLTVTCKRPGNKTVLPVTIMAGLVFHSQKYNLRLRQAWCHFPSNWKGAWKEVKEEIVNLPKERYRGTNDPKRIFFQRQWGDPETANLWFNCHGEFFYCKMDWFLNYLNNLTVDADHNECKNTSGTKSGNKRAPGPCVQRTYVACHIRSVIIWLETISKKTYAPPREGHLECTSTVTGMTVELNYIPKNRTNVTLSPQIESIWAAELDRYKLVEITPIGFAPTEVRRYTGGHERQKRVPFVXXXXXXXXXXXXXXXXXXXXXXVQSQHLLAGILQQQKNLLAAVEAQQQMLKLTIWGVK>gi|532320|some other proteinELRLRYCAPAGFALLKCNDADYDGFKTNCSNVSVVHCTNLMNTTVTTGLLLNGSYSENRTQIWQKHRTSNDSALILLNKHYNLTVTCKRPGNKTVLPVTIMAGLVFHSQKYNLRLRQAWC…
![Page 44: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/44.jpg)
hmm FormatHMMER2.0 [2.2g]NAME globins50LENG 148ALPH AminoRF noCS noMAP yesCOM ../binaries/hmmbuild globin.hmm globins50.msfCOM ../binaries/hmmcalibrate globin.hmmNSEQ 50DATE Thu Jul 25 10:51:38 2002CKSUM 9858XT -8455 -4 -1000 -1000 -8455 -4 -8455 -4 NULT -4 -8455NULE 595 -1558 85 338 -294 453 -1158 197 249 902 -1085 -142 -21 -313
45 531 201 384 -1998 -644 EVD -41.853970 0.212647HMM A C D E F G H I K L M N P Q
R S T V W Y m->m m->i m->d i->m i->i d->m d->d b->m m->e -661 * -1444 1 77 -228 -1302 -1020 -730 -1034 -756 578 -803 -375 82 -791 -1461 -720
-959 364 -94 2204 -1315 -857 9 - -149 -500 233 43 -381 399 106 -626 210 -466 -720 275 394 45
96 359 117 -369 -294 -249 - -39 -5807 -6849 -894 -1115 -701 -1378 -661 *
![Page 45: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/45.jpg)
Sequence Analysis Algorithm Summary• BLAT rapidly identifies nearly identical sequences (chars)• BLAST less rapidly identifies similar sequences (chars)• HMMer identifies “likeness” of protein families (pattern matching)
![Page 46: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/46.jpg)
B i o T e a mThe
Clustering for Informatics
![Page 47: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/47.jpg)
What’s Different?• Many User Models
• Many Applications
• Mostly Open Source
• Cooperative and Collaborative
• Compute and Data Intensive
• Rapid Rate of Growth
![Page 48: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/48.jpg)
Types Of Problems
Tightly Coupled Embarrassingly Parallel
1 + 1 = X 1 + 1 = X
X + 2 = Y 2 + 2 = Y
Y + 3 = Z 3 + 3 = Z
Z + N = W N + N = W
![Page 50: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/50.jpg)
B i o T e a mThe
Types of Clusters
![Page 53: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/53.jpg)
Tightly Coupled
Low Latency Switching Fabric
Public Local Area Network
Private Ethernet Network
![Page 54: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/54.jpg)
Portal Architecture
User 1 User 2Public LAN
Private Ethernet Network
Portal Head NodeDistributed Resource Management (DRM) System
![Page 55: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/55.jpg)
B i o T e a mThe
Infx Cluster Requirements
![Page 56: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/56.jpg)
Infx Cluster Requirements
User Model Storage
Applications Maintenance
Compilers Administration & Monitoring
Physical Environment DRM
Know Bottlenecks Common File System
Network & Topology Common User Environment
![Page 57: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/57.jpg)
Portal Architecture
Public LAN
Private Ethernet Network
Portal Head NodeDistributed Resource Management (DRM) System
![Page 58: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/58.jpg)
Infx Cluster Requirements
Network Services -DHCP, DNS
Web Services -HTTP, HTTPs
Common User Environment -NetInfo, NIS, LDAP, /etc/*
Time Synchronization -NTP
Common File System -AFP, NFS, SMB, AFS
DRM -LSF, SGE, PBS
Network Translation -NATd
Image Server -NetInstall, NetRestore, SI
Mail Services -POP, IMAP, SMTP
Cluster Monitor -Server Admin/Monitor, BB
![Page 60: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/60.jpg)
Clustering: PROS• Affordable
• Scalable
• Flexible
• Reliable
• Consumable
• Sharable
![Page 61: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/61.jpg)
Clustering: CONSChallenging to ...
