Transcript

U s e r G u i d e s

I D C D O C U M E N T A T I O N

Database Schema

Revision 5

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

NoticeThis document was published by the Monitoring Systems Operation of Science Applications International Corporation (SAIC) as part of the International Data Centre (IDC) Documentation. It was first published in 1998 and was republished as Revision 1 in March 1999 and then again as Revision 2 in November 2000 to include major changes. This third revision of the document was published electronically as Revision 3 in October 2002. The fourth and fifth revisions of the document were published by Veridian Systems in August 2002 and October 2002, respec-tively; these include changes only to the radionuclide sections of the document. IDC documents that have been changed substantially are indicated by a whole revision number (for example, Revision 1).

ContributorsJerry A. Carter, Science Applications International CorporationRoger Bowman, Science Applications International CorporationKendra Biegalski, Veridian SystemsMark D. Fisk, Mission Research CorporationRichard J. Carlson, Mission Research CorporationPat Donohoe, Veridian SystemsWilliam E. Farrell, Science Applications International CorporationBonnie MacRitchie, Science Applications International CorporationHallie Magyar, Veridian Systems

TrademarksEthernet is a registered trademark of Xerox Corporation. ORACLE is a registered trademark of Oracle Corporation.Solaris is a registered trademark of Sun Microsystems.SPARC is a registered trademark of Sun Microsystems.SQL*Plus is a registered trademark of Oracle Corporation.UNIX is a registered trademark of UNIX System Labs, Inc.

Ordering InformationThe ordering number for this document is TN2924 through Veridian Systems. Notice PageThis document is cited within other IDC documents as [IDC5.1.1Rev5].

TABLE OF CONTENTS

About th is Document xxi

• PURPOSE xxii

• SCOPE xxii

• AUDIENCE xxii

• RELATED INFORMATION xxii

• USING THIS DOCUMENT xxiii

Chapter 1 : S /H/ I En t i t y Re la t ionsh ips 1

• OVERVIEW 2

• FUNDAMENTAL TABLES 6

• REFERENCE TABLES 13

• S/H/I APPLICATION SOFTWARE TABLES 16

• HISTORICAL DATA TABLES 30

Chapter 2 : S /H/ I Tab le Descr ip t ions 33

• AFFILIATION, STANET 34

• ALLOCATE_HOUR 35

• ALLOW_RESID 36

• ALPHASITE 37

• AMP3C 38

• AMPDESCRIPT 39

• AMPLITUDE 40

• APMA 42

• ARCH_DATA_TYPE 44

• ARRIVAL 45

• ASSOC, ASSOC_TEMP_GA 47

• ATTENCOEF 49

• BEAMAUX 50

• BULL_COMP 51

• CEPPKS 53

i

TABLE OF CONTENTS

• CHAN_GROUPS 54

• CHANNAME 55

• COLORDISC 56

• COMPLEXITY 57

• DATADAYS 58

• DATAREADY 59

• DATAUSER 60

• DETECTION 62

• DISCARD 64

• DLFILE 65

• DLMAN 67

• EV_SUMMARY, EX_SUMMARY, AN_SUMMARY 68

• EVENT 70

• EVENT_CONTROL, IN_EVENT_CONTROL 71

• EVSC_HYDRO 73

• EVSC_PROD 74

• EVSC_REGIONAL 76

• EX_AN 78

• EXCEPTION_CHANMAP 80

• EXPLO 81

• FILEPRODUCT, FS_STAGEPRODUCT 83

• FKDISC 84

• FORBEAMAUX 86

• FPDESCRIPTION 87

• FSAVE 88

• FSDISC 89

• FSRECIPE 91

• FSTAG 92

ii

TABLE OF CONTENTS

• FTPFAILED 93

• FTPLOGIN 94

• FWFILE 95

• FWGAP 96

• FWSITE 97

• GA_TAG 98

• GLOSSARY 99

• GREGION 100

• HYDRO_ARR_GROUP 101

• HYDRO_ASSOC 102

• HYDRO_FEATURES 103

• INFRA_FEATURES 105

• INSTRUMENT 107

• INTERVAL 108

• LASTID, PROBLASTID, RMS_LASTID 109

• LOCATION 110

• MAPCOLOR 111

• MAPDISC 112

• MAPOVER 114

• MAPPOINT 115

• MIG_DATE 116

• MIG_RULES 117

• MSGAUX 118

• MSGDATATYPE 119

• MSGDEST 120

• MSGDISC 121

• NA_VALUE 123

• NETMAG 124

iii

TABLE OF CONTENTS

• NETWORK 125

• ORIGAUX 126

• ORIGERR, ORIGERR_TEMP_GA 127

• ORIGIN, ORIGINREF, ORIGIN_TEMP_GA 128

• OUTAGE 130

• OVERLAYDISC 131

• PARRIVAL 132

• PARTICIPATION 133

• PROBLEM 134

• PROBLEMLOG 135

• PROBLEMMAIL 136

• PRODTRACK 137

• PRODUCTCRITERIA 138

• PRODUCTTYPEEVSC 140

• PRODUCTTYPEORIGIN 142

• PRODUCTTYPESTA 144

• QCSTATS 145

• REBDONE_DATADAY_FLAG 147

• REF_LOC 148

• REGCOEF 149

• REMARK 150

• REQUEST 151

• REVAUDIT 153

• SCAN_DATE 154

• SEISGRID, DSEISGRID 155

• SEISINDEX, DSEISINDEX 156

• SENSOR 157

• SITE 159

iv

TABLE OF CONTENTS

• SITE_ADDRESS 160

• SITEAUX 161

• SITECHAN 162

• SITEPOLL 163

• SPLP 164

• SPVAR 165

• SREGION 166

• STAMAG 167

• STASSOC 169

• STD_CHANMAP 170

• SUBS 171

• SUBSUSER 172

• THIRDMOM 173

• TIMEFREQ 174

• TIMESTAMP 175

• WEIGHTS 176

• WFAUX 177

• WFCONV 178

• WFDISC, WFPROTO 180

• WFTAG 182

• XTAG 183

Chapter 3 : S /H/ I Co lumn Descr ip t ions 185

• RANGES 186

• NA VALUES 186

• COLUMNS 187

Chapter 4 : Rad ionuc l ide Database Overv iew 413

• TWO-TIER DATABASE SCHEMA 414

• DATABASE ORGANIZATION 414

v

TABLE OF CONTENTS

• RADIONUCLIDE OBJECT DESCRIPTIONS 419

Chapter 5 : Rad ionuc l ide Ent i t y Re la t ionsh ips 441

• OVERVIEW 442

• RADIONUCLIDE TABLES 442

Chapter 6 : Rad ionuc l ide Tab le Descr ip t ions 455

• GARDS_ALERTS 456

• GARDS_AUTO_SAMPLE_CAT 457

• GARDS_AUX_LIB 458

• GARDS_AUX_LINES_LIB 459

• GARDS_B_ENERGY_PAIRS 460

• GARDS_B_ENERGY_PAIRS_ORIG 461

• GARDS_B_RESOLUTION_PAIRS 462

• GARDS_B_RESOLUTION_PAIRS_ORIG 463

• GARDS_BG_EFFICIENCY_PAIRS 464

• GARDS_BG_ENERGY_CAL 465

• GARDS_CAT_CRITERIA_TESTS 466

• GARDS_CAT_TEMPLATE 467

• GARDS_CODES 469

• GARDS_COMMENTS 470

• GARDS_COMMENTS_DEFS 471

• GARDS_CSC_MODCOEFF_LIB 472

• GARDS_DATA_LOG 473

• GARDS_DBROLE_OWNER 474

• GARDS_DETECTORS 475

• GARDS_DIST_SAMPLE_QUEUE 476

• GARDS_EFFICIENCY_CAL 477

• GARDS_EFFICIENCY_PAIRS 478

• GARDS_ENERGY_CAL 479

vi

TABLE OF CONTENTS

• GARDS_ENERGY_CAL_ORIG 481

• GARDS_ENERGY_PAIRS 483

• GARDS_ENERGY_PAIRS_ORIG 484

• GARDS_ENVIRONMENT 485

• GARDS_FLAGS 486

• GARDS_FPE 487

• GARDS_HISTOGRAM 488

• GARDS_INTERVAL 489

• GARDS_MDAS2REPORT 490

• GARDS_MET_DATA 491

• GARDS_NOTIFY 492

• GARDS_NUCL2QUANTIFY 493

• GARDS_NUCL_IDED 494

• GARDS_NUCL_IDED_ORIG 497

• GARDS_NUCL_LIB 499

• GARDS_NUCL_LINES_IDED 500

• GARDS_NUCL_LINES_IDED_ORIG 502

• GARDS_NUCL_LINES_LIB 504

• GARDS_PEAKS 505

• GARDS_PEAKS_ORIG 508

• GARDS_PERMISSIONS 511

• GARDS_POC 512

• GARDS_PROC_PARAMS_TEMPLATE 513

• GARDS_PROCESSING_ERRORS 516

• GARDS_QAT_CONFIG 517

• GARDS_QAT_NOTIFY 518

• GARDS_QAT_QUERY_FILTER 519

• GARDS_QCHISTORY 520

vii

TABLE OF CONTENTS

• GARDS_QCPARAMS 521

• GARDS_QCTARGETS 522

• GARDS_QUERY_RESULTS 523

• GARDS_READ_SAMPLE_STATUS 524

• GARDS_RECEIPT_LOG 525

• GARDS_REFLINE_MASTER 526

• GARDS_RELEVANT_NUCLIDES 527

• GARDS_RESOLUTION_CAL 528

• GARDS_RESOLUTION_CAL_ORIG 529

• GARDS_RESOLUTION_PAIRS 530

• GARDS_RESOLUTION_PAIRS_ORIG 531

• GARDS_RLR 532

• GARDS_ROI_CHANNELS 533

• GARDS_ROI_CONCS 534

• GARDS_ROI_COUNTS 535

• GARDS_ROI_LIB 536

• GARDS_ROI_LIMITS 537

• GARDS_ROLES 538

• GARDS_ROLES_PERMISSIONS 539

• GARDS_SAMPLE_AUX 540

• GARDS_SAMPLE_CAT 541

• GARDS_SAMPLE_CERT 542

• GARDS_SAMPLE_CERT_LINES 543

• GARDS_SAMPLE_DATA 544

• GARDS_SAMPLE_DESCRIPTION 546

• GARDS_SAMPLE_FLAGS 547

• GARDS_SAMPLE_PROC_PARAMS 548

• GARDS_SAMPLE_RATIOS 551

viii

TABLE OF CONTENTS

• GARDS_SAMPLE_STATUS 552

• GARDS_SAMPLE_UPDATE_PARAMS 553

• GARDS_SAMPLE_XE_PROC_PARAMS 554

• GARDS_SOH_CHAR_DATA 555

• GARDS_SOH_CODE 556

• GARDS_SOH_HEADER 557

• GARDS_SOH_NUM_DATA 558

• GARDS_SOH_SENSOR_DATA 559

• GARDS_SPECTRUM 560

• GARDS_STADET 561

• GARDS_STATION_ASSIGNMENTS 562

• GARDS_STATIONS 563

• GARDS_STATIONS_SCHEDULE 564

• GARDS_STATUS_HISTORY 565

• GARDS_TOTAL_EFFIC 566

• GARDS_TRENDVUE 567

• GARDS_UPDATE_PARAMS_TEMPLATE 568

• GARDS_UPDATE_REFLINES 569

• GARDS_USER_COMMENTS 570

• GARDS_USERENV 571

• GARDS_USERS 572

• GARDS_USERS_ROLES 573

• GARDS_XE_NUCL_LIB 574

• GARDS_XE_NUCL_LINES_LIB 575

• GARDS_XE_PROC_PARAMS_TEMPLATE 576

Chapter 7 : Rad ionuc l ide Co lumn Descr ip t ions 579

References 669

Glossary 673

ix

LIST OF FIGURES

FIGURE 1. SAMPLE ENTITY RELATIONSHIP 4

FIGURE 2. RELATIONSHIPS BETWEEN FUNDAMENTAL S/H/I TABLES 7

FIGURE 3. EVENT TABLE RELATIONSHIPS 9

FIGURE 4. DETAIL TABLES RELATED TO ARRIVAL 10

FIGURE 5. MEASUREMENT TABLE RELATIONSHIPS 11

FIGURE 6. EVENT CHARACTERIZATION TABLE RELATIONSHIPS 12

FIGURE 7. WAVEFORM TABLE RELATIONSHIPS 13

FIGURE 8. REFERENTIAL CORE TABLE RELATIONSHIPS 14

FIGURE 9. NETWORK TABLE RELATIONSHIPS 15

FIGURE 10. CHANNEL TABLE RELATIONSHIPS 16

FIGURE 11. RELATIONSHIPS OF TABLES USED IN AUTOMATIC PROCESSING 17

FIGURE 12. EVENT SCREENING TABLE RELATIONSHIPS 18

FIGURE 13. TABLES INVOLVED IN ANALYST REVIEW OF TIME-SERIES DATA 19

FIGURE 14. MAP TABLE RELATIONSHIPS 20

FIGURE 15. RELATIONSHIPS AMONG TABLES USED TO RECORD SPECTRUMS OF TIME-SERIES DATA 21

FIGURE 16. TABLES USED BY DISTRIBUTED PROCESSING APPLICATIONS 22

FIGURE 17. CONTINUOUS DATA SUBSYSTEM TABLE RELATIONSHIPS 23

FIGURE 18. MESSAGE SUBSYSTEM TABLE RELATIONSHIPS 24

FIGURE 19. SUBSCRIPTION SUBSYSTEM TABLE RELATIONSHIPS 25

FIGURE 20. MESSAGE AND SUBSCRIPTION SUBSYSTEM SUPPORT TABLES 26

FIGURE 21. DATA ARCHIVING SUBSYSTEM TABLES 27

FIGURE 22. TABLES USED BY SYSTEM MONITORING APPLICATIONS 28

FIGURE 23. TABLES USED FOR PERFORMANCE MONITORING 29

FIGURE 24. TABLES USED TO SUPPORT SCHEMA 30

FIGURE 25. TABLES USED TO DESCRIBE EXPLOSIONS 31

FIGURE 26. RADIONUCLIDE EQUIPMENT 443

FIGURE 27. RAW SENSOR DATA 444

FIGURE 28. RAW PULSE HEIGHT DATA 445

FIGURE 29. RAW PARTICULATE CALIBRATION DATA 446

x

LIST OF FIGURES

FIGURE 30. RAW NOBLE GAS DATA 447

FIGURE 31. CALCULATED PARTICULATE CALIBRATION DATA 448

FIGURE 32. CALCULATED PARTICULATE DETECTION AND CHARACTERIZATION DATA 449

FIGURE 33. PARTICULATE PARAMETER AND STATUS DATA 450

FIGURE 34. CALCULATED NOBLE GAS DETECTION DATA 451

FIGURE 35. NOBLE GAS PARAMETER AND STATUS DATA 452

FIGURE 36. ANALYST COMMENT DATA 453

FIGURE 37. MULTIPLE ANALYST REVIEW DATA 454

xi

LIST OF TABLES

TABLE 1: SYNTAX USED TO INDICATE DATABASE TABLE RELATIONSHIPS 3

TABLE 2: AFFILIATION (STANET) 34

TABLE 3: ALLOCATE_HOUR 35

TABLE 4: ALLOW_RESID 36

TABLE 5: ALPHASITE 37

TABLE 6: AMP3C 38

TABLE 7: AMPDESCRIPT 39

TABLE 8: AMPLITUDE 40

TABLE 9: APMA 42

TABLE 10: ARCH_DATA_TYPE 44

TABLE 11: ARRIVAL 45

TABLE 12: ASSOC (ASSOC_TEMP_GA) 47

TABLE 13: ATTENCOEF 49

TABLE 14: BEAMAUX 50

TABLE 15: BULL_COMP 51

TABLE 16: CEPPKS 53

TABLE 17: CHAN_GROUPS 54

TABLE 18: CHANNAME 55

TABLE 19: COLORDISC 56

TABLE 20: COMPLEXITY 57

TABLE 21: DATADAYS 58

TABLE 22: DATAREADY 59

TABLE 23: DATAUSER 60

TABLE 24: DETECTION 62

TABLE 25: DISCARD 64

TABLE 26: DLFILE 65

TABLE 27: DLMAN 67

TABLE 28: EV_SUMMARY (EX_SUMMARY, AN_SUMMARY) 68

TABLE 29: EVENT 70

TABLE 30: EVENT_CONTROL (IN_EVENT_CONTROL) 71

xii

LIST OF TABLES

TABLE 31: EVSC_HYDRO 73

TABLE 32: EVSC_PROD 74

TABLE 33: EVSC_REGIONAL 76

TABLE 34: EX_AN 78

TABLE 35: EXCEPTION_CHANMAP 80

TABLE 36: EXPLO 81

TABLE 37: FILEPRODUCT (FS_STAGEPRODUCT) 83

TABLE 38: FKDISC 84

TABLE 39: FORBEAMAUX 86

TABLE 40: FPDESCRIPTION 87

TABLE 41: FSAVE 88

TABLE 42: FSDISC 89

TABLE 43: FSRECIPE 91

TABLE 44: FSTAG 92

TABLE 45: FTPFAILED 93

TABLE 46: FTPLOGIN 94

TABLE 47: FWFILE 95

TABLE 48: FWGAP 96

TABLE 49: FWSITE 97

TABLE 50: GA_TAG 98

TABLE 51: GLOSSARY 99

TABLE 52: GREGION 100

TABLE 53: HYDRO_ARR_GROUP 101

TABLE 54: HYDRO_ASSOC 102

TABLE 55: HYDRO_FEATURES 103

TABLE 56: INFRA_FEATURES 105

TABLE 57: INSTRUMENT 107

TABLE 58: INTERVAL 108

TABLE 59: LASTID (PROBLASTID, RMS_LASTID) 109

TABLE 60: LOCATION 110

xiii

LIST OF TABLES

TABLE 61: MAPCOLOR 111

TABLE 62: MAPDISC 112

TABLE 63: MAPOVER 114

TABLE 64: MAPPOINT 115

TABLE 65: MIG_DATE 116

TABLE 66: MIG_RULES 117

TABLE 67: MSGAUX 118

TABLE 68: MSGDATATYPE 119

TABLE 69: MSGDEST 120

TABLE 70: MSGDISC 121

TABLE 71: NA_VALUE 123

TABLE 72: NETMAG 124

TABLE 73: NETWORK 125

TABLE 74: ORIGAUX 126

TABLE 75: ORIGERR (ORIGERR_TEMP_GA) 127

TABLE 76: ORIGIN (ORIGINREF, ORIGIN_TEMP_GA) 128

TABLE 77: OUTAGE 130

TABLE 78: OVERLAYDISC 131

TABLE 79: PARRIVAL 132

TABLE 80: PARTICIPATION 133

TABLE 81: PROBLEM 134

TABLE 82: PROBLEMLOG 135

TABLE 83: PROBLEMMAIL 136

TABLE 84: PRODTRACK 137

TABLE 85: PRODUCTCRITERIA 138

TABLE 86: PRODUCTTYPEEVSC 140

TABLE 87: PRODUCTTYPEORIGIN 142

TABLE 88: PRODUCTTYPESTA 144

TABLE 89: QCSTATS 145

TABLE 90: REBDONE_DATADAY_FLAG 147

xiv

LIST OF TABLES

TABLE 91: REF_LOC 148

TABLE 92: REGCOEF 149

TABLE 93: REMARK 150

TABLE 94: REQUEST 151

TABLE 95: REVAUDIT 153

TABLE 96: SCAN_DATE 154

TABLE 97: SEISGRID (DSEISGRID) 155

TABLE 98: SEISINDEX (DSEISINDEX) 156

TABLE 99: SENSOR 157

TABLE 100: SITE 159

TABLE 101: SITE_ADDRESS 160

TABLE 102: SITEAUX 161

TABLE 103: SITECHAN 162

TABLE 104: SITEPOLL 163

TABLE 105: SPLP 164

TABLE 106: SPVAR 165

TABLE 107: SREGION 166

TABLE 108: STAMAG 167

TABLE 109: STASSOC 169

TABLE 110: STD_CHANMAP 170

TABLE 111: SUBS 171

TABLE 112: SUBSUSER 172

TABLE 113: THIRDMOM 173

TABLE 114: TIMEFREQ 174

TABLE 115: TIMESTAMP 175

TABLE 116: WEIGHTS 176

TABLE 117: WFAUX 177

TABLE 118: WFCONV 178

TABLE 119: WFDISC (WFPROTO) 180

TABLE 120: WFTAG 182

xv

LIST OF TABLES

TABLE 121: XTAG 183

TABLE 122: GUIDELINES AND EXAMPLES OF NA VALUES 187

TABLE 123: DATABASE TABLE GROUPS 416

TABLE 124: RMSAUTO INDEXES 420

TABLE 125: RMSAUTO UNIQUE DATA CONSTRAINTS 422

TABLE 126: RMSAUTO PRIMARY KEY CONSTRAINTS 422

TABLE 127: RMSAUTO FOREIGN KEY CONSTRAINTS 422

TABLE 128: RMSAUTO COLUMN CONSTRAINTS 426

TABLE 129: RMSAUTO SYNONYMS 426

TABLE 130: RMSAUTO TRIGGERS 429

TABLE 131: RMSMAN INDEXES 434

TABLE 132: RMSMAN UNIQUE DATA CONSTRAINTS 435

TABLE 133: RMSMAN PRIMARY KEY CONSTRAINTS 435

TABLE 134: RMSMAN FOREIGN KEY CONSTRAINTS 436

TABLE 135: RMSMAN COLUMN CONSTRAINTS 438

TABLE 136: RMSMAN SEQUENCES 438

TABLE 137: RMSMAN SYNONYMS 439

TABLE 138: RMSMAN TRIGGERS 440

TABLE 139: GARDS_ALERTS 456

TABLE 140: GARDS_AUTO_SAMPLE_CAT 457

TABLE 141: GARDS_AUX_LIB 458

TABLE 142: GARDS_AUX_LINES_LIB 459

TABLE 143: GARDS_B_ENERGY_PAIRS 460

TABLE 144: GARDS_B_ENERGY_PAIRS_ORIG 461

TABLE 145: GARDS_B_RESOLUTION_PAIRS 462

TABLE 146: GARDS_B_RESOLUTION_PAIRS_ORIG 463

TABLE 147: GARDS_BG_EFFICIENCY_PAIRS 464

TABLE 148: GARDS_BG_ENERGY_CAL 465

TABLE 149: GARDS_CAT_CRITERIA_TESTS 466

TABLE 150: GARDS_CAT_TEMPLATE 467

xvi

LIST OF TABLES

TABLE 151: GARDS_CODES 469

TABLE 152: GARDS_COMMENTS 470

TABLE 153: GARDS_COMMENTS_DEFS 471

TABLE 154: GARDS_CSC_MODCOEFF_LIB 472

TABLE 155: GARDS_DATA_LOG 473

TABLE 156: GARDS_DBROLE_OWNER 474

TABLE 157: GARDS_DETECTORS 475

TABLE 158: GARDS_DIST_SAMPLE_QUEUE 476

TABLE 159: GARDS_EFFICIENCY_CAL 477

TABLE 160: GARDS_EFFICIENCY_PAIRS 478

TABLE 161: GARDS_ENERGY_CAL 479

TABLE 162: GARDS_ENERGY_CAL_ORIG 481

TABLE 163: GARDS_ENERGY_PAIRS 483

TABLE 164: GARDS_ENERGY_PAIRS_ORIG 484

TABLE 165: GARDS_ENVIRONMENT 485

TABLE 166: GARDS_FLAGS 486

TABLE 167: GARDS_FPE 487

TABLE 168: GARDS_HISTOGRAM 488

TABLE 169: GARDS_INTERVAL 489

TABLE 170: GARDS_MDAS2REPORT 490

TABLE 171: GARDS_MET_DATA 491

TABLE 172: GARDS_NOTIFY 492

TABLE 173: GARDS_NUCL2QUANTIFY 493

TABLE 174: GARDS_NUCL_IDED 494

TABLE 175: GARDS_NUCL_IDED_ORIG 497

TABLE 176: GARDS_NUCL_LIB 499

TABLE 177: GARDS_NUCL_LINES_IDED 500

TABLE 178: GARDS_NUCL_LINES_IDED_ORIG 502

TABLE 179: GARDS_NUCL_LINES_LIB 504

TABLE 180: GARDS_PEAKS 505

xvii

LIST OF TABLES

TABLE 181: GARDS_PEAKS_ORIG 508

TABLE 182: GARDS_PERMISSIONS 511

TABLE 183: GARDS_POC 512

TABLE 184: GARDS_PROC_PARAMS_TEMPLATE 513

TABLE 185: GARDS_PROCESSING_ERRORS 516

TABLE 186: GARDS_QAT_CONFIG 517

TABLE 187: GARDS_QAT_NOTIFY 518

TABLE 188: GARDS_QAT_QUERY_FILTER 519

TABLE 189: GARDS_QCHISTORY 520

TABLE 190: GARDS_QCPARAMS 521

TABLE 191: GARDS_QCTARGETS 522

TABLE 192: GARDS_QUERY_RESULTS 523

TABLE 193: GARDS_READ_SAMPLE_STATUS 524

TABLE 194: GARDS_RECEIPT_LOG 525

TABLE 195: GARDS_REFLINE_MASTER 526

TABLE 196: GARDS_RELEVANT_NUCLIDES 527

TABLE 197: GARDS_RESOLUTION_CAL 528

TABLE 198: GARDS_RESOLUTION_CAL_ORIG 529

TABLE 199: GARDS_RESOLUTION_PAIRS 530

TABLE 200: GARDS_RESOLUTION_PAIRS_ORIG 531

TABLE 201: GARDS_RLR 532

TABLE 202: GARDS_ROI_CHANNELS 533

TABLE 203: GARDS_ROI_CONCS 534

TABLE 204: GARDS_ROI_COUNTS 535

TABLE 205: GARDS_ROI_LIB 536

TABLE 206: GARDS_ROI_LIMITS 537

TABLE 207: GARDS_ROLES 538

TABLE 208: GARDS_ROLES_PERMISSIONS 539

TABLE 209: GARDS_SAMPLE_AUX 540

TABLE 210: GARDS_SAMPLE_CAT 541

xviii

LIST OF TABLES

TABLE 211: GARDS_SAMPLE_CERT 542

TABLE 212: GARDS_SAMPLE_CERT_LINES 543

TABLE 213: GARDS_SAMPLE_DATA 544

TABLE 214: GARDS_SAMPLE_DESCRIPTION 546

TABLE 215: GARDS_SAMPLE_FLAGS 547

TABLE 216: GARDS_SAMPLE_PROC_PARAMS 548

TABLE 217: GARDS_SAMPLE_RATIOS 551

TABLE 218: GARDS_SAMPLE_STATUS 552

TABLE 219: GARDS_SAMPLE_UPDATE_PARAMS 553

TABLE 220: GARDS_SAMPLE_XE_PROC_PARAMS 554

TABLE 221: GARDS_SOH_CHAR_DATA 555

TABLE 222: GARDS_SOH_CODE 556

TABLE 223: GARDS_SOH_HEADER 557

TABLE 224: GARDS_SOH_NUM_DATA 558

TABLE 225: GARDS_SOH_SENSOR_DATA 559

TABLE 226: GARDS_SPECTRUM 560

TABLE 227: GARDS_STADET 561

TABLE 228: GARDS_STATION_ASSIGNMENTS 562

TABLE 229: GARDS_STATIONS 563

TABLE 230: GARDS_STATIONS_SCHEDULE 564

TABLE 231: GARDS_STATUS_HISTORY 565

TABLE 232: GARDS_TOTAL_EFFIC 566

TABLE 233: GARDS_TRENDVUE 567

TABLE 234: GARDS_UPDATE_PARAMS_TEMPLATE 568

TABLE 235: GARDS_UPDATE_REFLINES 569

TABLE 236: GARDS_USER_COMMENTS 570

TABLE 237: GARDS_USERENV 571

TABLE 238: GARDS_USERS 572

TABLE 239: GARDS_USERS_ROLES 573

TABLE 240: GARDS_XE_NUCL_LIB 574

xix

LIST OF TABLES

TABLE 241: GARDS_XE_NUCL_LINES_LIB 575

TABLE 242: GARDS_XE_PROC_PARAMS_TEMPLATE 576

xx

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

A b o u t t h i s D o c u m e n t

This chapter describes the organization and content of the document and includes the following topics:

■ Purpose

■ Scope

■ Audience

■ Related Information

■ Using this Document

b e r 2 0 0 2 xxi

U s e r G u i d e sI D C D O C U M E N T A T I O N

xxii

A b o u t t h i s D o c u m e n t

P U R P O S E

This document describes the Prototype International Data Centre (PIDC) database schema. It is Revision 5 of Database Schema.

S C O P E

This document describes the schema used in the PIDC databases. The schema includes relationships between tables, table descriptions, and definitions of the table columns.

This document does not describe the specific location and general use of these tables at the PIDC or how to manipulate them to obtain information. Nor does it provide the for-mats for external file representations of the tables. These topics are described in sources cited in Related Information.

A U D I E N C E

This document is intended for software developers, engineers, scientists, processing operators, and anyone who needs to interact with the databases at the PIDC.

R E L A T E D I N F O R M A T I O N

This document supersedes [And90a], [Swa91], [Swa93], [Car97], [IDC5.1.1], [IDC5.1.1Rev1], and [IDC5.1.1Rev5].

External formats of all columns used with S/H/I data are described in “S/H/I Column Descriptions” on page 185, and most can also be found in [Car97].

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

▼Abou t th i s D oc ume n t

Tables used with specific application software are described in the software design docu-ments (for example, [IDC7.1.1], [IDC7.1.3], [IDC7.1.4], [IDC7.1.5], [IDC7.1.6], [IDC7.1.10Rev3], [IDC7.1.11], [IDC7.1.12], [IDC7.3.1], [IDC7.4.1], [IDC7.4.2], [IDC7.4.3], [IDC7.4.4], and [IDC7.5.1]).

The following documents provide information and instructions for retrieving data from the PIDC databases:

■ Database Tutorial [IDC5.1.2]

■ Configuration of PIDC Databases [IDC5.1.3Rev0.1]

See “References” on page R669 for a listing of all the sources of information consulted in preparing this document.

U S I N G T H I S D O C U M E N T

This document is part of the overall documentation architecture for the International Data Centre (IDC). It is part of the User Guides document category, which provides information relevant to understanding IDC processing.

This document is organized as follows:

■ Chapter 1: S/H/I Entity Relationships

This chapter describes the relationships between the S/H/I database tables.

■ Chapter 2: S/H/I Table Descriptions

This chapter describes each table in the S/H/I database schema (in alphabeti-cal order). It includes information about the category to which the table belongs, the columns included in the table, ORACLE storage types for each column, keys (primary, alternate, and foreign), and column categories (descriptive, measurement, or administrative).

■ Chapter 3: S/H/I Column Descriptions

This chapter provides detailed descriptions of the columns of the S/H/I data-base schema including the tables in which the columns may be found, a full description of the column, storage and external formats, NA values, units, and ranges.

xxiiib e r 2 0 0 2

xxiv

▼ Ab ou t t h i s Docum e n t

U s e r G u i d e sI D C D O C U M E N T A T I O N

■ Chapter 4: Radionuclide Database Overview

This chapter provides an overview of the radionuclide database tables through an organizational description of the tables.

■ Chapter 5: Radionuclide Entity Relationships

This chapter describes the relationships between the radionuclide database tables.

■ Chapter 6: Radionuclide Table Descriptions

This chapter describes each table in the radionuclide database schema (in alphabetical order). It includes information about the columns included in the table, ORACLE storage types for each column, and keys (primary, alternate, and foreign).

■ Chapter 7: Radionuclide Column Descriptions

This chapter provides detailed descriptions of the columns of the radionuclide database schema including the tables in which the columns may be found, a full description of the column, storage and external formats, NA values, units, and ranges.

■ References

This section lists the sources cited in this document.

■ Glossary

This section defines the terms, abbreviations, and acronyms used in this docu-ment.

C o n v e n t i o n s

This document uses a variety of conventions, which are described in the following tables. Table I shows the conventions for entity-relationship diagrams. Table II lists typographical conventions. Table III explains certain technical terms that are not part of the standard Glossary, which is located at the end of this document.

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

▼Abou t th i s D oc ume n t

TABLE I: ENTITY-RELATIONSHIP SYMBOLS

Description Symbol

One A maps to one B.

One A maps to zero or one B.

One A maps to many Bs.

One A maps to zero or many Bs.

database table

A B

A B

A B

A B

tablename

primary keyforeign key

attribute 1 attribute 2 … attribute n

xxvb e r 2 0 0 2

xxvi

▼ Ab ou t t h i s Docum e n t

U s e r G u i d e sI D C D O C U M E N T A T I O N

TABLE II: TYPOGRAPHICAL CONVENTIONS

Element Font Example

database tabledatabase table and column, when written in the dot notation

bold datareadyprodtrack.status

database columnsprocesses, software units, and librariesuser-defined arguments and variables used in parameter (par) files or program command linestitles of documentsBEA supplied server software (all CAPS)

italics statusParseSubs

delete-remarks object

Continuous Data SubsystemBRIDGE

computer code and outputfilenames, directories, and web sitestext that should be typed in exactly as shown

courier >(list ‘a ‘b ‘c)

ars.scm

edit-filter-dialog

TABLE III: TECHNICAL TERMS

Term Description

Data: Administrative database columns used for administrative purposes

Data: Descriptive database columns that are qualitative

Data: Measurement database columns that are quantitative

field database column

Keys: Alternate set of alternate database columns that uniquely define a row in a database table (unique key)

Keys: Foreign primary key in a different table

Keys: Primary set of database columns that uniquely define a row in a database table (unique key)

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

▼Abou t th i s D oc ume n t

D a t e s a n d T i m e s

The time column used throughout the S/H/I schema is stored as epochal time, the num-ber of seconds since January 1, 1970. Epochal time has a precision of one millisecond. Often time is matched by the more readable field, jdate. This “Julian date” represents a day in the form yyyyddd; for example, 1981231 where 1981 is the year (yyyy) and 231 is the day of year (ddd).

O r a c l e D a t a Ty p e s

The PIDC database uses four of the available ORACLE data types:

■ varchar2(n)

All character data in the database are defined to be varchar2(n) where n is the maximum number of characters in the string. varchar2 does not store trailing blanks.

■ number(n)

All integer fields in the database are defined to be number(n) where n is the maximum number of digits allowed in the field. Number may also be used without specifying the maximum number of digits.

■ float(n)

ORACLE supports the float(n) data type where n is the maximum number of binary digits. Float allows the approximation of single and double precision floats commonly used in scientific programming. The decimal point may be specified anywhere from the first to the last digit (or not at all). All real num-bers in the database are single precision float(24), except for epoch time fields such as time, endtime, and other time fields that are double precision float(53).

■ date

The only columns in the database that are declared to be the ORACLE date data type are the lddate, moddate, last_mig_date, offdate, ondate, and initialdatecolumns, which store the day and time a record was inserted into the database or last modified.

xxviib e r 2 0 0 2

xxviii

▼ Ab ou t t h i s Docum e n t

U s e r G u i d e sI D C D O C U M E N T A T I O N

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Chapter 1: S / H / I E n t i t y R e l a t i o n s h i p s

This chapter describes the relationships between selected tables for the PIDC database schema. The following topics are covered:

■ Overview

■ Fundamental Tables

■ Reference Tables

■ S/H/I Application Software Tables

b e r 2 0 0 2 1

U s e r G u i d e sI D C D O C U M E N T A T I O N

2

Chapter 1: S / H / I E n t i t y R e l a t i o n s h i p s

O V E R V I E W

This chapter contains entity-relationship diagrams that show the relationships among database tables for the IDC database schema. The diagrams include the table names, and, in most cases, the keys as well as the names of all of the columns. The table name is always shown at the top of the table symbol. Keys (if present) are shown below the table name. The primary key of a table is indicated with a black key symbol. An optional for-eign key is indicated with a white key symbol. Keys consisting of multiple columns are shown with a key symbol next to the first column of the key, and the remaining columns are listed beneath with no symbol. All column names (if present) are shown below the key section in the diagrams. Some of the key columns in the schema have been denor-malized for convenience and usability. For readability, relationships for denormalized keys are not shown. Furthermore, the primary key, commid, of the table remark is not explicitly drawn in the tables in which it appears as a foreign key.

C o l u m n R e l a t i o n s h i p s

Relationships between tables are usually indicated by naming the column or columns through which two tables are related. Table 1 explains the syntax used. In many cases the column names that must be compared in the two tables are not identical, or a column value in one table must be compared to more than one column value in another table. The delimiters in the syntax are the dash (-) and the slash (/). A dash (-) separates groups of column names from the two tables, and slashes (/) separate the columns that comprise the composite key. Other symbols, such as equal (=), vertical bar (|), ampersand (&), and brackets, specify how the columns are compared. Expressions within brackets in rela-tionships between tables are evaluated first. The order of operations is: =, |, and &.

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 1 :

S /H/ I En t i ty R e la t i ons h ips

TABLE 1: SYNTAX USED TO INDICATE DATABASE TABLE RELATIONSHIPS

Syntax Definition

col This is the simplest case where the column names (col) of the keys in the tables at each end of the relationship are the same. Both keys consist of a single column.

col1/col2 A slash (/) is used when a key is comprised of multiple columns. Here, the keys in both tables are the same and consist of two col-umns, col1 and col2.

col1-col2 A dash (-) is used when the column names of the keys in the two tables are not the same. Col1 is the name of the key column in one table. Col2 is the name of the key column in the other table. Each key consists of a single column. Only one dash may be used, and the dash separates the keys of the two tables. A dash can be com-bined with slash (/) to show that the keys consist of multiple col-umns and that one or more of the columns have different names in the two tables as in col1/col2-col3/col4 (both parts of the key are different in the two tables), or col1/col2-col1/col3 (only the second part of the key is different in the two tables).

col1-col2/col3=value An equals sign (=) is used when a component of a key must be set to a particular value. Here col1 is the name of the key column in one table. Col2 and col3 are the names of the key columns in the other table, and col3 must be set to the shown value. See the arid-tagid/tagname=arid relationship between arrival and wftag and orid-tagid/tagname=orid relationship between origin and wftag.

col1-col2 | col3 A vertical line (|) is used to show that the key in a table could be one of a set of columns. This is different from a key that consists of multiple columns. Here col1 corresponds to either col2 or col3. See the magid-mbid|msid|mlid relationship between netmag and origin.

col1-col2 & col3 An ampersand (&) is used to show that a key in one table must have a value between the values of two keys in another table. Here the value of col1 must be between the values of col2 and col3. See the sta/chan/time-sta/chan/time&endtime relationship between wfdisc and sensor.

3b e r 2 0 0 2

4

Chap te r 1 :

S /H/ I En t i t y Re la t ions h ip s

U s e r G u i d e sI D C D O C U M E N T A T I O N

The relationship shown in Figure 1, with table_1 columns on the left and table_2 col-umns on the right, demonstrates the possible relationships between the columns of two different tables. The syntax of Table 1 is used to interpret the relationships between the columns of table_1 and table_2 in Figure 1. Col8 in table_2 has no matching column in table_1 and must be equal to value in this relationship. All other columns have one or more corresponding columns in the other table. Following the syntax, col1 in table_1

must have the same value as col1 in table_2, col2 in table_1 must have a value between col4 and col5 in table_2, and col3 in table_1 must match either col6 or col7 in table_2 for the one-to-many relationship indicated by the entity-relationship symbol (Table I on page xxv) to be true.

FIGURE 1. SAMPLE ENTITY RELATIONSHIP

(col1)-(col2) Brackets () are used to show that the keys within them have differ-ent formats and a conversion must be made to make the compari-son. Here col1 corresponds to col2, but col1 and col2 have different storage formats (usually an epoch time versus a date). See the sta/chan/(time)-sta/chan/(ondate&offdate) relationship between sitechan and siteaux.

TABLE 1: SYNTAX USED TO INDICATE DATABASE TABLE RELATIONSHIPS (CONTINUED)

Syntax Definition

col1/col2/col3 - col1/(col4&col5)/col6|col7/col8=valuetable_1

col1col2col3

col1col2col3…

table_2

col1col4col5col6col7col8

col1col4col5col6col7col8…

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 1 :

S /H/ I En t i ty R e la t i ons h ips

Some of the entity-relationship diagrams show more than one relationship between two tables. For example, there are two relationships between the origin and event tables in Figure 2: a many-to-zero or many-to-one relationship through evid and a zero-to-one or one-to-one relationship through prefor-orid. The evid relationship states that for every origin entry, there is zero or one corresponding entry in event where the evid in origin

equals the evid in event, and for every event entry, there are many origin entries where the evid in event equals the evid in origin. The prefor-orid relationship states that for every origin entry, there is zero or one corresponding entry in event where the orid in origin

equals the prefor in event, and for every event entry, there is one origin entry where the prefor in event equals the orid in origin.

Ta b l e C a t e g o r i e s

The database tables of the schema are grouped into natural categories. The first category contains the fundamental tables used with S/H/I data. These tables are used by many applications and are frequently updated. The fundamental tables contain a smaller set called the core tables. The core tables, which have remained essentially unchanged for many years, have been widely adopted by other seismological organizations, and there-fore their definitions are virtually immutable. The relationships between the fundamental tables are shown in Figures 2 through 7.

Figures 8, 9, and 10 show the relationships of tables in the second category, referential tables for S/H/I data. These tables are read by many applications, but seldom if ever are the contents altered. Most of the data in these tables pertain to International Monitoring System (IMS) stations and seismic networks.

Relationships between tables used by only a few application programs are shown in 11 additional figures. These are further grouped according to the software configuration items of the software architecture. Figures 11 and 12 have tables associated with auto-matic processing; Figures 13, 14, and 15 have tables associated with interactive process-ing; and Figure 16 has tables associated with management of distributed processes. Figures 17 through 21 are related to the data services software; Figures 22 and 23 are used by system monitoring software; Figure 24 shows tables that facilitate use of the database; and finally, Figure 25 shows tables that contain information about historical explosions.

5b e r 2 0 0 2

6

Chap te r 1 :

S /H/ I En t i t y Re la t ions h ip s

U s e r G u i d e sI D C D O C U M E N T A T I O N

F U N D A M E N T A L TA B L E S

The fundamental tables have been part of seismic processing at the PIDC from its incep-tion. They hold data characterizing time-series signals as well as the collections of sig-nals that are associated with a particular origin or event.

Figure 2 summarizes the fundamental tables. In this figure, only the table names and keys are shown. Those tables that are part of the core set are labeled 3.0 core and 3.1 core, indicating previous versions of the schema [And90a], [Swa91], [Swa93]. Figure 3shows the tables that have data related to signal arrivals and the association of arrivals to origins and events. Additional data about signal arrivals are recorded in the tables shown in Figure 4, and Figure 5 shows tables holding data about source size.

Tables holding data used for event characterization are shown in Figure 6. Finally, Fig-ure 7 shows the relationships of tables that have information about the time-series data, which are themselves saved in conventional files.

S u m m a r y o f Ta b l e s a n d K e y s

Fundamental tables related to stored time series, detected signals, and relationships between signals and events are shown in Figure 2. This summary provides the table names, keys, and relationships, but each table is presented in its entirety in a subsequent figure.

Data from the IMS stations (wfdisc) are processed for detections (detection) from which arrivals and signal characteristics are extracted (amplitude, arrival, stassoc). The signals are used to infer event locations (assoc, event, netmag, origerr, origin, originref, parrival, stamag).

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 1 :

S /H/ I En t i ty R e la t i ons h ips

FIGURE 2. RELATIONSHIPS BETWEEN FUNDAMENTAL S/H/I TABLES

detection

statimearid

parrival

paridsta

timeoridevid

netmag

magidevidnet

orid

stamag

magidampid

staaridoridevid

amplitude

ampidarid

paridamptype

event

evidprefor

wfdisc

wfidsta

chantime

arrival

statimearid

stassidchanid

assoc

aridorid

origin

oridlatlon

depthtimeevid

mbidmsidmlid

stassoc

stassid

wftag

tagnametagidwfid origerr

orid

originref

oridlatlon

depthtimeevid

mbidmsidmlid

arid orid evid

arid-tagid/tagname=arid

orid-tagid/tagname=orid

3.0 core

3.0 core

3.0 core

3.0 core

3.0 core

3.0 core

3.0 core3.0 core

3.0 core

3.1 core

stassid

arid

arid

orid

orid

orid

wfid

magid

evid

evidampid

parid

prefor-orid

magid-mbid | msid | mlid

7b e r 2 0 0 2

8

Chap te r 1 :

S /H/ I En t i t y Re la t ions h ip s

U s e r G u i d e sI D C D O C U M E N T A T I O N

E v e n t

Figure 3 shows tables involved in forming origin hypotheses and events. Each table is part of the core set. Tables with information about event arrivals, location, origin time, and error are included. During automated processing, groups of arrivals from several sta-tions are associated with presumed events. The initial origin estimate for an individual station is contained in the stassoc table, which is related to the arrival table through stassid. Specific arrivals listed in the arrival table are associated with origins in the origin

table through the assoc table. An event may have several different origins, each of which is a different estimate. The preferred origin is indicated in the event table.

M e a s u r e m e n t s

The tables shown in Figures 4, 5, and 6 contain additional data about seismic and hydroacoustic signals and the magnitudes, locations, and characteristics of events. Most tables in this category lie outside the core set and are used by a smaller number of appli-cations.

Figure 4 shows tables that have detailed data about arrivals. Figure 5 shows tables related to the location, origin time, and size of an event.

The event characterization tables in Figure 6 include spvar, complexity, splp, thirdmom, timefreq, and ceppks. The spvar table contains arrival-based information and is related to the arrival table through arid. The other tables contain origin-based measurements and are related to origin through orid.

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 1 :

S /H/ I En t i ty R e la t i ons h ips

FIGURE 3. EVENT TABLE RELATIONSHIPS

arrival

statimearid

stassidchanid

statimearidjdatestassidchanidchaniphasestypedeltimazimuthdelazslowdelsloemarectampperlogatclipfmsnrqualauthcommidlddate

origerr

orid

oridsxxsyyszzsttsxysxzsyzstxstystzsdobssmajaxsminaxstrikesdepthstimeconfcommidlddate

assoc

aridorid

aridoridstaphasebeliefdeltaseazesaztimerestimedefazresazdefsloresslodefemareswgtvmodelcommidlddate

event

evidprefor

evidevnamepreforauthcommidlddate

origin

oridlatlon

depthtimeevid

mbidmsidmlid

latlondepthtimeoridevidjdatenassndefndpgrnsrnetypedepdpdtypembmbidmsmsidmlmlidalgorithmauthcommidlddate

stassoc

stassid

stassidstaetypelocationdistazimuthlatlondepthtimeimbimsimlauthcommidlddate

arid orid

orid

prefor-orid

stassid

evid

9b e r 2 0 0 2

10

Chap te r 1 :

S /H/ I En t i t y Re la t ions h ip s

U s e r G u i d e sI D C D O C U M E N T A T I O N

FIGURE 4. DETAIL TABLES RELATED TO ARRIVAL

apma

apmaridarid

phasearidfreqsnramppampsamplrrectplansplanlrhvratphvrathmxmninang3seazpseazsseazlrinang1ptimestimeauthapmaridcommidlddate

arrival

infra_features

arid

arideng_timeeng_dureng_deldurcoh_timecoh_durcoh_deldurcoinc_timecoinc_durcoinc_deldurfordzrcr_freqzrcr_delfreqcrnr_freqcrnr_delfreqcoh_percoh_snrtotal_energyauthcommidlddate

amp3c

aridrid

aridcfreqvampvsnrhamphsnrhtovridlddate

detection

statimearid

aridjdatestatimechanbmtypsproidcfreqseazdelazslowdelslosnrstavfstatdeltimbandwfkqualcommidlddate

hydro_features

arid

aridpeak_timepeak_leveltotal_energymean_arrival_timetime_spreadonset_timetermination_timetotal_timenum_crossave_noiseskewnesskurtosiscep_var_signalcep_delay_time_signalcep_peak_std_signalcep_var_trendcep_delay_time_trendcep_peak_std_trendlow_cuthigh_cutfordftypefzpprob_weight_timesigma_timelddate

aridarid

arid arid

arid

hydro_arr_group

hydro_idnet

hydro_idaz1az2slowdelaznhydarrnethyd_grp_phaselddate

hydro_assoc

aridhydro_id

aridhydro_idazcontriblddate

hydro_id

arid

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 1 :

S /H/ I En t i ty R e la t i ons h ips

FIGURE 5. MEASUREMENT TABLE RELATIONSHIPS

amplitude

ampidarid

paridamptype

ampidaridparidchanamppersnramptimestart_timedurationbandwamptypeunitsclipinarrivalauthlddate

stamag

magidampid

staaridoridevid

magidampidstaaridoridevidphasedeltamagtypemagnitudeuncertaintymagresmagdefmmodelauthcommidlddate

netmag

magidevidnet

orid

magidnetoridevidmagtypenstamagnitudeuncertaintyauthcommidlddate

arrival assoc origin event

ampdescript

amptype

amptypetofftlengvlogvhimtypedescrlddate

parrival

paridsta

timeoridevid

paridoridevidstatimeazimuthslowphasedeltavmodellddate

originref

oridlatlon

depthtimeevid

mbidmsidmlid

oridlatlondepthtimeevidmbidmlidmsidndefndpgrnsrnetypedepdpdtypembmsmlalgorithmauthcommidlddate

arid

arid

ampid magid evid

evid

evid

orid

orid

orid

magid-mbid |msid |mlid

prefor-orid

paridamptype

11b e r 2 0 0 2

12

Chap te r 1 :

S /H/ I En t i t y Re la t ions h ip s

U s e r G u i d e sI D C D O C U M E N T A T I O N

FIGURE 6. EVENT CHARACTERIZATION TABLE RELATIONSHIPS

Wa v e f o r m s

The waveform tables include wfdisc, wfaux, and wftag (see Figure 7). The wfdisc table is related to most other tables through the wftag table. However, sta, chan, and time are more frequently used to link the arrival and wfdisc tables directly.

complexity

oridsta

phase

oridstaphaserectypecomplexitysnrlddate

spvar

aridfminfmaxfsid

aridfsidacoefbcoefccoeffminfmaxsvarlddate

splp

oridsta

oridstarectyperatiolddate

arrival assoc origin

ceppks

oridsta

ptyp

oridstaptyppkamppkqflddate

thirdmom

arid

aridstarectypetmftmfpctlddate

timefreq

oridsta

oridstarectypezavpctnavpcteavpctxavpctzavcepnavcepeavcepzavcornavcoreavcorxcorlddate

arid

arid

orid

orid

oridarid

orid

orid

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 1 :

S /H/ I En t i ty R e la t i ons h ips

FIGURE 7. WAVEFORM TABLE RELATIONSHIPS

R E F E R E N C E TA B L E S

The reference tables are fairly static and primarily contain look-up information. Figure 8is an overview of the tables in this category. As with Figure 2, no column names are pro-vided, and tables in the core set are noted. Tables shown by name only are core tables that were previously shown in Figure 2.