• Build
• Manage
• Use
• Map computing to computers
• Achieve high-throughput
• Achieve high-performance
![Page 62: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/62.jpg)
B i o T e a mThe
BioTeam iNquiry
![Page 63: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/63.jpg)
BioTeam iNquiryWhat’s inside?
• Network Services• DRM (Sun GridEngine, LSF compatible)• Admin & Monitoring Tools• 200+ Informatics Applications– Cluster enabled– UI for the scientist– Consistent & Extensible
![Page 65: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/65.jpg)
To This
Public LAN
Private Ethernet Network
Portal Head NodeNetwork Services, DRM, Admin/Mon, Infx Tools
![Page 68: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/68.jpg)
B i o T e a mThe
iNquiry Demo
![Page 69: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/69.jpg)
B i o T e a mThe
Screenshots in place of “Live” Demo
![Page 70: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/70.jpg)
Extensible and modifiableWeb-based Tool Access
Tools are organized into folders by function
The active tool is emboldened
All tools have an “advanced” and “simple” form
Applications can be viewed in a flat list
![Page 71: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/71.jpg)
Quick access to simple forms forstandard searches
Results are e-mailed to user (and displayed in the web browser)
Direct data entry
Data entry via file upload
Quick access to installed databases
All command-line options are availablein the web interface
![Page 73: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/73.jpg)
Simple User Management
Choose between regular useror administrator
Minimal effort to create anew user
Single-click user disabling or deletion
![Page 75: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/75.jpg)
Only admin users have access to management tools
Instantly see if any cluster nodes are offline
See load statistics for the entire cluster
See load statistics for individual cluster nodes,including the portal (head) node
Cluster Monitoring
![Page 76: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/76.jpg)
Histograms of CPU utilization by percentage
Histograms of memory usage by gigabyte
Load histograms for individual cluster nodes
![Page 77: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/77.jpg)
Fully provisioned bioinformatics portal
• Turnkey bioinformatics solution • Web-based front end to bioinformatics cluster• Useful for biologists that are non-bioinformaticists• Sophisticated Unix level access for power users• Many applications are Velocity Engine performance optimized• Excellent solution for G4 Xserves• Fast and simple deployment of a compute cluster
BioTeam’s iNquiry - Solution Summary
![Page 78: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/78.jpg)
BioTeam iNquiry
Public LAN
Private Ethernet Network
Portal Head NodeNetwork Services, DRM, Admin/Mon, Infx Tools
![Page 80: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/80.jpg)
iNquiry Installation ...Step Two
• Boot and Re-image head node from external FireWire device
![Page 81: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/81.jpg)
iNquiry Installation ...Step Three
• Boot and re-image cluster from head node
Public LAN
Private Ethernet Network
Portal Head NodeNetwork Services, DRM, Admin/Mon, Infx Tools
![Page 82: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/82.jpg)
B i o T e a mThe
Q&A
![Page 83: The BioTeam - USENIXThe info@bioteam.net BioTeam Genetics Trivia • “Everything you are, is either protein or the result of protein action.” • Proteins: folded strings of Amino](https://reader033.vdocuments.us/reader033/viewer/2022052102/603ca9512e4a14704542a047/html5/thumbnails/83.jpg)
TM and © 2004 The BioTeam, Inc. All rights reserved.
BioTeamThe