N e t w o r k

Figure 9 shows tables related to networks, which are collections of stations across wide geographic areas. Network tables include information on the names of the networks, the stations included in them, the participation of the stations in the network, and geographic and seismic region information.

wfaux

wfid

wfidlength

arrival

wfdisc

stachantimewfid

chanid

stachantimewfidchanidjdateendtimensampsampratecalibcalperinstypesegtypedatatypeclipdirdfilefoffcommidlddate

wftag

tagnametagidwfid

tagnametagidwfidlddate

origin

wfid

wfid

orid-tagid/tagname=oridarid-tagid/tagname=arid

msgdisc

msgid-tagid/tagname=msgid

13b e r 2 0 0 2

14

Chap te r 1 :

S /H/ I En t i t y Re la t ions h ip s

U s e r G u i d e sI D C D O C U M E N T A T I O N

FIGURE 8. REFERENTIAL CORE TABLE RELATIONSHIPS

site

staondate

affiliation

netsta

network

net

stassoc arrival assoc origin

gregion

grn

site_address

sta

participation

netsta

sregion

srn

sitechan

stachan

ondatechanid

sensor

stachantime

endtimeinid

chanid

instrument

inid

wfdisc wftag arrival amplitude

siteaux

stachantime

3.0 core

3.0 core

3.0 core

3.0 core

3.0 core 3.0 core3.0 core3.0 core

sta

sta

sta sta

sta/ondate

sta

stassid arid orid

srngrn

net

net

aridwfid

chanid

sta/chan

sta/chan/time- sta/chan/time-

sta/chan/(time)-

inid

sta/chan/jdate-

arid-tagid/tagname=arid

sta/chan/time&endtime sta/chan/time&endtime

sta/chan/(ondate&offdate)

sta/chan/ondate&offdate

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 1 :

S /H/ I En t i ty R e la t i ons h ips

FIGURE 9. NETWORK TABLE RELATIONSHIPS

C h a n n e l

Figure 10 shows tables that contain specific information about the data channels of the IMS stations. Instrument response information is identified in the instrument table. The sensor table is linked to it through inid and from there to wfdisc and amplitude through sta/chan/time. General data characteristics for any data channel are in siteaux.

affiliation

netsta

netstalddate

site

staondate

staondateoffdatelatlonelevstanamestatyperefstadnorthdeastlddate

network

net

netnetnamenettypeauthcommidlddate

stassoc arrival assoc origin

site_address

sta

stanamelocalitystat_provcountrylddate

participation

netsta

netstabegin_dateend_datelddate

sregion

srn

srnsrnamelddate

gregion

grn

grngrnamelddate

sta stasta

sta

sta

sta

net

net

oridstassid

srn grn

arid

15b e r 2 0 0 2

16

Chap te r 1 :

S /H/ I En t i t y Re la t ions h ip s

U s e r G u i d e sI D C D O C U M E N T A T I O N

FIGURE 10. CHANNEL TABLE RELATIONSHIPS

S / H / I A P P L I C A T I O N S O F T W A R E TA B L E S

The tables shown in this section are used by fewer applications than those previously described. The tables are organized by computer software configuration items (CSCIs).

A u t o m a t i c P r o c e s s i n g

The event_control table is used by the event location and magnitude programs to pre-serve the values of key parameters that analysts set while reviewing the bulletin (see Fig-ure 11), and it is also used in post-analysis processing. The seisgrid and seisindex hold historical seismicity data. The tables are also used by event quality control software.

sitechan

stachan

ondatechanid

stachanondatechanidoffdatectypeedepthhangvangdescriplddate

siteaux

stachantime

stachantimenoisnoissdamcoramcorsdsnthrshrelyptmcorstmcorstaperauthcommidlddate

sensor

stachantime

endtimeinid

chanid

stachantimeendtimeinidchanidjdatecalratiocalpertshiftinstantlddate

site wfdisc amplitude

instrument

inid

inidinsnameinstypebanddigitalsampratencalibncalperdirdfilersptypelddate

sta/ondate

sta/chan

sta/chan/time-

chanid

inid

sta/chan/jdate-sta/chan/ondate&offdate

sta/chan/time&endtimesta/chan/time-sta/chan/time&endtime

sta/chan/(time)-sta/chan/(ondate&offdate)

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 1 :

S /H/ I En t i ty R e la t i ons h ips

FIGURE 11. RELATIONSHIPS OF TABLES USED IN AUTOMATIC PROCESSING

Event Screening Subsystem uses the tables shown in Figure 12.

event_control

evidorid

oridevidprefer_locconstrain_otconstrain_latlonconstrain_depthsrc_dpnt_corrloc_src_dpnt_regloc_sdv_screenloc_sdv_multloc_alpha_onlyloc_all_stasloc_dist_varwgtmag_src_dpnt_regmag_sdv_screenmag_sdv_multmag_alpha_onlymag_all_stasmb_min_distmb_max_distmmodelcov_sm_axescov_depth_timelddate

event origin

seisgrid

grdnameicell

grdnameicellmagthmagtypenevyrlddate

seisindex

grdname

grdnamelat1lon1dlatdlonnlatnlonorderbylddate

grdname

evid orid

allow_resid

phasemindelta

statype

phasemindeltamaxdeltastatypetimeresazressloreslddate

arrival

ga_tag

objtypeid

state

objtypeidstate

arid-id/objtype=a

orid-id/objtype=o

17b e r 2 0 0 2

18

Chap te r 1 :

S /H/ I En t i t y Re la t ions h ip s

U s e r G u i d e sI D C D O C U M E N T A T I O N

FIGURE 12. EVENT SCREENING TABLE RELATIONSHIPS

evsc_regional

oridsta

chan

oridstachandeltapnsmaxpnsmax_corrpnsmax_errpnsnpnlgpn_snrsn_snrlg_snrpnsn_qualpnlg_quallddate

origin

evsc_hydro

oridsta

oridstacp_broad_bandsnr_high_bandnoise_high_bandlddate

orid orid orid

evsc_prod

prodidorid

prodidoridscoredscoremscorerscorehscoredepthdeptherrmoveout_ppmoveout_spmin_dt_ppmin_dt_spndp_snr_ppndp_snr_spmbmsmbmserrmbmsnsta_mbnsta_mssmaj_scsmin_scstrikepctoffshmin_wdepthclrpthconsiderlddate

producttypeevsc

attencoef

attenidsta

ratiotypechan

attenidstaratiotypechanxcoefycoefzcoefdmindmaxlddate

regcoef

rcoefidrcoeftype

rcoefidrcoeftypercoefvalueondateoffdatelddate

parrival

sta/delta-sta/dmin&dmax

producttypeorigin

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 1 :

S /H/ I En t i ty R e la t i ons h ips

I n t e r a c t i v e P r o c e s s i n g

The tables in this group support the work of S/H/I data analysts, but they are not linked to any of the core tables. Figure 13 shows tables involved in scheduling the work of ana-lysts and recording progress. Figure 14 shows tables for the Map application. The tables have information about the base maps, as well as overlays and colors.

Interactive analysis frequently includes calculation of frequency spectrums and frequency-wave number spectrums. Figure 15 shows tables that record the results of these calculations.

FIGURE 13. TABLES INVOLVED IN ANALYST REVIEW OF TIME-SERIES DATA

allocate_hour

jdatehour

action

jdatehouractionauthcommidlddate

datadays

jdate

jdatetimeendtimelddate

scan_date

jdate

jdatescan

discard

evid

evidreasonauthlddate

rebdone_dataday_flag

dataday

datadaystatedonetimelddate

originevid

jdate-dataday

revaudit

revidrevtagid1

revtagname1revtagid2

revtagname2

revidrevfunctionauthrevtagid1revtagname1revtagid2revtagname2revstatelddate

arrival

stamag netmag

revtagid/revtagname=orid-orid

revtagid/revtagname=arid-arid

revtagid/revtagname=magid-magid

19b e r 2 0 0 2

20

Chap te r 1 :

S /H/ I En t i t y Re la t ions h ip s

U s e r G u i d e sI D C D O C U M E N T A T I O N

FIGURE 14. MAP TABLE RELATIONSHIPS

colordisc

colormapid

colormapiddfiledircolormapnamelddate

mapcolor

mapidcolormapid

mapidcolormapidlddate

mapdisc

mapid

mapidmapnamedfiledirmaptypemapfiletypeprojectiondimxdimyreflonreflatrefoffsetlonrefoffsetlatlonorigradianslatorigradiansscalerotationlatminorlatmajorlonminorlonmajorbordercolorlabelgctp1gctp2gctp3gctp4gctp5gctp6gctp7gctp8gctp9gctp10gctp11gctp12gctp13gctp14gctp15lddate

mappoint

latlon

mptype

latlonmplabelmptypempdescriplddate

overlaydisc

overlayid

overlayidoverlaynamedfiledircolornamelddate

mapover

mapidoverlayid

mapidoverlaidlddate

mapid

mapid

overlayid

colormapid

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 1 :

S /H/ I En t i ty R e la t i ons h ips

FIGURE 15. RELATIONSHIPS AMONG TABLES USED TO RECORD SPECTRUMS OF TIME-SERIES DATA

D i s t r i b u t e d P r o c e s s i n g

The Distributed Processing CSCI has software that manages jobs and orchestrates the workflow. Two tables (shown in Figure 16) are used by this software as well as by some of the data services applications.

fkdisc

fkidarid

jdatetimetlenstafktyparidmaxkxmaxsxnxmaxkymaxsynycfreqbandwcommidfkridfkiddatswfoffdirdfilelddate

fsdisc

fsidchanid

wfidfsridarid

fsidchanidwfidfsridaridjdatetimetlenstachanfstypemaxfnfdatatypedirdfilefoffcommidlddate

fsave

afsidavtypefstype

sta

staavtypefstypemaxfnfnaveafsidnoissddatatypedirdfilefoffforidcommidlddate

arrival wftag wfdisc

fstag

afsidfsid

afsidfsidlddate

fsrecipe

fsrid

fsridfsdesctapertaperstarttaperendwinlenoverlapnfftsmoothvalueresponselddate

wfid

afsid

wfid

fsrid

arid

fsid

sta/chan/time-sta/chan/time&endtime

arid-tagid/tagname=arid

21b e r 2 0 0 2

22

Chap te r 1 :

S /H/ I En t i t y Re la t ions h ip s

U s e r G u i d e sI D C D O C U M E N T A T I O N

FIGURE 16. TABLES USED BY DISTRIBUTED PROCESSING APPLICATIONS

D a t a S e r v i c e s

The Data Services CSCI has software to receive and forward continuous time-series data, software of the Message and Subscription Subsystems, and software used to archive time-series data.

Figure 17 shows relationships between tables of the Continuous Data Subsystem. These hold data about computers from which data are provided, computers on which data are stored for processing, and computers to which data are forwarded. Tables are also used by applications that ensure the integrity and completeness of forwarded data.

interval

classnametime

endtimeintvlid

intvlidclassnametimeendtimestatemoddatelddate

timestamp

proclassprocname

procclassprocnametimelddate

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 1 :

S /H/ I En t i ty R e la t i ons h ips

FIGURE 17. CONTINUOUS DATA SUBSYSTEM TABLE RELATIONSHIPS

outage

otgidsta

chantime

endtime

otgidstachanauxidtimeendtimestatusauthavailablecommidlddate

alphasite

staaddress

dlid

staaddressprefdlidprefportdlidtimecommidlddate

dlman

dlid

dlidmachinerunningconnmanportcontrolportarchiveportforwardportcommidlddate

wfconv

stachan

chanid

stachanchanidinauthincompintypeinsampoutauthoutcompouttypeoutsampstripcommidlddate

dlfile

dirdfiledfid

chaniddlid

dirdfilemachinepartitiondfidinloopfullarchivedlengthtlentimereaptimestachanchaniddlidcommidlddate

fwsite

ndcpriority

ndcmachineportprioritylddate

fwfile

standc

fwhidfwfidndcstamaxtimedirdfiledfilesizelddate

dlid dlid chanid

ndc

channame

extern_staextern_chan

intern_staintern_chan

intern_chanid

extern_staextern_chanextern_authintern_staintern_chanintern_chanidcommidlddate

chanid-intern_chanid

sitechan

stachan

ondatechanid

sta/chan-intern_sta/intern_chan

23b e r 2 0 0 2

24

Chap te r 1 :

S /H/ I En t i t y Re la t ions h ip s

U s e r G u i d e sI D C D O C U M E N T A T I O N

Figure 18 shows relationships between tables of the Message Subsystem. These tables are used by applications that receive and reply to AutoDRM requests and that make requests for seismic data from stations in the auxiliary network.

FIGURE 18. MESSAGE SUBSYSTEM TABLE RELATIONSHIPS

msgdisc

msgidintid

userid

msgiduseridmsgvermsgtypesubtypeextmsgidintidintidtypemsgsrcitimeidateimethodisrcmsizestatussubjectdirdfilefoffmfofffileofffilesizesigtypeverifstatuscommidlddate

msgdest

msgdidmsgid

msgdidmsgidtransmethemailtostatusitimestimelddate

msgdatatype

msgidfoff

msgidmsgdtypemsgdformatstatusfoffmsizelddate

msgaux

msgidmsgrow

state_count

msgidmsgrowstate_countcommandsub_statuslddate

request

reqidsta

chanstart_timeend_time

oridevid

reqidstachanarrayoridevidstart_timeend_timeclassstatestatecountcompleterequestormodtimemodauthorlddate

ftpfailed

msgidftp_address

msgidnumfailedattemptlastfailedtimeftp_addressstatuslddate

ftplogin

ftp_address

ftp_addressusernamepasswordlddate

msgid

msgid

msgid

intid/intidtype=reqid-reqid

ftp_address

msgid

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 1 :

S /H/ I En t i ty R e la t i ons h ips

Figure 19 shows tables used by the Subscription Subsystem, which notes when products are ready, maintains subscriptions, and tracks subscription processing.

FIGURE 19. SUBSCRIPTION SUBSYSTEM TABLE RELATIONSHIPS

subsuser

userid

useridusernamedomainstatuspocidprioritylddate

subs

prodiduseriduseridprodid

useridintidintidtypesubsidsubsnameprodidaddressdeliv_methstatusondateoffdateinitialdatelddate

productcriteria

prodid

prodidprodnamedelividcycle_sizecycle_timehour_to_senddow_to_senddom_to_sendprodtypeprodsubtypeprodfmtsupress_emptytimelastsendtimenextsendlddate

dataready

dataid

dataidtablenameaccounttagnametagidtagid2data_infostatuslddate

prodtrack

prodiddataidmsgiddataidmsgid

prodiddelividdataidmsgidstatuslddate

msgdisc

msgidintid

userid

producttypesta

prodidsta

chanfpdescription

typeid

typeidprodtypenamemsgdtypemsgdformatheader_fpidlddate

producttypeorigin

prodid

msgiddelivid-intid

userid

dataidprodid

prodid

fileproduct

fpidtypeid

fpidtypeiddirdfilefoffdsizetimeendtimestachanauthorversionrevisionobsoletelddate

typeid

prodid

producttypeevsc

prodid

25b e r 2 0 0 2

26

Chap te r 1 :

S /H/ I En t i t y Re la t ions h ip s

U s e r G u i d e sI D C D O C U M E N T A T I O N

The datauser table supports both the Message and Subscription Subsystems. The std_chanmap and exception_chanmap tables are used by the Message Subsystem (Auto-DRM) and in Performance Monitoring (stacap) to map external channel names to chan-nel names used internally (Figure 20).

FIGURE 20. MESSAGE AND SUBSCRIPTION SUBSYSTEM SUPPORT TABLES

The tables of the data archiving subsystem contain information used by the software subsystems that migrate database tables between databases and that migrate time-series data to the mass-storage device (see Figure 21).

subsuserdatauser

useridpocid

useridpocidusernamedomainmsgtypestatusprioritycommidemaillimitservicetimelddate

userid

exception_chanmap

staext_chanint_chan

staext_chanint_chanondateoffdatelddate

std_chanmap

ext_chanint_chan

ext_chanint_chanondateoffdatelddate

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 1 :

S /H/ I En t i ty R e la t i ons h ips

FIGURE 21. DATA ARCHIVING SUBSYSTEM TABLES

S y s t e m a n d P e r f o r m a n c e M o n i t o r i n g

The tables of the System Monitoring CSCI track the state of the hardware and software as well as the quality of the scientific results. Xlogger is used to record problems discov-ered in the system. The sitepoll table is a list of auxiliary seismic stations and channels that are regularly “polled” to determine their availability. System and performance mon-itoring applications tables are displayed in Figure 22.

mig_date

procclassprocname

procclassprocnamelast_mig_datelddate

mig_rules

task_numquery_type

src_tbl

task_numquery_typesrcsrc_tbldestdest_tblquery_seq_noseq_typeseq_contents

arch_data_type

archid

archiddatatypetable_nameprimarykeysecondkeymerge_adjacentnote_missing_dataondateoffdatelddate

chan_groups

classname

classnamestachandurationinwfactivityondateoffdatelddate

interval

classnametime

endtimeintvlid

class/name

weights

phasestatype

net

phasestatypenettweightaweightsweightondateoffdatelddate

27b e r 2 0 0 2

28

Chap te r 1 :

S /H/ I En t i t y Re la t ions h ip s

U s e r G u i d e sI D C D O C U M E N T A T I O N

FIGURE 22. TABLES USED BY SYSTEM MONITORING APPLICATIONS

Figure 23 displays tables that hold data pertinent to monitoring scientific performance. The bull_comp table (used by an application of the same name) compares event origins first estimated by automatic analysis against origins finally accepted by analysts. In the figure, the origin table on the left exists in the database account for automatic processing, and the origin table on the right exists in the account for interactive processing. The orig-

inaux table holds data that are in bulletins provided by other organizations, but do not fit elsewhere in the schema. The three tables at the bottom of the figure are used by other evaluation applications.

sitepollstanet

chan

stanetchanlddate

problemlog

plidprid

plidpridtimedirdfileloginlddate

problemmail

procclasslogin

procclassloginlddate

problem

prid

pridprocclassprocnametimeendtimestatusclassdescriploginlddate

procclass prid

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 1 :

S /H/ I En t i ty R e la t i ons h ips

FIGURE 23. TABLES USED FOR PERFORMANCE MONITORING

bull_comp

orid1orid2

orid1orid2ddistddepthdtimendef1ndef2dndefnarr1narr2dnarrnmatchndef1arr2ndef2arr1asstrlddate

ex_an

forideorid

forideoridddistddepthdtimediddnstadlstadastadrstadtstadndefdprimpdsecondpddepthprprimprsecondprdepthpaddedretimesplitevmultevkbscauselddate

ev_summary

oridgrn

refid

oridnearstaneardistnearazrefidrefdistrefazgrnnstalstaastarstatstandefadefprimpsecondpdepthplddate

origin origin

ref_loc

refid

refidrefnamelatlondescriplddate

origaux

oridevid

eventotfixfepfixfnstagapindentmindistmaxdistantypeevidtoridlddate

refid

oridorid

orid-eorid

orid-orid1 orid-orid2

orid-forid qcstats

qcstatsidsta

chantime

endtime

qcstatsidstachantimejdateendtimedettimedetendtimemissingdroppednsegmaskedpointspikespikenconstsegconstavgconstvalstdconstvalauthlddate

wfdisc

sta/chan/time - sta/chan/time & endtime

29b e r 2 0 0 2

30

Chap te r 1 :

S /H/ I En t i t y Re la t ions h ip s

U s e r G u i d e sI D C D O C U M E N T A T I O N

D a t a b a s e S u p p o r t

Several tables facilitate use of the database (see Figure 24). The remark table holds text comments for all tables in the schema. Lastid is used by all applications that require unique values for surrogate keys. Na_value specifies not-available values for many col-umns of the schema.

FIGURE 24. TABLES USED TO SUPPORT SCHEMA

H I S T O R I C A L D A T A TA B L E S

Historical explosion data are kept in tables that describe the locations, times, sizes, names, and other information about the explosions.

remark

commidlineno

commidlinenoremarklddate

lastid

keyname

keynamekeyvaluelddate

xtag

thisidthisname

thisidthatidthisnamethatnamethisdbthatdblddate

na_value

attribute

attributena_value

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 1 :

S /H/ I En t i ty R e la t i ons h ips

FIGURE 25. TABLES USED TO DESCRIBE EXPLOSIONS

explo

oridevid

locid

oridevidnameelevyieldyldmaxmediummoistwaterdepthpaleodepthcol_intervalcol_diametercol_depthcol_volumetestsiteexpcodeexptypelocidauthcommidlddate

location

locidlatlon

elevdepth

locnamesublocnamelocidlatlontdepthelevdescripauthcommidlddate

glossary

abbrev

abbrevabbrevtypelinenodescripdirdfilelddate

origin eventevid

orid-prefor

locid

oridevid

orid-prefor

31b e r 2 0 0 2

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Chapter 2: S / H / I Ta b l e D e s c r i p t i o n s

This chapter describes the tables that comprise the PIDC S/H/I Schema and defines the physical structure of each table as it exists within the ORACLE data dictionary. Brief descriptions of the columns are provided for convenience. “Chapter 3: S/H/I Column Descriptions” on page 185 contains detailed descriptions of the columns.

b e r 2 0 0 2 33

U s e r G u i d e sI D C D O C U M E N T A T I O N

34

Chapter 2: S / H / I Ta b l e D e s c r i p t i o n s

A F F I L I A T I O N , S T A N E T

The affiliation table groups stations into networks. The stanet table groups array sites into an array “network.”

Category: Core, Reference

Keys: Primary net/sta

Data: Descriptive net, sta Administrative lddate

TABLE 2: AFFILIATION (STANET)

Column Storage Type Description

1 net varchar2(8) unique network identifier

2 sta varchar2(6) station identifier

3 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

A L L O C A T E _ H O U R

The allocate_hour table is used by the analyst_log application to manage analyst sched-ules.

Category: Interactive Processing

Keys: Primary jdate/hour/action Foreign commid

Data: Descriptive action, auth Measurement jdate, hour Administrative lddate

TABLE 3: ALLOCATE_HOUR

Column Storage Type Description

1 jdate number(8) Julian date

2 hour number(2) starting hour of analysis

3 action varchar2(16) analyst task

4 auth varchar2(16) name of analyst

5 commid number(8) comment identification

6 lddate date load date

35b e r 2 0 0 2

36

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

A L L O W _ R E S I D

The allow_resid table contains the allowable maximums for the absolute values of resid-uals for time, azimuth, and slowness. The allowed residuals are a function of phase type and station type (single station or array), and for each of these, the allowed residuals may vary for different distance ranges. A negative value for the residual indicates an arrival field that is not permitted to be defining for that phase, statype, and distance range.

Category: Automatic Processing

Keys: Primary phase/mindelta/statype

Data: Descriptive phase, statype Measurement mindelta, maxdelta, timeres, azres, slores Administrative lddate

TABLE 4: ALLOW_RESID

Column Storage Type Description

1 phase varchar2(8) associated phase

2 mindelta float(24) minimum station to event distance

3 maxdelta float(24) maximum station to event distance

4 statype varchar2(4) station type: single station, array

5 timeres float(24) time residual

6 azres float(24) azimuth residual

7 slores float(24) slowness residual

8 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

A L P H A S I T E

The alphasite table is used for tracking continuous data connections by the DLMan appli-cation. For a given station, there must be a row in the table for each address from which the station may send continuous data. Prefdlid and prefport describe the preferred DLManconnection for the station. DLMan fills in dlid and time while a station is actively con-nected. Dlid indicates to which dlid the station is currently connected (may be different from prefdlid), and time is the system time for the last activity on the station’s connection (not the time of any data received). For stations that are not connected, time and dlid are zero (0).

Category: Data Services

Keys: Primary sta/address Foreign dlid, commid

Data: Descriptive sta, address, prefdlid, prefport, dlid Measurement time Administrative lddate

TABLE 5: ALPHASITE

Column Storage Type Description

1 sta varchar2(6) station code

2 address varchar2(16) source internet address

3 prefdlid number(8) dlid for preferred DLMan

4 prefport number(6) preferred network port

5 dlid number(8) dlid handling station

6 time float(53) clock time of most recent activity

7 commid number(8) comment identifier

8 lddate date load date

37b e r 2 0 0 2

38

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

A M P 3 C

The amp3c table contains amplitude measurements made on three-component data for a specific detection.

Category: Fundamental

Keys: Primary arid/rid

Data: Descriptive rid Measurement cfreq, vamp, vsnr, hamp, hsnr, htov Administrative lddate

TABLE 6: AMP3C

Column Storage Type Description

1 arid number(8) arrival identifier

2 cfreq float(24) center frequency of filter band amplitude is measured on

3 vamp float(24) vertical amplitude

4 vsnr float(24) vertical signal-to-noise ratio

5 hamp float(24) horizontal amplitude

6 hsnr float(24) horizontal signal-to-noise ratio

7 htov float(24) horizontal to vertical amplitude ratio

8 rid varchar2(8) recipe identifier

9 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

A M P D E S C R I P T

The ampdescript table contains descriptions of how amplitude measurements in ampli-

tude were made.

Category: Fundamental

Keys: Primary amptype

Data: Descriptive amptype, mtype, descr Measurement toff, tlen, gvlo, gvhi Administrative lddate

TABLE 7: AMPDESCRIPT

Column Storage Type Description

1 amptime varchar2(8) amplitude measure descriptor

2 toff float(24) offset from theoretical or observed arrival time

3 tlen float(24) duration of measurement window

4 gvlo float(24) low group velocity for measurement win-dow (km/sec)

5 gvhi float(24) high group velocity for measurement window (km/sec)

6 mtype varchar2(8) measurement type

7 descr varchar2(255) description

8 lddate date load date

39b e r 2 0 0 2

40

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

A M P L I T U D E

The amplitude table contains arrival-based and origin-based amplitude measurements. The amplitude measurement is described in ampdescript.

TABLE 8: AMPLITUDE

Column Storage Type Description

1 ampid number(8) amplitude identifier

2 arid number(8) arrival identifier

3 parid number(8) predicted arrival identifier

4 chan varchar2(8) channel code

5 amp float(24) amplitude (nm)

6 per float(24) period (s)

7 snr float(24) signal-to-noise ratio

8 amptime float(53) time of amplitude measure

9 start_time float(53) start time of measurement window

10 duration float(24) duration of measurement window

11 bandw float(24) bandwidth

12 amptype varchar2(8) amplitude measure descriptor

13 units varchar2(15) units

14 clip varchar2(1) clipped flag

15 inarrival varchar2(1) “y” or “n” flag indicating if amp is the same as the amp in the arrival table

16 auth varchar2(15) author

17 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

Category: Fundamental

Keys: Primary ampid Foreign arid, parid, amptype

Data: Descriptive chan, amptype, units, inarrival Measurement amp, per, snr, amptime, start_time, duration, bandw,

clip Administrative auth, lddate

41b e r 2 0 0 2

42

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

A P M A

The apma table contains results of particle motion analysis for a specific detection.

TABLE 9: APMA

Column Storage Type Description

1 phase varchar2(8) phase

2 arid number(8) arrival identifier

3 freq float(24) frequency

4 snr float(24) signal-to-noise ratio

5 ampp float(24) P-phase amplitude

6 amps float(24) S-phase amplitude

7 amplr float(24) Rayleigh-phase amplitude

8 rect float(24) rectilinearity

9 plans float(24) S-phase planarity

10 planlr float(24) Rayleigh-phase planarity

11 hvratp float(24) P-phase horizontal-to-vertical ratio

12 hvrat float(24) S-phase horizontal-to-vertical ratio

13 hmxmn float(24) maximum-to-minimum horizontal ratio

14 inang3 float(24) short-axis incidence angle

15 seazp float(24) P-phase observed azimuth

16 seazs float(24) S-phase observed azimuth

17 seazlr float(24) Rayleigh-phase observed azimuth

18 inang1 float(24) long-axis incidence angle

19 ptime float(53) P-phase extraction time

20 stime float(53) S-phase extraction time

21 auth varchar2(15) author

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

Category: Fundamental

Keys: Primary apmarid Foreign arid, commid

Data: Descriptive phase Measurement freq, snr, ampp, amps, amplr, rect, plans, planlr,

hvratp, hvrat, hmxmn, inang3, seazp, seazs, seazlr, inang1, ptime, stime

Administrative auth, lddate

22 apmarid number(8) apma recipe identifier

23 commid number(8) comment identifier

24 lddate date load date

TABLE 9: APMA (CONTINUED)

Column Storage Type Description

43b e r 2 0 0 2

44

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

A R C H _ D A T A _ T Y P E

The arch_data_type table contains information used by the archiving software.

Category: Core, Fundamental

Keys: Primary archid

Data: Descriptive datatype, table_name, primarykey, secondkey, merge_adjacent, not_missing_data, ondate, offdate

Administrative lddate

TABLE 10: ARCH_DATA_TYPE

Column Storage Type Description

1 archid number(8) Archive row identifier

2 datatype varchar2(24) data type (or class of data)

3 table_name varchar2(32) name of the table encapsulating the data type

4 primarykey varchar2(24) not used

5 secondkey varchar2(24) not used

6 merge_adjacent varchar2(2) y indicates Archive should merge adja-cent rows

7 note_missing_data varchar2(2) indicates that this data type is for late arriving data

8 ondate number(8) first date this row is valid

9 offdate number(8) last date this row is valid

10 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

A R R I V A L

The arrival table contains summary information about arrivals.

TABLE 11: ARRIVAL

Column Storage Type Description

1 sta varchar2(6) station code

2 time float(53) epoch time

3 arid number(8) arrival identifier

4 jdate number(8) Julian date

5 stassid number(8) stassoc identifier

6 chanid number(8) instrument identifier

7 chan varchar2(8) channel code

8 iphase varchar2(8) reported phase

9 stype varchar2(1) signal type

10 deltim float(24) time uncertainty

11 azimuth float(24) observed azimuth

12 delaz float(24) azimuth uncertainty

13 slow float(24) observed slowness, seconds/degree

14 delslo float(24) slowness uncertainty

15 ema float(24) emergence angle

16 rect float(24) rectilinearity

17 amp float(24) amplitude, instrument corrected, nm

18 per float(24) period

19 logat float(24) log(amp/per)

20 clip varchar2(1) clipped flag

21 fm varchar2(2) first motion

22 snr float(24) signal-to-noise ratio

45b e r 2 0 0 2

46

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

Category: Core, Fundamental

Keys: Primary sta/time Alternate arid Foreign stassid, chanid, commid

Data: Descriptive sta, chan, iphase, stype Measurement time, jdate, deltim, azimuth, delaz, slow, delslo,

ema, rect, amp, per, logat, clip, fm, snr, qual Administrative auth, lddate

23 qual varchar2(1) signal onset quality

24 auth varchar2(15) author

25 commid number(8) comment identifier

26 lddate date load date

TABLE 11: ARRIVAL (CONTINUED)

Column Storage Type Description

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

A S S O C , A S S O C _ T E M P _ G A

The assoc table contains information that connects arrivals (entries in the arrival table) to a particular origin. The assoc_temp_ga table is used by the Global Association (GA)application to store temporary associations.

TABLE 12: ASSOC (ASSOC_TEMP_GA)

Column Storage Type Description

1 arid number(8) arrival identifier

2 orid number(8) origin identifier

3 sta varchar2(6) station code

4 phase varchar2(8) associated phase

5 belief float(24) phase confidence

6 delta float(24) station-to-event distance

7 seaz float(24) station-to-event azimuth

8 esaz float(24) event-to-station azimuth

9 timeres float(24) time residual

10 timedef varchar2(1) time = defining (d), nondefining (n)

11 azres float(24) azimuth residual

12 azdef varchar2(1) azimuth = defining (d), nondefining (n)

13 slores float(24) slowness residual

14 slodef varchar2(1) slowness = defining (d), nondefining (n)

15 emares float(24) incidence angle residual

16 wgt float(24) location weight

17 vmodel varchar2(15) velocity model

18 commid number(8) comment identifier

19 lddate date load date

47b e r 2 0 0 2

48

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

Category: Core, Fundamental

Keys: Primary arid/orid Foreign commid

Data: Descriptive sta, phase, belief, wgt, vmodel Measurement delta, seaz, esaz, timeres, timedef, azres, azdef,

slores, slodef, emares Administrative lddate

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

A T T E N C O E F

The attencoef table contains station-specific attenuation corrections for regional analysis.

Category: Fundamental

Keys: Primary attenid/sta/ratiotype/chan

Data: Measurement xcoef, ycoef, zcoef, dmin, dmax Administrative lddate

TABLE 13: ATTENCOEF

Column Storage Type Description

1 attenid varchar2(20) attenuation coefficient set identifier

2 sta varchar2(6) station code

3 ratiotype varchar2(6) amplitude ratio identifier

4 chan varchar2(8) channel code

5 xcoef float(24) constant coefficient

6 ycoef float(24) geometrical spreading coefficient

7 zcoef float(24) attenuation coefficient

8 dmin float(24) minimum distance of applicability

9 dmax float(24) maximum distance of applicability

10 lddate date load date

49b e r 2 0 0 2

50

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

B E A M A U X

The beamaux table is a view into the sensor and instrument tables.

Category: Data Services

Keys: Primary sta/chan/time

Data: Descriptive sta, chan, ncalib, ncalper Measurement time, endtime

TABLE 14: BEAMAUX

Column Storage Type Description

1 sta varchar2(6) station code

2 chan varchar2(8) channel code

3 ncalib float(24) nominal calibration

4 ncalper float(24) nominal calibration period

5 time float(53) epoch time of beginning of beam

6 endtime float(53) epoch time of end of beam

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

B U L L _ C O M P

The bull_comp table contains results from the BullComp application of the comparison of two seismic bulletins. The information summarizes the differences between event solu-tions that share common associated arrivals, or (if no arrival information is available) whose locations and time uncertainties overlap.

TABLE 15: BULL_COMP

Column Storage Type Description

1 orid1 number(8) origin identifier from bulletin 1

2 orid2 number(8) origin identifier from bulletin 2

3 ddist float(24) difference in distance

4 ddepth float(24) difference in depth

5 dtime float(24) difference in epoch time

6 ndef1 number(8) number of time-defining phases for orid1

7 ndef2 number(8) number of time-defining phases for orid2

8 dndef number(8) difference in number of time-defining phases

9 narr1 number(8) number of associated arrivals for orid1

10 narr2 number(8) number of associated arrivals for orid2

11 dnarr number(8) difference in number of associated arriv-als

12 nmatch number(8) number of matching arrivals (defining/nondefining)

13 ndef1arr2 number(8) number of defining arrivals for orid1 that are arrivals (either defining or nondefin-ing) for orid2

14 ndef2arr1 number(8) number of defining arrivals for orid2 that are arrivals (defining/ nondefining) for orid1

15 asstr varchar2(1) association strength (s or w)

16 lddate date load date

51b e r 2 0 0 2

52

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

Category: System Monitoring

Keys: Primary orid1/orid2

Data: Descriptive asstr Measurement ddist, ddepth, dtime, ndef1, ndef2, dndef, narr1,

narr2, dnarr, nmatch, ndef1arr2, ndef2arr1 Administrative lddate

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

C E P P K S

The ceppks table contains results of cepstral analysis and includes the amplitude and fre-quency of cepstral peaks that are consistent among multiple phases associated with the same event.

Category: Fundamental

Keys: Primary orid/sta/ptyp

Data: Descriptive sta, ptyp Measurement pkamp, pkqf Administrative lddate

TABLE 16: CEPPKS

Column Storage Type Description

1 orid number(8) origin identifier

2 sta varchar2(6) station code

3 ptyp varchar2(6) consistent peak type code

4 pkamp float(24) consistent peak amplitude

5 pkqf float(24) consistent peak quefrency

6 lddate date load date

53b e r 2 0 0 2

54

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

C H A N _ G R O U P S

The chan_groups table contains information used by the archiving software.

Category: Data Services

Keys: Primary class/name

Data: Descriptive sta, chan, duration, inwfactivity, ondate, offdate Administrative lddate

TABLE 17: CHAN_GROUPS

Column Storage Type Description

1 class varchar2(16) class (or data type)

2 name varchar2(16) name of the grouping

3 sta varchar2(6) station name

4 chan varchar2(8) channel name

5 duration number not used

6 inwfactivity number(1) not used

7 ondate number(8) first date this row is valid

8 offdate number(8) last date this row is valid

9 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

C H A N N A M E

The channame table provides mapping between channel and station names.

Category: Data Services

Keys: Primary: extern_sta/extern_chan Foreign: intern_sta/intern_chan, intern_chanid, commid

Data: Descriptive: extern_sta, extern_chan, intern_sta, intern_chan, intern_chanid

Administrative: lddate

TABLE 18: CHANNAME

Column Storage Type Description

1 extern_sta varchar2(6) external station name

2 extern_chan varchar2(8) external channel name

3 extern_auth varchar2(20) external authority using this name

4 intern_sta varchar2(6) internal station name

5 intern_chan varchar2(8) internal channel name

6 intern_chanid number(8) internal channel ID

7 commid number(8) comment identifier

8 lddate date load date

55b e r 2 0 0 2

56

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

C O L O R D I S C

The colordisc table links a unique colormapid to a colormap name and disk file.

Category: Interactive Processing

Keys: Primary colormapid

Data: Descriptive colormapname, dfile, dir Administrative lddate

TABLE 19: COLORDISC

Column Storage Type Description

1 colormapid number(8) colormap identifier

2 dfile varchar2(32) data filename

3 dir varchar2(64) directory

4 colormapname varchar2(64) colormap name

5 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

C O M P L E X I T Y

The complexity table contains the complexity event characterization parameter estimated by the Detection and Feature Extraction (DFX) application.

Category: Fundamental

Keys: Primary orid/sta/phase

Data: Descriptive sta, phase, rectype Measurement complexity, snr Administrative lddate

TABLE 20: COMPLEXITY

Column Storage Type Description

1 orid number(8) origin identifier

2 sta varchar2(6) station name

3 phase varchar2(6) phase name

4 rectype varchar2(8) recipe type

5 complexity float(24) complexity measure

6 snr float(24) signal-to-noise ratio

7 lddate date load date

57b e r 2 0 0 2

58

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

D A T A D A Y S

The datadays table contains the days and times for which analysis has been completed.

Category: Interactive Processing

Keys: Primary jdate

Data: Measurement jdate, time, endtime Administrative lddate

TABLE 21: DATADAYS

Column Storage Type Description

1 jdate number(8) Julian date

2 time float(53) epoch time of start of dataday

3 endtime float(53) epoch time of end of dataday

4 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

D A T A R E A D Y

The dataready table indicates which data are ready to be processed by the Subscription Subsystem. Entries to the table are made by scripts running in the operational systems that process the data.

Category: Data Services

Keys: Primary dataid

Data: Descriptive tablename, account, tagname, data_info, status Measurement tagid, tagid2 Administrative lddate

TABLE 22: DATAREADY

Column Storage Type Description

1 dataid number(8) data ready identifier

2 tablename varchar2(24) name of table

3 account varchar2(24) account name

4 tagname varchar2(12) name of reference field (for example, orid)

5 tagid number(10) value of tag name

6 tagid2 number(10) secondary tag value

7 data_info varchar2(24) miscellaneous data information

8 status varchar2(8) status of new entry (i=insert, c=change, d=delete)

9 lddate date load date

59b e r 2 0 0 2

60

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

D A T A U S E R

The datauser table tracks authorized users of the Message and Subscription Subsystems. Each user is identified by a (unique) username and domain, which must match all email headers. The priority column specifies the class of user, and servicetime is the last time a request from the user was processed. Priority and servicetime are considered when select-ing the order in which requests will be processed. The status can either be active or inac-tive.

TABLE 23: DATAUSER

Column Storage Type Description

1 userid number(8) identifier for the user

2 pocid number(8) point of contact identifier

3 username varchar2(24) user name from the incoming subscrip-tion message

4 domain varchar2(48) domain name from the incoming sub-scription message

5 msgtype varchar2(16) message type

6 status varchar2(24) status of this user

7 priority number(2) user’s priority

8 commid number(8) comment identifier

9 emaillimit number(8) maximum size of message (in bytes) that will be delivered via email

10 servicetime float(53) last time a request from that user was ser-viced

11 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

Category: Data Services

Keys: Primary userid Foreign pocid, commid

Data: Descriptive username, domain, msgtype, emaillimit Measurement status, priority, servicetime Administrative lddate

61b e r 2 0 0 2

62

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

D E T E C T I O N

The detection table contains summary information about S/H/I detections.

TABLE 24: DETECTION

Column Storage Type Description

1 arid number(8) arrival identifier

2 jdate number(8) Julian date

3 time float(53) epoch time

4 sta varchar2(6) station code

5 chan varchar2(8) channel code

6 bmtyp varchar2(4) beam type

7 sproid number(8) signal processor identifier

8 cfreq float(24) center frequency

9 seaz float(24) observed azimuth

10 delaz float(24) azimuth uncertainty

11 slow float(24) observed slowness, sec/km

12 delslo float(24) slowness uncertainty

13 snr float(24) signal-to-noise ratio

14 stav float(24) short-term average

15 fstat float(24) f-statistic

16 deltim float(24) time uncertainty

17 bandw float(24) bandwidth

18 fkqual number(4) f-k quality

19 commid number(8) comment identifier

20 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

Category: Fundamental

Keys: Primary sta/time Alternate arid Foreign commid

Data: Descriptive sta, chan, bmtyp, sproid Measurement jdate, time, cfreq, seaz, delaz, slow, delslo, snr, stav,

fstat, deltim, bandw, fkqual Administrative lddate

63b e r 2 0 0 2

64

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

D I S C A R D

The discard table contains the reason why an analyst discarded an event that was hypoth-esized by the automated system.

Category: Interactive Processing

Keys: Primary evid

Data: Descriptive reason, auth Administrative lddate

TABLE 25: DISCARD

Column Storage Type Description

1 evid number(8) event identifier

2 reason varchar2(30) reason event was discarded

3 auth varchar2(15) source/originator

4 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

D L F I L E

The dlfile table describes the files used in the diskloops managed by the DLMan applica-tion.

TABLE 26: DLFILE

Column Storage Type Description

1 dir varchar2(64) directory name

2 dfile varchar2(32) filename

3 machine varchar2(32) machine name

4 partition varchar2(64) disk partition name

5 dfid number(8) diskloop file identifier

6 inloop varchar2(1) file is part of a diskloop = y/n

7 full varchar2(1) file is full = y/n

8 archived varchar2(1) file is archived = y/n/a

9 length number(10) length of file, bytes

10 tlen float(24) length of file, seconds

11 time float(53) start time

12 reaptime float(53) clock time for expiration

13 sta varchar2(6) station name

14 chan varchar2(8) channel name

15 chanid number(8) channel identifier

16 dlid number(8) diskloop manager identifier

17 commid number(8) comment identifier

18 lddate date load date

65b e r 2 0 0 2

66

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

Category: Data Services

Keys: Primary dir/dfile Alternate dfid Foreign chanid, dlid, commid

Data: Descriptive dir, dfile, machine, partition, inloop, full, archived, length, tlen, time, sta, chan

Administrative reaptime, lddate

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

D L M A N

The dlman table keeps track of currently running DLMan instances. Machine is the host on which this dlid runs (it may not run elsewhere). “Running” indicates whether that DLMan is currently operational. The table also provides the ports this dlid is currently using to listen to other processes.

Category: Data Services

Keys: Primary dlid Foreign commid

Data: Descriptive machine, running, connmanport, controlport, archiveport, forwardport

Administrative lddate

TABLE 27: DLMAN

Column Storage Type Description

1 dlid number(8) diskloop manager identifier

2 machine varchar2(32) machine name

3 running varchar2(1) DLMan running = y/n

4 connmanport number(6) ConnMan port

5 controlport number(6) DataControl port

6 archiveport number(6) Archiver port

7 forwardport number(6) Forwarder port

8 commid number(8) comment identifier

9 lddate date load date

67b e r 2 0 0 2

68

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

E V _ S U M M A R Y, E X _ S U M M A R Y, A N _ S U M M A R Y

The ev_summary, ex_summary, and an_summary tables contain statistical summary anal-ysis of expert system solutions from the ExAnComp application.

TABLE 28: EV_SUMMARY (EX_SUMMARY, AN_SUMMARY)

Column Storage Type Description

1 orid number(8) origin identifier of analyst event

2 nearsta varchar2(6) code for nearest station

3 neardist float(24) distance to closest station

4 nearaz float(24) azimuth from nearest station

5 refid number(8) identifier of nearest reference point

6 refdist float(24) distance to nearest reference point

7 refaz float(24) azimuth to nearest reference point

8 grn number(8) geographic region number

9 nsta number(8) number of recording stations

10 lsta number(8) number of local observations

11 asta number(8) number of regional array observations

12 rsta number(8) number of non-array regional observa-tions

13 tsta number(8) number of teleseismic observations

14 ndef number(8) number of time-defining phases

15 adef number(8) number of associated nondefining phases

16 primp number(8) number of primary time-defining phases used for location

17 secondp number(8) number of secondary phases used for location

18 depthp number(8) number of depth phases

19 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

Category: System Monitoring

Keys: Primary orid Foreign grn, refid

Data: Descriptive nearsta, grn Measurement neardist, nearaz, refdist, refaz, nsta, lsta, asta, rsta,

tsta, ndef, adef, primp, secondp, depthp Administrative lddate

69b e r 2 0 0 2

70

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

E V E N T

The event table contains a list of events. Multiple origins may be defined for any one event. Prefor points to the preferred origin.

Category: Core, Fundamental

Keys: Primary evid Foreign prefor, commid

Data: Descriptive evname, prefor Administrative auth, lddate

TABLE 29: EVENT

Column Storage Type Description

1 evid number(8) event identifier

2 evname varchar2(15) event name

3 prefor number(8) preferred origin

4 auth varchar2(15) source/originator

5 commid number(8) comment identifier

6 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

E V E N T _ C O N T R O L , I N _ E V E N T _ C O N T R O L

The event_control and in_event_control tables contain event location and magnitude con-trol parameters. This information acts as an archive of the specific user-defined controls that were used to determine the location and magnitude of a given orid. The table also includes two measurement columns (cov_sm_axes and cov_depth_time) that allow the coverage ellipse to be determined from the confidence ellipse axes.

TABLE 30: EVENT_CONTROL (IN_EVENT_CONTROL)

Column Storage Type Description

1 orid number(8) origin identification

2 evid number(8) event identification

3 prefer_loc varchar2(1) preferred location identifier (S, F, R)

4 constrain_ot number(1) flag to constrain origin time

5 constrain_latlon number(1) flag to constrain latitude/longitude

6 constrain_depth number(1) flag to constrain depth

7 src_dpnt_corr number(2) source-dependent correction code

8 loc_src_dpnt_reg varchar2(15) region name of source-dependent loca-tion correction

9 loc_sdv_screen number(1) flag to ignore large data residuals in loca-tion

10 loc_sdv_mult float(24) location large residual multiplier factor

11 loc_alpha_only number(1) flag to use only primary stations in loca-tion

12 loc_all_stas number(1) flag to use only stations with src_dpnt_corr

13 loc_dist_varwgt number(1) flag to use distance variance weighting

14 mag_src_dpnt_reg varchar2(15) region name of source-dependent magni-tude correction

71b e r 2 0 0 2

72

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

Category: Automatic Processing

Keys: Primary evid/orid

Data: Descriptive prefer_loc, constrain_ot, constrain_latlon, constrain_depth, src_dpnt_corr, loc_src_dpnt_reg, loc_sdv_screen, loc_sdv_mult, loc_alpha_only, loc_all_stas, loc_dist_varwgt, mag_src_dpnt_reg, mag_sdv_screen, mag_sdv_mult, mag_alpha_only, mag_all_stas, mb_min_dist, mb_max_dist, mmodel

Measurement cov_sm_axes, cov_depth_time Administrative lddate

15 mag_sdv_screen number(1) flag to ignore large magnitude data resid-uals

16 mag_sdv_mult float(24) magnitude large residual multiplier fac-tor

17 mag_alpha_only number(1) flag to limit station net used in magnitude

18 mag_all_stas number(1) flag to use only primary stations in mag-nitude

19 mb_min_dist float(24) minimum distance (degrees) for mb

20 mb_max_dist float(24) maximum distance (degrees) for mb

21 mmodel varchar2(15) network magnitude model

22 cov_sm_axes float(24) coverage ellipse semi-axes conversion factor

23 cov_depth_time float(24) coverage ellipse depth/time conversion factor

24 lddate date load date

TABLE 30: EVENT_CONTROL (IN_EVENT_CONTROL) (CONTINUED)

Column Storage Type Description

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

E V S C _ H Y D R O

The evsc_hydro table contains station-specific hydroacoustic event-screening results for the standard and subscription criteria. One record per orid per sta is in the table.

Category: Automatic Processing

Keys: Primary orid/sta

Data: Measurement cp_broad_band, snr_high_band, noise_high_band Administrative lddate

TABLE 31: EVSC_HYDRO

Column Storage Type Description

1 orid number(8) origin identifier

2 sta varchar2(6) station code

3 cp_broad_band float(24) hydroacoustic cepstral peak amplitude in 2–80 Hz band

4 snr_high_band float(24) hydroacoustic signal-to-noise ratio in 32–64 Hz band

5 noise_high_band float(24) hydroacoustic noise level in 32–64 Hz band

6 lddate date load date

73b e r 2 0 0 2

74

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

E V S C _ P R O D

The evsc_prod table contains event screening results for the standard and subscription criteria. One record per orid is in the table for each subscription (prodid).

TABLE 32: EVSC_PROD

Column Storage Type Description

1 prodid number(8) product identifier

2 orid number(8) origin identifier

3 score float(24) composite screening score

4 dscore float(24) depth screening score

5 mscore float(24) mb minus Ms screening score

6 rscore float(24) regional P/S screening score

7 hscore float(24) hydroacoustic screening score

8 depth float(24) depth estimate

9 deptherr float(24) depth confidence interval

10 moveout_pp float(24) moveout of pP–P travel times

11 moveout_sp float(24) moveout of sP–P travel times

12 min_dt_pp float(24) pP–P travel time difference at nearest station beyond 25 deg.

13 min_dt_sp float(24) sP–P travel time difference at nearest station beyond 25 deg.

14 ndp_snr_pp number(8) number of pP phases with sufficient snr for move-out processing

15 ndp_snr_sp number(8) number of sP phases with sufficient snr for move-out processing

16 mbms float(24) mb minus Ms (including slope term)

17 mbmserr float(24) mb minus Ms confidence interval

18 mb float(24) mb magnitude used for event screening

19 ms float(24) Ms magnitude used for event screening

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

Category: Fundamental

Keys: Primary prodid/orid

Data: Descriptive consider Convenience mb, ms, strike, depth, nsta_mb, nsta_ms Measurement score, dscore, mscore, rscore, hscore, deptherr,

moveout_pp, moveout_sp, min_dt_pp, min_dt_sp, ndp_snr_pp, ndp_snr_sp, mbms, mbmserr, smaj_sc, smin_sc, pctoffsh, min_wdepth, clrpth

Administrative lddate

20 nsta_mb number(8) number of stations used in network mb estimate

21 nsta_ms number(8) number of stations used in network Ms estimate

22 smaj_sc float(24) scaled semi-major axis of location error ellipse

23 smin_sc float(24) scaled semi-minor axis of location error ellipse

24 strike float(24) strike angle of location error ellipse

25 pctoffsh float(24) percent of location error ellipse that is offshore

26 min_wdepth float(24) minimum water depth within location error ellipse

27 clrpth number(1) indicator of clear path to at least one hydroacoustic station

28 consider number(1) considered for event screening flag

29 lddate date load date

TABLE 32: EVSC_PROD (CONTINUED)

Column Storage Type Description

75b e r 2 0 0 2

76

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

E V S C _ R E G I O N A L

The evsc_regional table contains station-specific regional seismic phase amplitude mea-surements and quality flags for the standard and subscription criteria. One record per orid per sta is in the table.

TABLE 33: EVSC_REGIONAL

Column Storage Type Description

1 orid number(8) origin identifier

2 sta varchar2(6) station name

3 chan varchar2(8) channel identifier

4 delta float(24) source-receiver distance

5 pnsmax float(24) maximum of Pn/Sn and Pn/Lg

6 pnsmax_corr float(24) amplitude ratio correction term

7 pnsmax_err float(24) amplitude ratio error term

8 pnsn float(24) Pn/Sn amplitude ratio

9 pnlg float(24) Pn/Lg amplitude ratio

10 pn_snr float(24) Pn amplitude snr ratio

11 sn_snr float(24) Sn amplitude snr ratio

12 lg_snr float(24) Lg amplitude snr ratio

13 pnsn_qual varchar2(10) Pn/Sn amplitude ratio quality flags

14 pnlg_qual varchar2(10) Pn/Lg amplitude ratio quality flags

15 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

Category: Fundamental

Keys: Primary orid/sta/chan

Data: Descriptive pnsn_qual, pnlg_qual Convenience delta Measurement pnsmax, pnsmax_corr, pnsmax_err, pnsn, pnlg,

pn_snr, sn_snr, lg_snr Administrative lddate

77b e r 2 0 0 2

78

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

E X _ A N

The ex_an table contains analyses of expert system solutions compared to analyst solu-tions from the ExAnComp application.

TABLE 34: EX_AN

Column Storage Type Description

1 forid number(8) final origin identifier

2 eorid number(8) expert system origin identifier

3 ddist float(24) distance between forid and eorid

4 ddepth float(24) depth difference

5 dtime float(24) origin time difference

6 did varchar2(4) identification difference

7 dnsta number(8) difference in recording stations

8 dlsta number(8) difference in local stations

9 dasta number(8) difference in regional array stations

10 drsta number(8) difference in non-array regional station

11 dtsta number(8) difference in teleseismic station

12 dndef number(8) difference in defining phases

13 dprimp number(8) difference in primary phases

14 dsecondp number(8) difference in secondary phases

15 ddepthp number(8) difference in depth phases

16 rprimp number(8) renamed primary phases

17 rsecondp number(8) renamed secondary phases

18 rdepthp number(8) renamed depth phases

19 added number(8) number of added phases

20 retime number(8) number of retimed phases

21 splitev varchar2(4) split event (y/n)

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

Category: System Monitoring

Keys: Primary forid Foreign eorid

Data: Measurement ddist, ddepth, dtime, did, dnsta, dlsta, dasta, drsta, dtsta, dndef, dprimp, dsecondp, ddepthp, rprimp, rsecondp, rdepthp, added, retime, splitev, multev, kbscause

Administrative lddate

22 multev varchar2(4) multiple events (y/n)

23 kbscause varchar2(7) knowledge system explanation

24 lddate date load date

TABLE 34: EX_AN (CONTINUED)

Column Storage Type Description

79b e r 2 0 0 2

80

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

E X C E P T I O N _ C H A N M A P

The exception_chanmap table contains exception channel mappings for specific stations.

Category: Data Services

Keys: Primary. sta, ext_chan Foreign. int_chan

Data: Descriptive sta, ext_chan, int_chan Measurement ondate, offdate Administrative lddate

TABLE 35: EXCEPTION_CHANMAP

Column Storage Type Description

1 sta varchar2(6) station code

2 ext_chan varchar2(8) external channel name

3 int_chan varchar2(8) internal channel name

4 ondate number(8) Julian start date

5 offdate number(8) Julian off date

6 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

E X P L O

The explo table contains information on explosions.

TABLE 36: EXPLO

Column Storage Type Description

1 orid number(8) origin identifier

2 evid number(8) event identifier

3 name varchar2(32) shot name

4 elev float(24) surface elevation (km)

5 yield float(24) yield (kT)

6 yldmax float(24) upper limit of yield range

7 medium varchar2(48) shot medium

8 moist float(24) moisture content

9 waterdepth float(24) depth of static water table (km)

10 paleodepth float(24) depth of Paleozoic layer (km)

11 col_interval float(24) collapse interval (seconds)

12 col_diameter float(24) collapse diameter (km)

13 col_depth float(24) collapse depth (km)

14 col_volume float(24) collapse volume (km3)

15 testsite varchar2(15) test site name

16 expcode varchar2(10) explosion type code

17 exptype varchar2(15) explosion type

18 locid varchar2(30) location identification code

19 auth varchar2(15) author

20 commid number(8) comment identifier

21 lddate date load date

81b e r 2 0 0 2

82

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

Category: Historical

Keys: Primary orid Foreign evid, locid, commid

Data: Descriptive name, medium, testsite, expcode, exptype Measurement elev, yield, yldmax, moist, waterdepth, paleodepth,

col_interval, col_diameter, col_depth, col_volume Administrative auth, lddate

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

F I L E P R O D U C T , F S _ S T A G E P R O D U C T

The fileproduct table contains descriptions of files containing products.

Category: Data Services

Keys: Primary fpid Foreign typeid

Data: Descriptive dir, dfile, foff, dsize, time, endtime, sta, chan, author, version, revision, obsolete

Administrative lddate

TABLE 37: FILEPRODUCT (FS_STAGEPRODUCT)

Column Storage Type Description

1 fpid number(8) file product identifier

2 typeid number(8) identifier for the product type

3 dir varchar2(64) directory where the file is stored

4 dfile varchar2(32) filename containing the file product

5 foff number(10) file offset (in bytes) where the data begins

6 dsize number(10) size of the data (in bytes)

7 time float(53) beginning time of the data

8 endtime float(53) end time of the data

9 sta varchar2(6) station code

10 chan varchar2(8) channel code

11 author varchar2(16) author of the file product

12 version float(53) version of the author

13 revision number(4) revision number of the file product

14 obsolete number(1) flag to indicate if the data are obsolete

15 lddate date load date

83b e r 2 0 0 2

84

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

F K D I S C

The fkdisc table contains descriptions of frequency-wave number (.fk) files.

TABLE 38: FKDISC

Column Storage Type Description

1 jdate number(8) Julian date

2 time float(53) epoch time

3 tlen float(24) time window

4 sta varchar2(6) station code

5 fktyp varchar2(4) f-k type

6 arid number(8) arrival identifier

7 maxkx float(24) maximum x-wavenumber

8 maxsx float(24) maximum x-slowness

9 nx number(4) number of x-samples

10 maxky float(24) maximum y-wavenumber

11 maxsy float(24) maximum y-slowness

12 ny number(4) number of y-samples

13 cfreq float(24) center frequency

14 bandw float(24) bandwidth

15 commid number(8) comment identifier

16 fkrid number(8) f-k recipe identifier

17 fkid number(8) f-k identifier

18 datsw number(10) data switch

19 foff number(10) byte offset of data segment within file

20 dir varchar2(64) f-k directory

21 dfile varchar2(32) f-k data file

22 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

Category: Interactive Processing

Keys: Primary fkid Alternate arid Foreign commid

Data: Descriptive sta, datsw, foff, dir, dfile Measurement jdate, time, tlen, fktyp, maxkx, maxsx, nx, maxky,

maxsy, ny, cfreq, bandw Administrative fkrid, lddate

85b e r 2 0 0 2

86

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

F O R B E A M A U X

The forbeamaux table contains the channels for which amplitude measurements in the event lists and bulletins have been made.

Category: Data Services

Keys: Primary sta/chan

Data: Descriptive sta, chan

TABLE 39: FORBEAMAUX

Column Storage Type Description

1 sta varchar2(6) station code

2 chan varchar2(8) channel code

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

F P D E S C R I P T I O N

The fpdescription table contains descriptions of product types used with file products.

Category: Data Services

Keys: Primary typeid

Data: Descriptive prodtype, name, msgdtype, msgdformat, header_fpid

Administrative lddate

TABLE 40: FPDESCRIPTION

Column Storage Type Description

1 typeid number(8) identifier for the product type description

2 prodtype varchar2(12) name of the product (should be the same as the protocol defining name)

3 name varchar2(64) descriptive listing of the product name

4 msgdtype varchar2(16) type of data (ASCII1, GIF89, and so on)

1. American Standard Code for Information Interchange

5 msgdformat varchar2(16) format of the data (GSE2.0, RMS1.0, and so on).

6 header_fpid number(8) fpid pointing to the header row for this product type

7 lddate date load date

87b e r 2 0 0 2

88

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

F S A V E

The fsave table contains descriptions of an averaged Fourier spectrum (.fs) file.

Category: Interactive Processing

Keys: Primary afsid Alternate avtype/fstype/sta Foreign commid

Data: Descriptive sta, avtype, fstype, datatype, dir, dfile, foff Measurement maxf, nave, nf, noissd Administrative lddate

TABLE 41: FSAVE

Column Storage Type Description

1 sta varchar2(6) station code

2 avtype varchar2(8) Fourier spectrum channel (ave, med, 95 percent, and so on)

3 fstype varchar2(4) Fourier spectrum type

4 maxf float(24) maximum frequency

5 nf number(8) number of frequency values

6 nave number(4) number of spectrums averaged

7 afsid number(8) averaged Fourier spectrum identifier

8 noissd float(24) standard deviation of log noise

9 datatype varchar2(2) numeric storage

10 dir varchar2(64) Fourier spectrum directory

11 dfile varchar2(32) Fourier spectrum data file

12 foff number(10) byte offset of data within file

13 commid number(8) comment identifier

14 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

F S D I S C

The fsdisc table contains descriptions of a Fourier spectrum (.fs) file.

TABLE 42: FSDISC

Column Storage Type Description

1 fsid number(8) Fourier spectrum identifier

2 chanid number(8) channel identifier

3 wfid number(8) waveform identifier

4 fsrid number(8) fs recipe identifier

5 arid number(8) arrival identifier

6 jdate number(8) Julian date

7 time float(53) epoch time

8 tlen float(24) time window

9 sta varchar2(6) station code

10 chan varchar2(8) channel code

11 fstype varchar2(4) Fourier spectrum type

12 maxf float(24) maximum frequency

13 nf number(8) number of frequency values

14 datatype varchar2(2) numeric storage

15 dir varchar2(64) Fourier spectrum directory

16 dfile varchar2(32) Fourier spectrum data file

17 foff number(8) byte offset of data segment within file

18 commid number(8) comment identifier

19 lddate date load date

89b e r 2 0 0 2

90

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

Category: Interactive Processing

Keys: Primary fsid Foreign chanid, wfid, fsrid, arid, commid

Data: Descriptive sta, chan, datatype, dir, dfile, foff Measurement jdate, time, tlen, fstyp, maxf, nf Administrative lddate

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

F S R E C I P E

The fsrecipe table contains recipe descriptions for generating Fourier spectrum (.fs) files.

Category: Interactive Processing

Keys: Primary fsrid

Data: Descriptive fsdesc, taper, taperstart, taperend, winlen, overlap, nfft, smoothvalue, response

Administrative lddate

TABLE 43: FSRECIPE

Column Storage Type Description

1 fsrid number(8) recipe identification

2 fsdesc varchar2(15) Fourier spectrum description

3 taper varchar2(8) type of taper (Hanning, Hamming, Cosine, and so on)

4 taperstart number(8) starting percent for cosine taper

5 taperend number(8) end percent for cosine taper

6 winlen number(8) number of points per window

7 overlap number(8) percent overlap of windows

8 nfft number(8) number of data points in the fft

9 smoothvalue float(24) amount of smoothing (Hz)

10 response varchar2(1) flag specifying instrument response cor-rection

11 lddate date load date

91b e r 2 0 0 2

92

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

F S T A G

The fstag table links individual spectrum files to the average spectrum file.

Category: Interactive Processing

Keys: Primary afsid/fsid

Data: Administrative lddate

TABLE 44: FSTAG

Column Storage Type Description

1 afsid number(8) average Fourier spectra recipe identifica-tion

2 fsid number(8) Fourier spectrum identification

3 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

F T P F A I L E D

The ftpfailed table contains information on FTP data retrieval for AutoDRM.

Category: Data Services

Keys: Primary msgid Foreign ftp_address

Data: Descriptive status, ftp-address Measurement numfailedattempt, lastfailedtime Administrative lddate

TABLE 45: FTPFAILED

Column Storage Type Description

1 msgid number(8) message identifier

2 numfailedattempt number(4) number of failed attempts

3 lastfailedtime float(53) time of most recent attempt

4 ftp_address varchar2(64) FTP address

5 status varchar2(8) status of FTP attempt (retry or failed)

6 lddate date load date

93b e r 2 0 0 2

94

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

F T P L O G I N

The ftplogin table contains log on information for FTP data retrieval. The rows are used by the auxiliary data retrieval system to obtain data via FTP from auxiliary stations.

Category: Data Services

Keys: Primary ftp_address

Data: Descriptive ftp_address, username, password Administrative lddate

TABLE 46: FTPLOGIN

Column Storage Type Description

1 ftp_address varchar2(64) FTP address for auxiliary data

2 username varchar2(16) user name for FTP access

3 password varchar2(16) user password for FTP access

4 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

F W F I L E

The fwfile table contains file information used for buffering continuous data. An entry in this table describes the source station (sta) and the destination (ndc) for a particular stream of continuous data. A one-to-one relationship exists between a source station and a destination station. Fwhid and fwfid designate the identifiers (IDs) of the AlphaDLHeapand AlphaForward processes that service this file. This table is configured by an opera-tor, and the IDs are specified as parameters to the AlphaDLHeap and AlphaForwardapplications. Maxtime designates the maximum time that a gap in the data can span for a given station.

Category: Data Services

Keys: Primary sta/ndc

Data: Descriptive ndc, sta, fwfid, fwhid, dir, dfile, dfilesize Measurement maxtime Administrative lddate

TABLE 47: FWFILE

Column Storage Type Description

1 fwhid number(8) identifier of the AlphaDLHeap process

2 fwfid number(8) identifier of the AlphaForward process

3 ndc varchar2(6) destination of the forwarded data

4 sta varchar2(6) station code

5 maxtime float(53) greatest time period for a gap

6 dir varchar2(64) directory name

7 dfile varchar2(32) heap filename

8 dfilesize number(9) buffer file size

9 lddate date load date

95b e r 2 0 0 2

96

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

F W G A P

The fwgap table was used for tracking gaps in continuous data. Gap management is now handled by the continuous data subsystem but the table is still required by the Message Subsystem software.

Category: Data Services

Keys: Primary fwgid Alternate sta/chan/ndc

Data: Descriptive sta, chan, ndc Measurement time, endtime, framesize Administrative lddate

TABLE 48: FWGAP

Column Storage Type Description

1 sta varchar2(6) station code

2 chan varchar2(8) channel code

3 ndc varchar2(6) destination of the forwarded data

4 time float(53) start time of gap

5 fwgid number(8) forward gap identifier

6 endtime float(53) end time of gap

7 framesize float(53) delta time of data frame

8 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

F W S I T E

The fwsite table contains the possible destinations for forwarding data. An entry in this table describes the destination of the data (ndc), the fully qualified domain name of the machine where the connection manager resides (machine), and the port on which the connection manager is listening (port).

Category: Data Services

Keys: Primary ndc/priority

Data: Descriptive ndc, machine, port, priority Administrative lddate

TABLE 49: FWSITE

Column Storage Type Description

1 ndc varchar2(6) destination of the forwarded data

2 machine varchar2(32) machine name

3 port number(6) listen port

4 priority number(2) priority of connection

5 lddate date load date

97b e r 2 0 0 2

98

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A _ T A G

The ga_tag table contains information on the use of arrivals and origins in the GA appli-cation.

Category: Automatic Processing

Keys: Primary objtype/id/state

Data: Descriptive objtype Measurement state

TABLE 50: GA_TAG

Column Storage Type Description

1 objtype varchar2(1) type of identifier (a for arrival, o for ori-gin)

2 id number(8) identification number (arid or orid)

3 state varchar2(20) use of arid or orid

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

G L O S S A R Y

The glossary table contains information on abbreviations for the explosion database.

Category: Historical

Keys: Primary abbrev/lineno

Data: Descriptive abbrevtype, descrip, dir, dfile Administrative lddate

TABLE 51: GLOSSARY

Column Storage Type Description

1 abbrev varchar2(16) abbreviation name

2 abbrevtype varchar2(16) abbreviation type

3 lineno number(4) description line number

4 descrip varchar2(80) description

5 dir varchar2(64) directory

6 dfile varchar2(32) data file

7 lddate date load date

99b e r 2 0 0 2

100

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G R E G I O N

The gregion table contains geographic region numbers and their equivalent descriptions (see [Fli74]).

Category: Core, Reference

Keys: Primary grn

Data: Descriptive grn, grname Administrative lddate

TABLE 52: GREGION

Column Storage Type Description

1 grn number(8) geographic region number

2 grname varchar2(40) geographic region name

3 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

H Y D R O _ A R R _ G R O U P

The hydro_arr_group table contains hydroacoustic arrival based estimates of slowness and azimuth.

Category: Fundamental

Keys: Primary hydro_id Foreign net

Data: Descriptive nhydarr, hyd_grp_phase, slow Measurement az1, az2, delaz Administrative lddate

TABLE 53: HYDRO_ARR_GROUP

Column Storage Type Description

1 hydro_id number(8) hydro-arrival-group identifier

2 az1 float(24) azimuth estimated from lag times

3 az2 float(24) second possible azimuth (2 arrivals)

4 slow float(24) slowness (s/km)

5 delaz float(24) azimuth uncertainty

6 nhydarr number(4) number of arrivals in hydro-arrival-group

7 net varchar2(8) hydro network name

8 hyd_grp_phase varchar2(8) hydro-arrival-group phase

9 lddate date load date

101b e r 2 0 0 2

102

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

H Y D R O _ A S S O C

The hydro_assoc table contains hydroacoustic arrival based estimates of slowness and azimuth.

Category: Fundamental

Keys: Primary arid Foreign hydro_id

Data: Descriptive azcontrib Administrative lddate

TABLE 54: HYDRO_ASSOC

Column Storage Type Description

1 arid number(8) arrival identifier

2 hydro_id number(8) hydro-arrival-group identifier

3 azcontrib varchar2(1) azimuth contribution flag (y or n)

4 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

H Y D R O _ F E A T U R E S

The hydro_features table contains feature measurements for hydroacoustic data from the DFX application.

TABLE 55: HYDRO_FEATURES

Column Storage Type Description

1 arid number(8) arrival identifier

2 peak_time float(53) time of largest absolute signal value

3 peak_level float(24) pressure of largest absolute signal value

4 total_energy float(24) total energy in signal

5 mean_arrival_time float(53) mean arrival time of signal energy

6 time_spread float(24) rms1 time spread of signal

7 onset_time float(53) estimated onset time of signal

8 termination_time float(53) estimated termination time of signal

9 total_time float(53) total time above threshold

10 num_cross number(8) number of signal threshold crossings

11 ave_noise float(24) average pressure of the noise segment

12 skewness float(24) skew of the estimated signal energy

13 kurtosis float(24) kurtosis of the estimated signal energy

14 cep_var_signal float(24) variance of the cepstrum using spectrum

15 cep_delay_time_signal float(24) bubble pulse delay time using spectrum

16 cep_peak_std_signal float(24) number of standard deviations from the mean for amplitude using spectrum

17 cep_var_trend float(24) variance of the cepstrum detrended using Noise Spectrum Equalization (NSE)

18 cep_delay_time_trend float(24) bubble pulse delay time estimate using trend NSE

19 cep_peak_std_trend float(24) number of standard deviations from the mean for amplitude using the trend

103b e r 2 0 0 2

104

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

Category: Fundamental

Keys: Primary arid

Data: Descriptive low_cut, high_cut, ford, ftype, fzp Measurement peak_time, peak_level, total_energy,

mean_arrival_time, time_spread, onset_time, termination_time, total_time, num_cross, ave_noise, skewness, kurtosis, cep_var_signal, cep_delay_time_signal, cep_peak_std_signal, cep_var_trend, cep_delay_time_trend, cep_peak_std_trend, prob_weight_time, sigma_time

Administrative lddate

20 low_cut float(24) low-cut frequency of filter

21 high_cut float(24) high-cut frequency of filter

22 ford number(8) filter order

23 ftype varchar2(2) filter type

24 fzp number(8) filter causality

25 prob_weight_time float(53) probability-weighted time

26 sigma_time float(53) variance of the probability-weighted time

27 lddate date load date

1. root mean square

TABLE 55: HYDRO_FEATURES (CONTINUED)

Column Storage Type Description

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

I N F R A _ F E A T U R E S

The infra_features table contains feature measurements for infrasonic data from the DFXapplication.

TABLE 56: INFRA_FEATURES

Column Storage Type Description

1 arid number(8) arrival identifier

2 eng_time float(53) energy start time

3 eng_dur float(24) energy duration

4 eng_deldur float(24) standard deviation for energy duration

5 coh_time float(53) coherence start time

6 coh_dur float(24) coherence duration

7 coh_deldur float(24) standard deviation for coherence dura-tion

8 coinc_time float(53) coincident start time

9 coinc_dur float(24) coincident duration

10 coinc_deldur float(24) standard deviation for coincident dura-tion

11 ford number(8) filter order

12 zrcr_freq float(24) zero crossing frequency

13 zrcr_delfreq float(24) standard deviation for zero crossing fre-quency

14 crnr_freq float(24) corner frequency

15 crnr_delfreq float(24) standard deviation for corner frequency

16 coh_per float(24) spatial coherence period

17 coh_snr float(24) spatial coherence signal-to-noise ratio

18 total_energy float(24) total energy

105b e r 2 0 0 2

106

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

Category: Fundamental

Keys: Primary arid Foreign commid

Data: Descriptive ford Measurement eng_time, eng_dur, eng_deldur, coh_time, coh_dur,

coh_deldur, coinc_time, coinc_dur, coinc_deldur, zrcr_freq, zrcr_delfreq, crnr_freq, crnr_delfreq, coh_per, coh_snr, total_energy

Administrative auth, lddate

19 auth varchar2(15) author

20 commid number(8) comment identifier

21 lddate date load date

TABLE 56: INFRA_FEATURES (CONTINUED)

Column Storage Type Description

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

I N S T R U M E N T

The instrument table contains ancillary calibration information. This table holds nominal one-frequency calibration factors for each instrument and pointers to the nominal fre-quency-dependent calibration for an instrument. It also holds pointers to the exact cali-brations obtained by direct measurement on a particular instrument (see sensor).

Category: Core, Reference

Keys: Primary inid

Data: Descriptive insname, instype, band, digital, dir, dfile, rsptype Measurement samprate, ncalib, ncalper Administrative lddate

TABLE 57: INSTRUMENT

Column Storage Type Description

1 inid number(8) instrument identifier

2 insname varchar2(50) instrument name

3 instype varchar2(6) instrument type

4 band varchar2(1) frequency band

5 digital varchar2(1) data type, digital (d), or analog (a)

6 samprate float(24) sampling rate in samples/second

7 ncalib float(24) nominal calibration (nanometers/digital count)

8 ncalper float(24) nominal calibration period (seconds)

9 dir varchar2(64) directory

10 dfile varchar2(32) data file

11 rsptype varchar2(6) response type

12 lddate date load date

107b e r 2 0 0 2

108

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

I N T E R V A L

The interval table defines units of processing. The time, endtime, and name fields indicate processing times for a named object. The class field allows a single interval table to be used for different classes of objects.

Category: Distributed Processing

Keys: Primary class/name/time/endtime Alternate intvlid

Data: Descriptive class, name, state Measurement time, endtime Administrative moddate, lddate

TABLE 58: INTERVAL

Column Storage Type Description

1 intvlid number(8) interval identifier

2 class varchar2(16) type of interval

3 name varchar2(20) name of interval

4 time float(53) starting time of data

5 endtime float(53) ending time of data

6 state varchar2(16) current processing state

7 moddate date time of last processing state change

8 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

L A S T I D , P R O B L A S T I D , R M S _ L A S T I D

The lastid table contains counter values (last value used for keys). This table is a refer-ence table from which programs may retrieve the last sequential value of one of the numeric keys. Unique keys are required before inserting a record in numerous tables. The table has exactly one row for each keyname. Problastid and rms_lastid are views of the lastid table.

Category: Database and Utility

Keys: Primary keyname

Data: Descriptive keyname, keyvalue Administrative lddate

TABLE 59: LASTID (PROBLASTID, RMS_LASTID)

Column Storage Type Description

1 keyname varchar2(15) identifier name (arid, orid, and so on)

2 keyvalue number(8) last value used for that identifier

3 lddate date load date

109b e r 2 0 0 2

110

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

L O C A T I O N

The location table contains information on mines and test sites.

Category: Historical

Keys: Primary locid Alternate lat/lon/elev/tdepth Foreign commid

Data: Descriptive locname, sublocname, locid, descrip Measurement lat, lon, elev, tdepth Administrative auth, lddate

TABLE 60: LOCATION

Column Storage Type Description

1 locname varchar2(15) location name

2 sublocname varchar2(25) sub-location name

3 locid varchar2(30) location identifier

4 lat float(24) latitude

5 lon float(24) longitude

6 elev float(24) surface elevation (km)

7 tdepth float(24) tunnel depth

8 descrip varchar2(50) text description

9 auth varchar2(15) author

10 commid number(8) comment identifier

11 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

M A P C O L O R

The mapcolor table contains information to associate a mapid from the mapdisc table with a colormapid from the colordisc table. This table is used to plot the same map (mapid) in different colors (for example, brown, green, or outline).

Category: Interactive Processing

Keys: Primary mapid/colormapid

Data: Administrative lddate

TABLE 61: MAPCOLOR

Column Storage Type Description

1 mapid number(8) map identifier

2 colormapid number(8) colormap identifier

3 lddate date load date

111b e r 2 0 0 2

112

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

M A P D I S C

The mapdisc table contains information about map files that are on disk.

TABLE 62: MAPDISC

Column Storage Type Description

1 mapid number(8) map identifier

2 mapname varchar2(64) map name

3 dfile varchar2(32) map data filename

4 dir varchar2(64) directory

5 maptype number(8) map type

6 mapfiletype varchar2(4) map file type

7 projection number(8) map projection

8 dimx number(8) map x dimension

9 dimy number(8) map y dimension

10 reflon float(24) reference longitude

11 reflat float(24) reference latitude

12 refoffsetlon float(24) longitude reference offset

13 refoffsetlat float(24) latitude reference offset

14 lonorigradians float(24) longitude origin radians

15 latorigradians float(24) latitude origin radians

16 scale float(24) map scale

17 rotation float(24) map rotation

18 latminor float(24) latitude interval for minor grid lines

19 latmajor float(24) latitude interval for major grid lines

20 lonminor float(24) longitude interval for minor grid lines

21 lonmajor float(24) longitude interval for major grid lines

22 bordercolor varchar2(32) border color name

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

Category: Interactive Processing

Keys: Primary mapid

Data: Descriptive mapname, dfile, dir, maptype, mapfiletype, projection, bordercolor, label

Measurement dimx, dimy, reflon, reflat, refoffsetlon, refoffsetlat, lonorigradians, latorigradians, scale, rotation, latminor, latmajor, lonminor, lonmajor, gctp1–15

Administrative lddate

23 label varchar2(65) map category

24–38 gctp1 through gctp15 float(53) general cartographic transformation package variables

39 lddate date load date

TABLE 62: MAPDISC (CONTINUED)

Column Storage Type Description

113b e r 2 0 0 2

114

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

M A P O V E R

The mapover table contains links between the mapdisc and overlaydisc tables.

Category: Interactive Processing

Keys: Primary mapid/overlayid

Data: Administrative lddate

TABLE 63: MAPOVER

Column Storage Type Description

1 mapid number(8) map identifier

2 overlayid number(8) overlay identifier

3 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

M A P P O I N T

The mappoint table contains labeled point data to be displayed by the Map application.

Category: Interactive Processing

Keys: Primary lat/lon/mptype

Data: Descriptive lat, lon, mplabel, mptype, mpdescrip Administrative lddate

TABLE 64: MAPPOINT

Column Storage Type Description

1 lat float(24) latitude

2 lon float(24) longitude

3 mplabel varchar2(65) map point type

4 mptype varchar2(20) map point label

5 mpdescrip varchar2(50) map point description

6 lddate date load date

115b e r 2 0 0 2

116

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

M I G _ D A T E

The mig_date table is used by the MigrateData application to track table migration.

Category: Data Services

Keys: Primary procclass/procname

Data: Descriptive procclass, procname, last_mig_date Administrative lddate

TABLE 65: MIG_DATE

Column Storage Type Description

1 procclass varchar2(16) process class

2 procname varchar2(16) process name

3 last_mig_date date last migration date

4 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

M I G _ R U L E S

The mig_rules table contains rules for migrating database tables from one database table to another and are specified in Table 66.

Category: Data Services

Keys: Primary task_num/query_type/src_tbl

Data: Descriptive task_num, query_type, src, src_tbl, dest, dest_tbl, quer_seq_no, seq_type, seq_contents

TABLE 66: MIG_RULES

Column Storage Type Description

1 task_num number order of this task

2 query_type varchar2(20) type of query

3 src varchar2(10) source database

4 src_tbl varchar2(30) source table

5 dest varchar2(10) destination database

6 dest_tbl varchar2(30) destination table

7 quer_seq_no number order of this part of the query

8 seq_type varchar2(15) type of sequence to be added to the query

9 seq_contents varchar2(200) query contents

117b e r 2 0 0 2

118

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

M S G A U X

The msgaux table contains records of unsuccessfully processed AutoDRM messages.

Category: Data Services

Keys: Primary msgid/msgrow/state_count

Data: Descriptive command, sub_status Measurement msgrow, state_count Administrative lddate

TABLE 67: MSGAUX

Column Storage Type Description

1 msgid number(8) message identifier

2 msgrow number(4) line number in message

3 state_count number(4) number of failures

4 command varchar2(24) AutoDRM command that could not be processed

5 sub_status varchar2(24) cause of failure

6 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

M S G D A T A T Y P E

The msgdatatype table supports data tracking by recording each data section in a mes-sage for both incoming and outgoing AutoDRM data messages.

Category: Data Services

Keys: Primary msgid/foff

Data: Descriptive msgdtype, msgdformat Measurement status, foff, msize Administrative lddate

TABLE 68: MSGDATATYPE

Column Storage Type Description

1 msgid number(8) message identifier

2 msgdtype varchar2(16) data type of the data section within the message

3 msgdformat varchar2(16) general format of data that follows

4 status varchar2(32) status of the data section

5 foff number(8) file offset to beginning of data section

6 msize number(8) size of data section

7 lddate date load date

119b e r 2 0 0 2

120

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

M S G D E S T

The msgdest table contains information about AutoDRM messages sent from the IDC.

Category: Data Services

Keys: Primary msgdid Foreign msgid

Data: Descriptive transmeth Data emailto, status, stime, itime Administrative lddate

TABLE 69: MSGDEST

Column Storage Type Description

1 msgdid number(8) message destination identifier

2 msgid number(8) message identifier

3 transmeth varchar2(16) method by which the response is to be delivered to the requester

4 emailto varchar2(64) email address to send message

5 status varchar2(32) current status of the response message

6 itime float(53) time at which table entry was made

7 stime float(53) time at which message was sent

8 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

M S G D I S C

The msgdisc table contains information pertinent to AutoDRM messages including the date and time that the message was sent or received, identification information, and where the message is stored.

TABLE 70: MSGDISC

Column Storage Type Description

1 msgid number(8) message identifier

2 userid number(8) user identifier

3 msgver varchar2(8) message system version number

4 msgtype varchar2(16) message type

5 subtype varchar2(2) message subtype

6 extmsgid varchar2(20) message identification string provided by the sender

7 intid number(8) either the locally generated msgid of an earlier table entry that evoked the cre-ation of this table entry or the reqid from the request table of an internally gener-ated request

8 intidtype varchar2(16) intid type

9 msgsrc varchar2(16) message source code

10 itime float(53) initial time message was received

11 idate number(8) initial date message was received

12 imethod varchar2(8) input method (email or ftp)

13 isrc varchar2(64) initial source of message

14 msize number(10) message size in bytes

15 status varchar2(32) status of message

16 subject varchar2(64) subject header from email message

17 dir varchar2(64) directory to find file

18 dfile varchar2(32) name of data file

121b e r 2 0 0 2

122

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

Category: Data Services

Keys: Primary msgid Foreign userid, intid, commid

Data: Descriptive msgver, msgtype, intidtype, subtype, msgsrc, status, subject, dir, dfile, foff, mfoff, fileoff, filesize, sigtype, verifstatus

Measurement extmsgid, intid, itime, idate, imethod, isrc, msize Administrative lddate

19 foff number(10) byte offset of data segment within file

20 mfoff number(10) offset in bytes to beginning of message

21 fileoff number(10) number of bytes to the first character of the emal file (first character of the email header)

22 filesize number(10) size of file

23 sigtype varchar2(64) digital signature type

24 verifstatus varchar2(4) status of verification

25 commid number(8) comment identifier

26 lddate date load date

TABLE 70: MSGDISC (CONTINUED)

Column Storage Type Description

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

N A _ V A L U E

The na_value table contains the default values to be inserted for a column when not available.

Category: Database and Utility

Keys: Primary attribute

Data: Descriptive attribute, na_value

TABLE 71: NA_VALUE

Column Storage Type Description

1 attribute varchar2(30) column name

2 na_value varchar2(30) value inserted when not available

123b e r 2 0 0 2

124

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

N E T M A G

The netmag table contains estimates of network magnitudes of different types for an event. Each network magnitude has a unique magid. Station magnitudes used to compute the network magnitude are in the stamag table.

Category: Core, Fundamental

Keys: Primary magid Foreign evid, net, orid, commid

Data: Descriptive net, magtype Measurement magnitude, nsta, uncertainty Administrative auth, lddate

TABLE 72: NETMAG

Column Storage Type Description

1 magid number(8) network magnitude identifier

2 net varchar2(8) unique network identifier

3 orid number(8) origin identifier

4 evid number(8) event identifier

5 magtype varchar2(6) magnitude type (Ms, mb, and so on)

6 nsta number(8) number of stations used

7 magnitude float(24) magnitude

8 uncertainty float(24) magnitude uncertainty

9 auth varchar2(15) source/originator

10 commid number(8) comment identifier

11 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

N E T W O R K

The network table contains general information about seismic networks (see affiliation).

Category: Core, Reference

Keys: Primary net Foreign commid

Data: Descriptive net, netname, nettype Administrative auth, lddate

TABLE 73: NETWORK

Column Storage Type Description

1 net varchar2(8) unique network identifier

2 netname varchar2(80) network name

3 nettype varchar2(4) network type: array, local, world-wide, and so on

4 auth varchar2(15) source/originator

5 commid number(8) comment identifier

6 lddate date load date

125b e r 2 0 0 2

126

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

O R I G A U X

The origaux table contains additional data for supplementary events that cannot be inserted into origin, origerr, netmag, and remark tables.

Category: System Monitoring

Keys: Primary orid Foreign evid

Data: Descriptive antype, epfixf, otfixf Measurement gap, maxdist, mindist, nsta Administrative event, ident, lddate

TABLE 74: ORIGAUX

Column Storage Type Description

1 event varchar2(8) unique event identifier (string)

2 otfixf varchar2(1) origin time fixed flag

3 epfixf varchar2(1) epicenter fixed flag

4 nsta number(8) number of defining stations

5 gap number(4) gap in azimuth coverage (degrees)

6 ident varchar2(8) unique ident (string)

7 mindist float(24) distance to closest station (degrees)

8 maxdist float(24) distance to farthest station (degrees)

9 antype varchar2(1) analysis type

10 evid number(8) event identifier

11 orid number(8) origin identifier

12 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

O R I G E R R, O R I G E R R _ T E M P _ G A

The origerr table contains summaries of confidence bounds in origin estimations. The origerr_temp_ga table is used by the GA application to store temporary origin error infor-mation. The measurement fields are the elements of the location covariance matrix. The descriptive fields give the uncertainties in location, depth, and origin time. These quanti-ties are calculated from the covariance matrix, assuming gaussian errors and a confi-dence level conf.

Category: Core, Fundamental

Keys: Primary orid Foreign commid

Data: Descriptive sdobs, smajax, sminax, strike, sdepth, stime, conf Measurement sxx, syy, szz, stt, sxy, sxz, syz, stx, sty, stz Administrative lddate

TABLE 75: ORIGERR (ORIGERR_TEMP_GA)

Column Storage Type Description

1 orid number(8) origin identifier

2–11 sxx, syy, szz, stt, sxy, sxz, syz, stx, sty, stz

float(24) covariance matrix elements

12 sdobs float(24) standard error of observations

13 smajax float(24) semi-major axis of error

14 sminax float(24) semi-minor axis of error

15 strike float(24) strike of the semi-major axis

16 sdepth float(24) depth error

17 stime float(24) origin time error

18 conf float(24) confidence

19 commid number(8) comment identifier

20 lddate date load date

127b e r 2 0 0 2

128

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

O R I G I N , O R I G I N R E F , O R I G I N _ T E M P _ G A

The origin, originref, and origin_temp_ga tables contain information describing a derived or reported origin for a particular event. The origin_temp_ga table is used by the GAapplication to store temporary origins.

TABLE 76: ORIGIN (ORIGINREF, ORIGIN_TEMP_GA)

Column Storage Type Description

1 lat float(24) estimated latitude

2 lon float(24) estimated longitude

3 depth float(24) estimated depth

4 time float(53) epoch time

5 orid number(8) origin identifier

6 evid number(8) event identifier

7 jdate number(8) Julian date

8 nass number(4) number of associated phases

9 ndef number(4) number of locating phases

10 ndp number(4) number of depth phases

11 grn number(8) geographic region number

12 srn number(8) seismic region number

13 etype varchar2(7) event type

14 depdp float(24) estimated depth from depth phases

15 dtype varchar2(1) depth method used

16 mb float(24) body wave magnitude

17 mbid number(8) mb magnitude identifier

18 ms float(24) surface wave magnitude

19 msid number(8) Ms magnitude identifier

20 ml float(24) local magnitude

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

Category: Core, Fundamental

Keys: Primary orid Alternate lat/lon/depth/time Foreign evid, mbid, msid, mlid, commid

Data: Descriptive nass, ndef, ndp, grn, srn, etype Measurement lat, lon, depth, time, jdate, depdp, dtype, mb, mbid,

ms, msid, ml, mlid Administrative algorithm, auth, lddate

21 mlid number(8) ML magnitude identifier

22 algorithm varchar2(15) location algorithm used

23 auth varchar2(15) source/originator

24 commid number(8) comment identifier

25 lddate date load date

TABLE 76: ORIGIN (ORIGINREF, ORIGIN_TEMP_GA) (CONTINUED)

Column Storage Type Description

129b e r 2 0 0 2

130

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

O U T A G E

The outage table contains the availability of time-series data. If the available column is set to “f,” it specifies that no data are available for the interval. Conversely, the outage

table can be used to specify that data are available for an interval by setting the available column to “t.”

Category: Data Services

Keys: Primary otgid Alternate sta/chan/time/endtime

Data: Descriptive sta, chan, auxid, status, auth, available, commid Measurement time, endtime Administrative lddate

TABLE 77: OUTAGE

Column Storage Type Description

1 otgid number(8) outage identifier

2 sta varchar2(6) station code

3 chan varchar2(8) channel code

4 auxid varchar2(4) auxiliary identification code

5 time float(53) start time of outage interval

6 endtime float(53) end time of outage interval

7 status varchar2(32) status of outage

8 auth varchar2(15) source/originator of outage report

9 available varchar2(1) flag to specify if data are unavailable (f) or available (t)

10 commid number(8) comment identifier

11 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

O V E R L A Y D I S C

The overlaydisc table contains the location of the overlays for the Map application.

Category: Interactive Processing

Keys: Primary overlayid

Data: Descriptive overlayname, dfile, dir, colorname Administrative lddate

TABLE 78: OVERLAYDISC

Column Storage Type Description

1 overlayid number(8) overlay identifier

2 overlayname varchar2(64) overlay name

3 dfile varchar2(32) data filename

4 dir varchar2(64) directory

5 colorname varchar2(32) overlay color name

6 lddate date load date

131b e r 2 0 0 2

132

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

P A R R I V A L

The parrival table contains the predicted arrivals and associations for origin-based amplitude measurements.

Category: Fundamental

Keys: Primary parid Alternate sta/time Foreign orid, evid

Data: Descriptive sta, phase, vmodel Measurement time, azimuth, slow, delta Administrative lddate

TABLE 79: PARRIVAL

Column Storage Type Description

1 parid number(8) predicted arrival identifier

2 orid number(8) origin identifier

3 evid number(8) event identifier

4 sta varchar2(6) station code

5 time float(53) epoch time

6 azimuth float(24) azimuth

7 slow float(24) slowness (s/deg)

8 phase varchar2(8) associated phase

9 delta float(24) station to event distance

10 vmodel varchar2(15) velocity model

11 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

P A R T I C I P A T I O N

The participation table contains station participation information for performance report-ing.

Category: Reference

Keys: Primary net/sta

Data: Descriptive net, sta Measurement begin_date, end_date Administrative lddate

TABLE 80: PARTICIPATION

Column Storage Type Description

1 net varchar2(8) network name

2 sta varchar2(6) station name

3 begin_date number(8) date participation began

4 end_date number(8) date participation ended

5 lddate date load date

133b e r 2 0 0 2

134

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

P R O B L E M

The problem table contains information related to problems with stations, communica-tions, software, and hardware.

Category: System Monitoring

Keys: Primary prid

Data: Descriptive procclass, procname, status, class, descrip, login Measurement time, endtime Administrative lddate

TABLE 81: PROBLEM

Column Storage Type Description

1 prid number(8) problem identifier

2 procclass varchar2(17) process class

3 procname varchar2(17) process name

4 time number(17,5) epoch time of start of problem

5 endtime number(17,5) epoch time of end of problem

6 status varchar2(33) status of problem

7 class varchar2(33) class of problem

8 descrip varchar2(129) one line description of problem

9 login varchar2(33) login name of originator

10 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

P R O B L E M L O G

The problemlog table contains individual problem log entries relating to problems in the database table.

Category: System Monitoring

Keys: Primary plid Foreign prid

Data: Descriptive dir, dfile, login Measurement time Administrative lddate

TABLE 82: PROBLEMLOG

Column Storage Type Description

1 plid number(8) problem log identifier

2 prid number(8) problem identifier

3 time number(17,5) time of log entry

4 dir varchar2(129) directory of log file

5 dfile varchar2(65) filename of log file

6 login varchar2(33) login name of originator

7 lddate date load date

135b e r 2 0 0 2

136

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

P R O B L E M M A I L

The problemmail table contains instructions for distributing problem messages to sub-scribers.

Category: System Monitoring

Keys: Primary procclass/login

Data: Descriptive procclass, login Administrative lddate

TABLE 83: PROBLEMMAIL

Column Storage Type Description

1 procclass varchar2(17) subscription category

2 login varchar2(33) login name of originator

3 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

P R O D T R A C K

The prodtrack table queues and links data and subscription products. The dataid column links the product delivery to the data encapsulated in the dataready table, and the msgidcolumn links the product to the outgoing message, as referenced in the msgdisc table. Thus, the prodtrack table allows for subscription tracking from the data to the product.

Category: Data Services

Keys: Primary prodid/dataid/msgid Foreign dataid, msgid

Data: Descriptive delivid, status Administrative lddate

TABLE 84: PRODTRACK

Column Storage Type Description

1 prodid number(8) product identifier

2 delivid number(8) delivery identifier

3 dataid number(8) data ready identifier

4 msgid number(8) message identifier

5 status varchar2(12) status of the product

6 lddate date load date

137b e r 2 0 0 2

138

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

P R O D U C T C R I T E R I A

The productcriteria table contains subscription information about the type of product and when and how often to distribute the data. Each unique product has one record.

TABLE 85: PRODUCTCRITERIA

Column Storage Type Description

1 prodid number(8) product identifier

2 prodname varchar2(24) product name (if a standard product)

3 delivid number(8) last delivery for this product

4 cycle_size number(8) product size to be reached before release (0 for no limit)

5 cycle_time number(4) time interval between releases (0 for immediate)

6 hour_to_send number(2) hour to send product

7 dow_to_send number(2) day of week to send subscription

8 dom_to_send number(2) day of month to send subscription

9 prodtype varchar2(32) product type (origin, detection, and so on)

10 prodsubtype varchar2(12) product subtype (for example, bulletin type)

11 prodfmt varchar2(6) format of outgoing product

12 supressempty char(2) if “no,” empty messages may be sent

13 timelastsend float(54) epoch time of the last transmission

14 timenextsend float(54) epoch time of the next transmission

15 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

Category: Data Services

Keys: Primary prodid

Data: Descriptive prodname, cycle_site, cycle_time, hour_to_send, how_to_send, dom_to_send, prodtype, prodsubtype, prodfmt, supress_empty

Measurement delivid, timelastsend, timenextsend Administrative lddate

139b e r 2 0 0 2

140

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

P R O D U C T T Y P E E V S C

The producttypeevsc table contains the input parameters that define the event-screening criteria for the standard case and national subscriptions. It is used in conjunction with the producttypeorigin table to specify the set of user input criteria. There is one record for each subscription (prodid).

TABLE 86: PRODUCTTYPEEVSC

Column Storage Type Description

1 prodid number(8) product identifier

2 grpname varchar2(24) subscription group name

3 regname varchar2(24) region name

4 min_ndef number(8) minimum number of defining phases

5 min_mb float(24) minimum mb for screening

6 depth_conf float(24) depth screening confidence

7 depth_thresh float(24) depth screening threshold

8 depth_kvalue float(24) depth uncertainty k-value

9 min_ndp_pp number(8) minimum required number of pP depth phases

10 min_ndp_sp number(8) minimum required number of sP depth phases

11 min_moveout_pp float(24) minimum moveout of pP–P travel time differences

12 min_moveout_sp float(24) minimum moveout of sP–P travel time differences

13 min_dp_snr_pp float(24) minimum pP depth phase snr

14 min_dp_snr_sp float(24) minimum sP depth phase snr

15 mbms_conf float(24) mb minus Ms screening confidence

16 mbms_thresh float(24) mb minus Ms screening threshold

17 mbms_slope float(24) slope term for mb minus Ms relation

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

Category: Data Services

Keys: Primary prodid/grpname/regname

Data: Descriptive min_ndef, min_mb, depth_conf, depth_thresh, depth_kvalue, min_ndp_pp, min_ndp_sp, min_moveout_pp, min_moveout_ps, min_dp_snr_pp, min_dp_snr_sp, mbms_conf, mbms_thresh, mbms_slope, magpref_mb, magpref_ms, mb_err, ms_err, min_nsta_ms, loc_conf, hydro_te_thresh, hydro_cp_thresh, min_wdepth_thresh, reg_conf

Administrative lddate

18 magpref_mb varchar2(6) mb magnitude type used for screening.

19 magpref_ms varchar2(6) Ms magnitude type used for screening.

20 mb_err float(24) single-station mb uncertainty

21 ms_err float(24) single-station Ms uncertainty

22 min_nsta_ms number(8) minimum number of stations for ms

23 loc_conf float(24) location error ellipse confidence

24 hydro_te_thresh float(24) hydroacoustic total energy threshold

25 hydro_cp_thresh float(24) hydroacoustic cepstral peak threshold

26 min_wdepth_thresh float(24) minimum water depth threshold

27 reg_conf float(24) regional screening confidence

28 lddate date load date

TABLE 86: PRODUCTTYPEEVSC (CONTINUED)

Column Storage Type Description

141b e r 2 0 0 2

142

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

P R O D U C T T Y P E O R I G I N

The producttypeorigin table contains the details of origin subscriptions. It extends the productcriteria table that is generic to all subscriptions. Each origin-based product has one record.

TABLE 87: PRODUCTTYPEORIGIN

Column Storage Type Description

1 prodid number(8) product identifier

2 minlat float(24) minimum latitude of event

3 maxlat float(24) maximum latitute of event

4 minlon float(24) minimum longitude of event

5 maxlon float(24) maximum longitude of event

6 mindepth float(24) minimum depth of event

7 maxdepth float(24) maximum depth of event

8 minmag float(24) minimum magnitude

9 maxmag float(24) maximum magnitude

10 magtype varchar2(4) magnitude type

11 minmb_ms float(24) minimum value of mb minus Ms

12 maxmb_ms float(24) maximum value of mb minus Ms

13 mindep_err float(24) minimum value of depth minus error

14 maxdep_err float(24) maximum value of depth minus error

15 minesd float(24) minimum event-station distance

16 maxesd float(24) maximum event-station distance

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

Category: Data Services

Keys: Primary prodid

Data: Descriptive minlat, maxlat, minlon, maxlon, mindepth, maxdepth, minmag, maxmag, magtype, minmb_ms, maxmb_ms, mindep_err, maxdep_err, minesd, maxesd

143b e r 2 0 0 2

144

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

P R O D U C T T Y P E S T A

The producttypesta table contains the criteria used for defining subscription products with constraints that are based on the station. If a user requests a subscription for multiple stations, the table will have one productcriteria row, but multiple producttypesta rows (one for each station); all of the producttypesta rows will have a common value of prodid.

Category: Data Services

Keys: Primary prodid/sta/chan

Data: Descriptive minlat, maxlat, minlon, maxlon, sta, chan

TABLE 88: PRODUCTTYPESTA

Column Storage Type Description

1 prodid number(8) product identifier

2 minlat float(24) minimum station latitude

3 maxlat float(24) maximum station latitude

4 minlon float(24) minimum station longitude

5 maxlon float(24) maximum station longitude

6 sta varchar2(6) station name

7 chan varchar2(8) channel name

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

Q C S T A T S

The qcstats table contains waveform data quality statistics.

TABLE 89: QCSTATS

Column Storage Type Description

1 qcstatsid number(8) data quality statistics identifier

2 sta varchar2(6) station name

3 chan varchar2(8) channel name

4 time float(53) interval start time

5 jdate number(8) Julian date

6 endtime float(53) interval end time

7 dettime float(53) detection interval start time

8 detendtime float(53) detection interval end time

9 missing float(53) amount of missing data

10 dropped number(8) flag indicating if interval was dropped

11 nseg number(8) number of masked segments

12 masked float(53) amount of data in masked segments

13 pointspike float(53) amount of data in masked due to point-spikes

14 spike float(53) amount of data in masked due to spikes

15 nconstseg number(8) number of constant valued segments

16 const float(53) amount of data masked due to constant valued seg-ments

17 avgconstval float(53) average value in constant segments

18 stdconstval float(53) standard deviation of constant values

19 auth varchar2(15) author

20 lddate date load date

145b e r 2 0 0 2

146

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

Category: System Monitoring

Keys: Primary qcstatsid

Data: Descriptive sta, chan Measurement time, jdate, endtime, dettime, detendtime, missing,

dropped, nseg, masked, pointspike, spike, nconstseg, const, avgconstval, stdconstval

Administrative auth, lddate

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

R E B D O N E _ D A T A D A Y _ F L A G

The rebdone_dataday_flag table contains the status of Reviewed Event Bulletin (REB) bulletin generation.

Category: Interactive Processing

Keys: Primary dataday

Data: Descriptive state Measurement dataday, donetime Administration lddate

TABLE 90: REBDONE_DATADAY_FLAG

Column Storage Type Description

1 dataday number(12) Julian day

2 state varchar2(12) state of processing

3 donetime float(53) time that REB was produced

4 lddate date load date

147b e r 2 0 0 2

148

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

R E F _ L O C

The ref_loc table contains reference locations for comparing origins to known geo-graphic locations. This table is used by the ExAnComp application.

Category: System Monitoring

Keys: Primary refid

Data: Descriptive refname, lat, lon, descrip Administrative lddate

TABLE 91: REF_LOC

Column Storage Type Description

1 refid number(8) reference location identifier

2 refname varchar2(16) reference location name

3 lat float(24) latitude

4 lon float(24) longitude

5 descrip varchar2(80) description

6 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

R E G C O E F

The regcoef table contains linear coefficients for regional processing.

Category: Fundamental

Keys: Primary rcoefid/rcoeftype

Data: Descriptive ondate, offdate, rcoefvalue Administrative lddate

TABLE 92: REGCOEF

Column Storage Type Description

1 rcoefid varchar2(20) linear coefficient set identifier

2 rcoeftype varchar2(10) linear coefficient value identifier

3 rcoefvalue float(24) linear coefficient value

4 ondate number(8) Julian start date

5 offdate number(8) Julian stop date

6 lddate date load date

149b e r 2 0 0 2

150

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

R E M A R K

The remark table contains comments. This table may be used to store free-form com-ments that embellish records of other tables. The commid field in many tables refers to a record in the remark table. If commid is null (–1) in a record of any other table, no com-ments are stored for that record.

Category: Database and Utility

Keys: Primary commid/lineno

Data: Descriptive lineno, remark Administrative lddate

TABLE 93: REMARK

Column Storage Type Description

1 commid number(8) comment identifier

2 lineno number(8) comment line number

3 remark varchar2(80) free-format comment

4 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

R E Q U E S T

The request table defines segments of auxiliary waveform data to be acquired. The start_time, end_time, sta and chan fields define a single unit of data. Data import pro-grams must succeed in acquiring all the data for a time interval before changing the state to indicate success.

TABLE 94: REQUEST

Column Storage Type Description

1 reqid number(8) request identifier

2 sta varchar2(6) station code

3 chan varchar2(8) channel code

4 array varchar2(8) array code

5 orid number(8) origin identifier

6 evid number(8) event identifier

7 start_time float(53) starting time of requested waveform data

8 end_time float(53) ending time of requested waveform data

9 class varchar2(16) type of request

10 state varchar2(16) current request status

11 statecount number(8) number of failed attempts (when state = failed)

12 complete number(8) percentage of data acquired

13 requestor varchar2(15) original author of record

14 modtime float(53) time of last state change (epoch time)

15 modauthor varchar2(15) author of last state change

16 lddate date load date

151b e r 2 0 0 2

152

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

Category: Data Services

Keys: Primary reqid Alternate sta/chan/start_time/end_time Foreign orid, evid

Data: Descriptive sta, chan, array, class requestor, modauthor Measurement start_time, end_time, state, statecount, complete,

modtime Administrative lddate

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

R E V A U D I T

The revaudit table keeps a history of the revisions made to an event.

Category: Interactive processing

Keys: Primary revid Foreign revtagid1, revtagid2

Data: Descriptive revfunction, auth, revtagname1, revtagname2, revstate Administrative lddate

TABLE 95: REVAUDIT

Column Storage Type Description

1 revid number(8) revision identifier

2 revfunction varchar2(32) name of the revision function used

3 auth varchar2(15) author (originator) of the revision

4 revtagid1 number(8) revtagname1 value; the value of the for-eign key identified in revtagname1

5 revtagname1 varchar2(8) revtagname1 type; the name of the for-eign key whose value is revtagid1

6 revtagid2 number(8) revtagname2 value; the value of the for-eign key identified in revtagname2

7 revtagname2 varchar2(8) revtagname2 type; the name of the for-eign key whose value is revtagid2

8 revstate varchar2(16) state of the revision

9 lddate date load date

153b e r 2 0 0 2

154

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

S C A N _ D A T E

The scan_date table is used to track which data days were scanned for events missed by the automatic system.

Category: Interactive Processing

Keys: Primary jdate

Data: Descriptive scan Measurement jdate

TABLE 96: SCAN_DATE

Column Storage Type Description

1 jdate number(8) Julian date

2 scan varchar2(1) scanning status = y, n

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

S E I S G R I D , D S E I S G R I D

The seisgrid table contains a natural seismicity grid, which includes the average number of events per year with magnitude greater than the threshold in this table for each lati-tude-longitude grid point (the grid points are defined in the seisindex table). The seisgrid

table is used by the AEQ application to help identify anomalous events.

Category: Automatic Processing

Keys: Primary grdname/icell

Data: Descriptive grdname, icell, magth, magtype Measurement nevyr Administrative lddate

TABLE 97: SEISGRID (DSEISGRID)

Column Storage Type Description

1 grdname varchar2(6) grid name

2 icell number(8) grid cell index

3 magth float(24) magnitude threshold

4 magtype varchar2(6) magnitude type

5 nevyr float(24) average number of events/year

6 lddate date load date

155b e r 2 0 0 2

156

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

S E I S I N D E X , D S E I S I N D E X

The seisindex table contains the geographic grids of natural seismicity data in the seisgrid

table. The dseisindex table contains the geographic grids of seismicity data in the dseis-

grid table. The seisindex table is used by the AEQ application to help identify anomalous events.

Category: Automatic Processing

Keys: Primary grdname

Data: Descriptive grdname, lat1, lon1, dlat, dlon, nlat, nlon, orderby Administrative lddate

TABLE 98: SEISINDEX (DSEISINDEX)

Column Storage Type Description

1 grdname varchar2(6) grid name

2 lat1 float(24) initial latitude

3 lon1 float(24) initial longitude

4 dlat float(24) latitude increment

5 dlon float(24) longitude increment

6 nlat number(8) number of latitudes

7 nlon number(8) number of longitudes

8 orderby varchar2(6) order by (either latitude or longitude)

9 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

S E N S O R

The sensor table contains calibration information for specific sensor channels. This table provides a record of updates in the calibration factor or clock error of each instrument and links a sta/chan/time to a complete instrument response in the table instrument. Waveform data are converted into physical units through multiplication by the calib field located in wfdisc. The correct value of calib may not be accurately known when the wfdisc record is entered into the database. The sensor table provides the mechanism (cal-ratio and calper) to “update” calib, without requiring possibly hundreds of wfdisc records to be updated. Through the foreign key inid, this table is linked to instrument, which has fields pointing to flat files holding detailed calibration information in a variety of for-mats (see instrument).

TABLE 99: SENSOR

Column Storage Type Description

1 sta varchar2(6) station code

2 chan varchar2(8) channel code

3 time float(53) epoch time of start of recording period

4 endtime float(53) epoch time of end of recording period

5 inid number(8) instrument identifier

6 chanid number(8) channel identifier

7 jdate number(8) Julian date

8 calratio float(24) calibration

9 calper float(24) calibration period

10 tshift float(24) correction of data processing time

11 instant varchar2(1) (y, n) discrete/continuing snapshot

12 lddate date load date

157b e r 2 0 0 2

158

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

Category: Core, Reference

Keys: Primary sta/chan/time/endtime Foreign inid, chanid

Data: Descriptive sta, chan, instant Measurement time, endtime, jdate, calratio, calper, tshift Administrative lddate

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

S I T E

The site table contains station location information. Site names and describes a point on the earth where measurements are made (for example, the location of an instrument or array of instruments). It contains information that normally changes infrequently, such as location. In addition, site contains fields that describe the offset of a station relative to an array reference location. Global data integrity implies that the sta/ondate in site be con-sistent with the sta/chan/ondate in sitechan.

Category: Core, Reference

Keys: Primary sta/ondate

Data: Descriptive sta, staname, statype, refsta Measurement ondate, offdate, lat, lon, elev, dnorth, deast Administrative lddate

TABLE 100: SITE

Column Storage Type Description

1 sta varchar2(6) station identifier

2 ondate number(8) Julian start date

3 offdate number(8) Julian off date

4 lat float(24) latitude

5 lon float(24) longitude

6 elev float(24) elevation

7 staname varchar2(50) station description

8 statype varchar2(4) station type: single station, array

9 refsta varchar2(6) reference station for array members

10 dnorth float(24) offset from array reference (km)

11 deast float(24) offset from array reference (km)

12 lddate date load date

159b e r 2 0 0 2

160

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

S I T E _ A D D R E S S

The site_address table contains address information not included in the site table.

Category: Reference

Keys: Primary sta

Data: Descriptive sta, name, locality, stat_prov, country Administrative lddate

TABLE 101: SITE_ADDRESS

Column Storage Type Description

1 sta varchar2(6) station name

2 name varchar2(20) expanded station name

3 locality varchar2(40) locality of station

4 stat_prov varchar2(40) state or province

5 country varchar2(40) country name

6 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

S I T E A U X

The siteaux table contains additional site-dependent parameters that are not included in the site table.

Category: Reference

Keys: Primary sta/chan/time Foreign commid

Data: Descriptive sta, chan Measurement time, nois, noissd, amcor, amcorsd, snthrsh, rely,

ptmcor, stmcor, staper Administrative auth, lddate

TABLE 102: SITEAUX

Column Storage Type Description

1 sta varchar2(6) station code

2 chan varchar2(8) channel code

3 time float(53) epoch time

4 nois float(24) noise amplitude

5 noissd float(24) standard deviation of log noise

6 amcor float(24) amplitude correction

7 amcorsd float(24) correction standard deviation

8 snthrsh float(24) signal/noise detection threshold

9 rely float(24) station reliability

10 ptmcor float(24) P arrival time correction

11 stmcor float(24) S arrival time correction

12 staper float(24) period for measurements

13 auth varchar2(15) author

14 commid number(8) comment identifier

15 lddate date load date

161b e r 2 0 0 2

162

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

S I T E C H A N

The sitechan table contains station-channel information. This table describes the orienta-tion of a recording channel at the site referenced by sta. It provides information about the various channels that are available at a station and maintains a record of the physical channel configuration at a site.

Category: Core, Reference

Keys: Primary sta/chan/ondate Alternate chanid

Data: Descriptive sta, chan, ctype, descrip Measurement ondate, offdate, edepth, hang, vang Administrative lddate

TABLE 103: SITECHAN

Column Storage Type Description

1 sta varchar2(6) station identifier

2 chan varchar2(8) channel identifier

3 ondate number(8) Julian start date

4 chanid number(8) channel identifier

5 offdate number(8) Julian off date

6 ctype varchar2(4) channel type

7 edepth float(24) emplacement depth

8 hang float(24) horizontal angle

9 vang float(24) vertical angle

10 descrip varchar2(50) channel description

11 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

S I T E P O L L

The sitepoll table contains the station and channel names of auxiliary seismic stations that are polled periodically for system monitoring purposes.

Category: Data Services

Keys: Primary sta/net/chan

Data: Descriptive sta, net, chan Administrative lddate

TABLE 104: SITEPOLL

Column Storage Type Description

1 sta varchar2(6) station name

2 net varchar2(6) network name

3 chan varchar2(6) channel name

4 lddate date load date

163b e r 2 0 0 2

164

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

S P L P

The splp table contains event characterization parameters for short-period/long-period energy ratios. The ratios are computed using the DFX application.

Category: Fundamental

Keys: Primary orid/sta

Data: Descriptive sta, rectype Measurement ratio Administrative lddate

TABLE 105: SPLP

Column Storage Type Description

1 orid number(8) origin identifier

2 sta varchar2(6) station name

3 rectype varchar2(8) recipe type

4 ratio float(24) ratio of short-period to long-period energy

5 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

S P V A R

The spvar table contains the variance of the detrended log spectrum between fmin and fmax for an arrival identified by arid. The frequency bandwidth is based on a signal-to-noise ratio criterion. Each phase associated with an event has a spvar record.

Category: Fundamental

Keys: Primary arid/fmin/fmax Foreign fsid

Data: Measurement acoef, bcoef, ccoef, fmin, fmax, svar Administrative lddate

TABLE 106: SPVAR

Column Storage Type Description

1 arid number(8) arrival identifier

2 fsid number(8) Fourier spectrum identifier

3 acoef float(24) “a” coefficient for nonlinear trend

4 bcoef float(24) “b” coefficient for nonlinear trend

5 ccoef float(24) “c” coefficient for nonlinear trend

6 fmin float(24) minimum frequency

7 fmax float(24) maximum frequency

8 svar float(24) variance of detrended log spectrum

9 lddate date load date

165b e r 2 0 0 2

166

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

S R E G I O N

The sregion table contains seismic region numbers and their equivalent descriptions (see [Fli74]).

Category: Core, Reference

Keys: Primary srn

Data: Descriptive srn, srname Administrative lddate

TABLE 107: SREGION

Column Storage Type Description

1 srn number(8) seismic region number

2 srname varchar2(40) seismic region name

3 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

S T A M A G

The stamag table contains station magnitude estimates based upon measurements made on specific seismic phases. Values in stamag are used to calculate network magnitudes stored in netmag.

TABLE 108: STAMAG

Column Storage Type Description

1 magid number(8) magnitude identifier

2 ampid number(8) amplitude identifier

3 sta varchar2(6) station code

4 arid number(8) arrival identifier

5 orid number(8) origin identifier

6 evid number(8) event identifier

7 phase varchar2(8) associated phase

8 delta float(24) station-to-event distance

9 magtype varchar2(6) magnitude type (ml, ms, mb, and so on)

10 magnitude float(24) magnitude

11 uncertainty float(24) magnitude uncertainty

12 magres float(24) magnitude residual

13 magdef varchar2(1) “d” or “n” flag indicating if magnitude is defining or nondefining

14 mmodel varchar2(15) magnitude model

15 auth varchar2(15) author

16 commid number(8) comment identifier

17 lddate date load date

167b e r 2 0 0 2

168

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

Category: Core, Fundamental

Keys: Primary magid/ampid/sta Foreign arid, orid, evid, commid

Data: Descriptive delta, sta, phase, magtype, magdef, mmodel Measurement magnitude, uncertainty, magres Administrative auth, lddate

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

S T A S S O C

The stassoc table contains summary information about groups of related arrivals. This table defines the group of phases seen at a single station from the same event.

Category: Core, Fundamental

Keys: Primary stassid Foreign commid

Data: Descriptive sta, etype, location Measurement dist, azimuth, lat, lon, depth, time, imb, ims, iml Administrative auth, lddate

TABLE 109: STASSOC

Column Storage Type Description

1 stassid number(8) stassoc identifier

2 sta varchar2(6) station code

3 etype varchar2(7) event type

4 location varchar2(32) apparent location description

5 dist float(24) estimated distance

6 azimuth float(24) estimated azimuth

7 lat float(24) estimated latitude

8 lon float(24) estimated longitude

9 depth float(24) estimated depth

10 time float(53) estimated origin time

11 imb float(24) estimated mb

12 ims float(24) initial estimated Ms

13 iml float(24) initial estimated ML

14 auth varchar2(15) author

15 commid number(8) comment identifier

16 lddate date load date

169b e r 2 0 0 2

170

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

S T D _ C H A N M A P

The std_chanmap table contains standard channel name mappings between external and internal channel names.

Category: Data Services

Keys: Primary. ext_chan Foreign. int_chan

Data: Descriptive ext_chan, int_chan Measurement ondate, offdate Administrative lddate

TABLE 110: STD_CHANMAP

Column Storage Type Description

1 ext_chan varchar2(8) external channel name

2 int_chan varchar2(8) internal channel name

3 ondate number(8) Julian start date

4 offdate number(8) Julian off date

5 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

S U B S

The subs table is used by the Subscription Subsystem. It records what email address receives which products. In addition, it tracks the POC for the products.

Category: Data Services

Keys: Primary userid/prodid Foreign userid, prodid

Data: Descriptive intidtype, subsname, deliv_meth, status Measurement intid, subsid, prodid, address, ondate, offdate Administrative lddate

TABLE 111: SUBS

Column Storage Type Description

1 userid number(8) user identifier

2 intid number(8) internal identifier

3 intidtype varchar2(16) type of intid (usually msgid)

4 subsid number(8) subscription identifier

5 subsname varchar2(24) subscription name

6 prodid number(8) product identifier

7 address varchar2(64) FTP or email address of destination

8 deliv_meth varchar2(6) delivery method (email or ftp)

9 status varchar2(6) either “i,” interactive; or “a,” active

10 ondate date date subscription is “on”

11 offdate date date subscription is “off”

12 initialdate date initial date of subscription

13 lddate date load date

171b e r 2 0 0 2

172

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

S U B S U S E R

The subsuser table is used by the Subscription Subsystem to track authorized users of the system. A user is identified by the username and domain from the email header.

Category: Data Services

Keys: Primary userid

Data: Descriptive username, domain, status, pocid, priority Administrative lddate

TABLE 112: SUBSUSER

Column Storage Type Description

1 userid number(8) user identifier

2 username varchar2(24) user name from the incoming subscrip-tion message

3 domain varchar2(48) domain name from the incoming sub-scription message

4 status varchar2(24) status of this user

5 pocid number(8) point of contact identifier

6 priority number(2) user priority

7 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

T H I R D M O M

The thirdmom table contains the third moment of frequency and the percentage of signal frequency amplitudes greater than the corresponding noise frequency amplitudes for an arrival identified by arid. The measurements are used for event screening.

Category: Fundamental

Keys: Primary arid

Data: Descriptive sta, rectype Measurement tmf, tmfpct Administrative lddate

TABLE 113: THIRDMOM

Column Storage Type Description

1 arid number(8) arrival identifier

2 sta varchar2(6) station code

3 rectype varchar2(8) recipe identifier

4 tmf float(24) third moment of frequency

5 tmfpct float(24) percentage of signal spectrum amplitudes greater than noise spectrum amplitudes

6 lddate date load date

173b e r 2 0 0 2

174

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

TI M E F R E Q

The timefreq table contains the time-frequency measurements for event characterization.

Category: Fundamental

Keys: Primary orid/sta

Data: Descriptive sta, rectype Measurement zavpct, navpct, eavpct, xavpct, zavcep, navcep,

eavcep, zavcor, navcor, eavcor, xcor Administrative lddate

TABLE 114: TIMEFREQ

Column Storage Type Description

1 orid number(8) origin identifier

2 sta varchar2(6) station code

3 rectype varchar2(8) recipe identifier

4 zavpct float(24) ratio of bad points to total (vertical)

5 navpct float(24) ratio of bad points to total (north)

6 eavpct float(24) ratio of bad points to total (east)

7 xavpct float(24) ratio of bad points to total (cross-correla-tion)

8 zavcep float(24) average 2-D cepstrum max (vertical)

9 navcep float(24) average 2-D cepstrum max (north)

10 eavcep float(24) average 2-D cepstrum max (east)

11 zavcor float(24) average autocorrelation (vertical)

12 navcor float(24) average autocorrelation (north)

13 eavcor float(24) average autocorrelation (east)

14 xcor float(24) zero cross-correlation

15 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

TI M E S T A M P

The timestamp table is used for scheduling automatic processing of time-series data.

Category: Distributed Processing

Keys: Primary procclass/procname

Data: Descriptive procclass, procname, time Administrative lddate

TABLE 115: TIMESTAMP

Column Storage Type Description

1 procclass varchar2(16) process class

2 procname varchar2(16) process name

3 time float(53) last epoch time

4 lddate date load date

175b e r 2 0 0 2

176

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

WE I G H T S

The weights table is used to store weighting information for calculating the weights of REB events.

Category: Data Services

Keys: Primary phase/statype/net

Data: Descriptive tweight, aweight, sweight, ondate, offdate Administrative lddate

TABLE 116: WEIGHTS

Column Storage Type Description

1 phase varchar2(8) phase type

2 statype varchar2(4) station type (ar or ss)

3 net varchar2(8) unique network identifier

4 tweight float(24) time weight

5 aweight float(24) azimuth weight

6 sweight float(24) slowness weight

7 ondate number(8) Julian start date

8 offdate number(8) Julian off date

9 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

W F A U X

The wfaux table contains the length of a waveform file in bytes. The table should have a one-to-one relationship with the wfdisc table for those wfids where a length is required. This table is required by the Continuous Data Acquisition Subsystem to determine the lay-out of a diskloop file and should also provide better access to wfdisc records and better means of determining where and how much data are stored. Routines writing, updating, or deleting from this table should do so simultaneously with wfdisc.

Category: Fundamental

Keys: Primary wfid

Data: Descriptive length

TABLE 117: WFAUX

Column Storage Type Description

1 wfid number(8) waveform identifier

2 length number(10) waveform length, bytes

177b e r 2 0 0 2

178

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

W F C O N V

The wfconv table contains data translations that are to be performed on incoming data before they are written to disk by the DLMan application. Data compression types include “-” if the data are not compressed, or “CA” for Canadian compression. “Type” in columns intype and outtype is the fixed-width data type (for example, “s4”) or “-” if not applicable (that is, if the data are compressed). A “samp” value of zero (0) indicates that the number of samples varies. “Samp” values less than zero in columns insamp and out-samp indicate that the total number of samples must be evenly divisible by –samp. Striptells whether to strip the authentication headers from the data; “y” means strip them, “n” means do not.

TABLE 118: WFCONV

Column Storage Type Description

1 sta varchar2(6) station code

2 chan varchar2(8) channel code

3 chanid number(8) channel identifier

4 inauth varchar2(1) input authenticated (y or n)

5 incomp varchar2(2) input compression type

6 intype varchar2(2) input fixed-width data type

7 insamp number(8) input samples per packet

8 outauth varchar2(1) output authenticated (y or n)

9 outcomp varchar2(2) output compression type

10 outtype varchar2(2) output fixed-width data type

11 outsamp number(8) output samples per packet

12 strip varchar2(1) data stripped of headers

13 commid number(8) comment identifier

14 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

Category: Data Services

Keys: Primary sta/chan Alternate chanid Foreign commid

Data: Descriptive sta, chan, inauth, incomp, intype, insamp, outauth, outcomp, outtype, outsamp, strip

Administrative lddate

179b e r 2 0 0 2

W F D I S C , W F P R O T O

The wfdisc table contains a waveform header file and descriptive information. This table provides a pointer (or index) to waveforms stored on disk. The waveforms themselves are stored in ordinary disk files called wfdisc or “.w” files as a sequence of sample values (usually in binary representation). Wfproto is a view of the wfdisc table that is used to create temporary wfdisc files for the DLMan application.

TABLE 119: WFDISC (WFPROTO)

Column Storage Type Description

1 sta varchar2(6) station code

2 chan varchar2(8) channel code

3 time float(53) epoch time of first sample in file

4 wfid number(8) waveform identifier

5 chanid number(8) channel operation identifier

6 jdate number(8) Julian date

7 endtime float(53) time + (nsamp-1)/samprate

8 nsamp number(8) number of samples

9 samprate float(24) sampling rate in samples/sec

10 calib float(24) nominal calibration

11 calper float(24) nominal calibration period

12 instype varchar2(6) instrument code

13 segtype varchar2(1) indexing method

14 datatype varchar2(2) numeric storage

15 clip varchar2(1) clipped flag

16 dir varchar2(64) directory

17 dfile varchar2(32) data file

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

Category: Core, Fundamental

Keys: Primary sta/chan/time Alternate wfid Foreign chanid, commid

Data: Descriptive sta, chan, dir, dfile, foff Measurement time, jdate, endtime, nsamp, samprate, calib, calper,

instype, segtype, datatype, clip Administrative lddate

18 foff number(10) byte offset of data segment within file

19 commid number(8) comment identifier

20 lddate date load date

TABLE 119: WFDISC (WFPROTO) (CONTINUED)

Column Storage Type Description

181b e r 2 0 0 2

182

Chap te r 2 :

S /H/ I Tab le Desc r ip t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

W F T A G

The wftag table links various identifiers (for example, orid, arid, and stassid to wfid). Linkages can also be determined indirectly using sta, chan, and time. However, it is more efficient to use the wftag table.

Category: Core, Fundamental

Keys: Primary tagname/tagid/wfid

Data: Descriptive tagname Administrative lddate

TABLE 120: WFTAG

Column Storage Type Description

1 tagname varchar2(8) key (arid, orid, evid, and so on)

2 tagid number(8) tagname value

3 wfid number(8) waveform identifier

4 lddate date load date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 2 :

S /H/ I Tab le Desc r ip t i ons

X T A G

The xtag table links various identifiers (for example, orid, arid, stassid, and wfid to other identifiers). This table is a generalization of the wftag table, which is limited to linking exclusively to the wfid. The thisdb column describes the database account for the record specified by thisid and thisname; thatdb describes the database account for the record specified by thatid and thatname. When a parent/child relationship exists between the records, thisid should designate the parent, and thatid should designate the child.

Category: Database and Utility

Keys: Primary thisid/thisname

Data: Descriptive thisid, thatid, thisname, thatname, thisdb, thatdb Administrative lddate

TABLE 121: XTAG

Column Storage Type Description

1 thisid number(8) thisname identifier

2 thatid number(8) thatname identifier

3 thisname varchar2(8) key for thisid (grid, orid, ntid, and so on)

4 thatname varchar2(8) key for thatid (arid, orid, nfid, and so on)

5 thisdb varchar2(32) database account for the records speci-fied by thisid and thisname

6 thatdb varchar2(32) database account for the records speci-fied by thatid and thatname

7 lddate date load date

183b e r 2 0 0 2

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Chapter 3: S / H / I C o l u m n D e s c r i p t i o n s

This chapter describes the columns in the seismic, hydroacoustic, and infrasonic tables used at the PIDC and includes the following topics:

■ Ranges

■ NA Values

■ Columns

b e r 2 0 0 2 185

U s e r G u i d e sI D C D O C U M E N T A T I O N

186

Chapter 3: S / H / I C o l u m n D e s c r i p t i o n s

R A N G E S

Wherever possible, an explicit range is defined for each column. This range is important for data integrity and database management systems that automatically check ranges. When the range consists of a relatively small number of discreet values, the following notation is used:

column ∈ {value-1, value-2, …, value-n}

No range is documented for columns whose value may be any floating point number.

N A VA L U E S

Sometimes no information is available for a column. In that case, an “NA Value” (for Not Available) is assigned. An NA Value is outside the range of permissible or recom-mended values for the column. This special NA Value alerts users and applications that the desired column was not available when the record was created. For example, in the origin table, the column ms (surface wave magnitude) may be unknown for a given row. Then the NA Value for magnitudes (–999.0) should be assigned to ms, and msid should be set to –1, the NA Value for msid. Some columns are essential to defining a meaning-ful record, and they must be specified; the NA Value is not permitted. For example, the column time in arrival must be given a value in the valid range, not an NA Value. Another example is magnitude in netmag and stamag. Magnitude must be given a mean-ingful value for each record, so no NA Value is defined.

Some general guidelines and specific examples of NA Values are given in Table 122. These are only guidelines and NA values may not be unique to a particular column.

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

An NA Value should not be confused with an ORACLE “NULL.” NA Values are sup-plied by users, while ORACLE inserts the database value “NULL” when no value is specified. A column containing a database value of “NULL” appears blank when selected within SQL*Plus. When creating a table, a column may be constrained as “NOT NULL” to require the user to supply a value. The ORACLE describe command will identify such columns as “NOT NULL.” No correlation is intended between ORA-CLE “NOT NULL” requirements and IDC requirements that a column must be speci-fied.

C O L U M N S

Name: abbrev Table: Glossary Description: Abbreviation name. This is the term used in Origin (Originref,

Origin_temp_ga), Explo, and Remark tables in the EXPLOSION database.Format: varchar2(16) External: a16NA Value: NOT ALLOWEDRange: any string up to 16 characters

TABLE 122: GUIDELINES AND EXAMPLES OF NA VALUES

Column Type/Range NA Value Examples

character columns - (hyphen) bmtype, auth

non-negative integers –1 chanid, avid

non-negative real numbers –1.0 cfreq, deltim

real numbers > –999.0 –999.0 iml

large real numbers –9999999999.999, or +9999999999.999

endtime, time

187b e r 2 0 0 2

188

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: abbrevtype Table: Glossary Description: Abbreviation type. Unique abbreviation identifier: country code, data source,

explosion type, and test site.Format: varchar2(16) External: a16NA Value: - (hyphen)Range: any string up to 16 characters

Name: account Table: Dataready Description: Database account name. The tagid and tagname pointing to the data to be dis-

tributed by the Subscription Subsystem are in this database account.Format: varchar2(24) External: a24NA Value: - (hyphen)Range: any string up to 24 characters

Name: acoef Table: Spvar Description: Coefficient “a” of the quadratic trend of the log spectrum between frequencies

fmin and fmax. The spectrum is measured in nm-sec.Format: float(24) External: f7.2NA Value: NOT ALLOWEDRange: any floating point value

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: action Table: Allocate_hour Description: Analyst task performed on this time-block of data.Format: varchar2 (16) External: a16NA Value: NOT ALLOWEDRange: action ∈ {AfterSchock, Allocate, Bull_QC, Del_Pass, RebDone,

Scan_Pass}

Name: added Table: Ex_an Description: Number of phases added by an analyst to an expert system event solution. An

added phase is an arrival not available to the expert system.Format: number(8) External: i8NA Value: –1 Range: added ≥ 0

Name: address Table: Alphasite, Subs

Description: Internet protocol (IP) address of source of continuous data, for alphasite. FTP, and email address for subs.

Format: varchar2(16) for alphasite External: a16 varchar2(64) for subs

NA Value: NOT ALLOWEDRange: “0.0.0.0” – “255.255.255.255” for alphasite,

a valid email address for subs

189b e r 2 0 0 2

190

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: adef Table: Ev_summary (Ex_summary, An_summary)

Description: Number of associated nondefining phases. The observations for these phases are not used in the location solution.

Format: number(8) External: i8NA Value: –1 Range: adef ≥ 0

Name: afsid Table: Fsave, Fstag

Description: Average Fourier spectrum identifier. Each average spectrum is assigned a unique positive integer identifying it with unique fsid through fstag that are used in generating the average.

Format: number(8) External: i8NA Value: NOT ALLOWEDRange: afsid > 0

Name: algorithm Table: Origin (Originref, Origin_temp_ga) Description: Location algorithm used. This column is a brief textual description of the

algorithm used for computing a seismic origin.Format: varchar2(15) External: a15NA Value: - (hyphen)Range: any string up to 15 characters

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: amcor Table: Siteaux Description: Site-dependent log amplitude correction.Format: float(24) External: f10.1NA Value: –999.0 Range: amcor > –999.0

Name: amcorsd Table: Siteaux Description: Standard deviation for log amplitude correction.Format: float(24) External: f5.2NA Value: –1.0 Range: amcorsd > 0.0

Name: amp Table: Amplitude, Arrival

Description: Measured amplitude defined by amptype.

Format: float(24) External: f11.2NA Value: –1.0 Units: nanometers or dimensionless depending on the type of channelRange: amp > 0.0

191b e r 2 0 0 2

192

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: ampid Table: Amplitude, Stamag Description: Amplitude identifier. Every amplitude measure is assigned a unique positive

integer that identifies it in the database. If an associated stamag record exists, then ampid links it to amplitude.

Format: number(8) External: i8NA Value: NOT ALLOWED in amplitude

–1 in stamag

Range: ampid > 0

Name: amplr Table: Apma Description: Maximum 3-component amplitude for all overlapping time windows used in

the polarization analysis. This column is equal to the sum of the square roots of the eigenvalues. The only difference between amps and amplr is in the defi-nition of the overlapping time windows.

Format: float(24) External: f7.2NA Value: –1.0 Units: nanometersRange: amplr > 0.0

Name: ampp Table: Apma Description: 3-component amplitude measured at the time of the maximum rectilinearity.

This column is equal to the sum of the square roots of the eigenvalues (that is, it is the sum of the amplitudes measured along the three axes of the polariza-tion ellipsoid).

Format: float(24) External: f7.2NA Value: –1.0 Units: nanometersRange: ampp > 0.0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: amps Table: Apma Description: Maximum 3-component amplitude for all overlapping time windows used in

the polarization analysis. This column is equal to the sum of the square roots of the eigenvalues. The only difference between amps and amplr is in the defi-nition of the overlapping time windows.

Format: float(24) External: f7.2NA Value: –1.0 Units: nanometersRange: amps > 0.0

Name: amptime Table: Amplitude Description: Epoch time of amplitude measure. Format: float(53) External: f17.5NA Value: –9999999999.999 Units: seconds Range: any valid epoch time

Name: amptype Table: Ampdescript, Amplitude

Description: Amplitude measure descriptor. This descriptor is used to uniquely identify an amplitude measurement and link the description in ampdescript with actual measurements in amplitude.

Format: varchar2(8) External: a8NA Value: - (hyphen)Range: any free-format string up to eight characters

193b e r 2 0 0 2

194

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: antype Table: Origaux Description: Analysis type for this solution. Examples are automatic (a), manual (m), and

ground truth (g).Format: varchar2(1) External: a1NA Value: - (hyphen)Range: antype ∈ {a, m, g}

Name: apmarid Table: Apma Description: Unique apma recipe identifier. Each arrival in apma is assigned a positive

integer identifying it with the recipe used in the polarization analysis.Format: number(8) External: i8NA Value: NOT ALLOWEDRange: apmarid > 0

Name: archid Table: Arch_data_type Description: Archive identifier. Format: number(8) External: i8NA Value: NOT ALLOWEDRange: archid > 0

Name: archived Table: Dlfile Description: Status of data archiving; archiving (a), yes (y), or no (n).Format: varchar2(1) External: a1NA Value: - (hyphen)Range: archived ∈ {a, n, y}

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: archiveport Table: Dlman Description: Archiver port.Format: number(6) External: i6NA Value: –1 Range: 0 ≤ archiveport ≤ 16383

Name: arid Table: Amp3c, Amplitude, Apma, Arrival, Assoc (Assoc_temp_ga), Detection, Fkdisc,

Fsdisc, Hydro_assoc, Hydro_features, Infra_features, Spvar, Stamag, Thirdmom

Description: Arrival identifier. Each arrival is assigned a unique positive integer identify-ing it with a unique sta, chan, and time.

Format: number(8) External: i8NA Value: NOT ALLOWED

–1 for stamag, fsdisc Range: arid > 0

Name: array Table: Request

Description: Array code. Network or station name.Format: varchar2(8) External: a8NA Value: NOT ALLOWEDRange: any string matching the net column in Affiliation (Stanet)

195b e r 2 0 0 2

196

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: asstr Table: Bull_comp Description: Association strength of two events: strong (s) or weak (w). An origin (origin1)

is strongly associated with an origin in the other database account (origin2) if three or more defining detections for origin1 are also associated with origin2, or all defining detections for origin1 are also associated with origin2. If events are associated only by time and location (no arrivals available) then asstr is set to w.

Format: varchar2(1) External: a1NA Value: NOT ALLOWEDRange: asstr ∈ {s, w}

Name: asta Table: Ev_summary (Ex_summary, An_summary) Description: Number of associated arrivals from regional arrays. “Regional” is currently

defined as a station-event distance not less than 250 km and up to 2,000 km.Format: number(8) External: i8NA Value: –1 Range: asta ≥ 0

Name: attenid Table: Attencoef Description: Attenuation coefficient set identifier. Each set of attenuation coefficients is

assigned a unique positive integer to identify the change history. Format: varchar2(20) External: a20NA Value: - (hyphen)Range: any valid string up to 20 characters

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: attribute Table: Na_value Description: Name of the column to which a NA value is to be assigned.Format: varchar2(30) External: a30NA Value: NOT ALLOWEDRange: any string up to 30 characters that is a valid column in this schema

Name: auth Table: Allocate_hour, Amplitude, Apma, Arrival, Discard, Event, Explo,

Infra_features, Location, Netmag, Network, Origin (Originref, Origin_temp_ga), Outage, Revaudit, Siteaux, Stamag, Stassoc

Description: Author, the originator of the data. Auth may also identify an application gener-ating the record, such as an automated interpretation or signal-processing pro-gram.

Format: varchar2(15) External: a15 varchar2(16) for allocate_hour

NA Value: - (hyphen)Range: any string up to 15 characters

Name: author Table: Fileproduct (Fs_stageproduct) Description: Author of the file product.Format: varchar2(16) External: a16NA Value: - (hyphen)Range: any string up to 16 characters

197b e r 2 0 0 2

198

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: auxid Table: Outage Description: Auxiliary identification code.Format: varchar2(4) External: a4NA Value: - (hyphen)Range: any valid auxiliary code up to four characters

Name: available Table: Outage Description: Flag to specify if data are available (t) or unavailable (f).Format: varchar2(1) External: a1NA Value: NOT ALLOWEDRange: available ∈ {t, f}

Name: ave_noise Table: Hydro_features Description: Average pressure of the noise segment.Format: float(24) External: f9.4NA Value: –1.0 Units: dB re µPaRange: ave_noise > 0.0

Name: avgconstval Table: Qcstats Description: Average value of data in masked constant segments.Format: float(53) External: f17.5NA Value: –999.0 Units: same as waveform dataRange: aveconstval Š 0.0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: avtype Table: Fsave Description: Description of averaged spectrum. This value is used as the channel name.Format: varchar2(8) External: a8NA Value: NOT ALLOWEDRange: avtype ∈ {mean, median, 95 pct, 5 pct}

Name: aweight Table: Weights Description: Azimuth weight.Format: float(24) External: f5.2NA Value: 0.0 Range: aweight Š 0.0

Name: az1 Table: Hydro_arr_group Description: Azimuth estimated from the time lags of arrivals in a hydro-arrival group.Format: float(24) External: f7.2NA Value: –1.0 Units: degreesRange: 0.0 ≤ az1 < 360.0

199b e r 2 0 0 2

200

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: az2 Table: Hydro_arr_group Description: Azimuth estimated from the time lags of arrivals in a hydro-arrival group.

This second azimuth estimate is only needed when only two arrivals exist in a group, which results in an ambiguity between two equally likely azimuths. The error is the same for the two azimuths.

Format: float(24) External: f7.2NA Value: –1.0 Units: degreesRange: 0.0 ≤ az2 < 360.0

Name: azcontrib Table: Hydro_assoc Description: Flag that specifies if an arrival that belongs to a hydro arrival group was used

to calculate the azimuth.Format: varchar2(1) External: a1NA Value: - (hyphen)Range: azcontrib ∈ {y, n}

Name: azdef Table: Assoc (Assoc_temp_ga) Description: Azimuth-defining code. The one-character flag indicates whether or not the

azimuth of a phase was used to constrain the event location solution. This col-umn is defining (azdef = d) if it was used in the location, nondefining (azdef = n) if it was not.

Format: varchar2(1) External: a1NA Value: - (hyphen)Range: azdef ∈ {d, n}

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: azimuth Table: Arrival, Parrival, Stassoc

Description: Observed azimuth. This value is the estimated station-to-event azimuth mea-sured clockwise from North. The estimate is made from f-k or polarization analysis. In stassoc, the value may be an analyst estimate.

Format: float(24) External: f7.2NA Value: –1.0 Units: degreesRange: 0.0 ≤ azimuth < 360.0

Name: azres Table: Allow_resid, Assoc (Assoc_temp_ga)

Description: Azimuth residual. The value is the difference between the measured station-to-event azimuth for an arrival and the true azimuth. The true azimuth is the bearing to the inferred event origin.

Format: float(24) External: f7.1NA Value: –999.0 Units: degreesRange: –180.0 ≤ azres ≤ 180.0

201b e r 2 0 0 2

202

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: band Table: Instrument Description: Frequency band. The value is a qualitative indicator of frequency passband

for an instrument. Values should reflect the response curve rather than just the sample rate. Recommended values are as follows: s (short-period) m (mid-period) i (intermediate-period) l (long-period) b (broadband) h (high-frequency, very short-period) v (very long-period) For a better notion of the instrument characteristics, see the instrument response curve.

Format: varchar2(1) External: a1NA Value: - (hyphen)Range: band ∈ {s, m, i, l, b, h, v}

Name: bandw Table: Amplitude, Detection, Fkdisc

Description: Frequency bandwidth.Format: float(24) External: f7.3NA Value: –1.0 Units: HertzRange: bandw > 0.0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: bcoef Table: Spvar

Description: Coefficient “b” of the quadratic trend of the log spectrum between frequencies fmin and fmax. The spectrum is measured in nm-sec.

Format: float(24) External: f7.2NA Value: NOT ALLOWEDRange: any floating point value

Name: begin_date Table: Participation Description: Beginning date of station participation in a particular net.Format: number(8) External: i8NA Value: NOT ALLOWEDRange: any valid Julian date (yyyyddd)

Name: belief Table: Assoc (Assoc_temp_ga) Description: Phase identification confidence level. The value is a qualitative estimate of

the confidence that a seismic phase is correctly identified.Format: float(24) External: f4.2NA Value: –1.0 Range: 0.0 ≤ belief ≤ 1.0

Name: bmtyp Table: Detection Description: String indicating a coherent (coh), incoherent (inc), or horizontal (hor)

beam type.Format: varchar2(4) External: a4NA Value: - (hyphen)Range: bmtyp ∈ {coh, inc, hor}

203b e r 2 0 0 2

204

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: bordercolor Table: Mapdisc Description: Map border color name. A solid colored border may appear on the top, bot-

tom, and right of any raster map.Format: varchar2(32) External: a32NA Value: - (hyphen)Range: any string up to 32 characters that forms a valid X11 color name (for example,

black)

Name: calib Table: Wfdisc (Wfproto) Description: Calibration factor. The value is the conversion factor that maps digital data to

earth displacement. The factor holds true at the oscillation period specified by the column calper. A positive value means ground motion increasing in com-ponent direction (up, north, east) is indicated by increasing counts. A negative value means the opposite. Calib generally reflects the best calibration infor-mation available at the time of recording, but refinement may be given in Sen-sor, reflecting a subsequent recalibration of the instrument (see calratio).

Format: float(24) External: f16.6NA Value: NOT ALLOWEDUnits: nanometers/digital countRange: any nonzero floating point number

Name: calper Table: Sensor, Wfdisc (Wfproto) Description: Calibration period. This gives the period for which calib, ncalib, and calratio

are valid.Format: float(24) External: f16.6NA Value: NOT ALLOWEDUnits: secondsRange: calper > 0.0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: calratio Table: Sensor Description: Calibration conversion ratio. The value is a dimensionless calibration correc-

tion factor that permits small refinements to the calibration correction made using calib and calper from the Wfdisc (Wfproto) table. Often, the wfdisc calibcontains the nominal calibration assumed at the time of data recording. If the instrument is recalibrated, calratio provides a mechanism to update calibra-tions from wfdisc with the new information without modifying the wfdisctable. A positive value means ground motion increasing in component direc-tion (up, north, east) is indicated by increasing counts. A negative value means the opposite. Calratio is meant to reflect the most accurate calibration information for the time period for which the sensor record is appropriate, but the nominal value may appear until other information is available.

Format: float(24) External: f16.6NA Value: NOT ALLOWEDRange: any nonzero floating point number

Name: ccoef Table: Spvar Description: Coefficient “c” of the quadratic trend of the log spectrum between frequencies

fmin and fmax. The spectrum is measured in nm-sec.Format: float(24) External: f7.2NA Value: NOT ALLOWEDRange: any floating point value

205b e r 2 0 0 2

206

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: cep_delay_time_signal Table: Hydro_features Description: Bubble pulse delay time estimate where the cepstrum is computed from the

NSE-detrended spectrum.Format: float(24) External: f9.4NA Value: –1.0 Units: secondsRange: cep_delay_time_signal > 0.0

Name: cep_delay_time_trend Table: Hydro_features Description: Bubble pulse delay time estimate where the cepstrum is computed from the

trend of NSE-detrended spectrum.Format: float(24) External: f9.4NA Value: –1.0 Units: secondsRange: cep_delay_time_trend > 0.0

Name: cep_peak_std_signal Table: Hydro_features Description: Number of standard deviations from the mean for the largest cepstrum ampli-

tude where the cepstrum is computed from the NSE-detrended spectrum.Format: float(24) External: f9.4NA Value: –1.0 Units: standard deviationsRange: cep_peak_std_signal > 0.0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: cep_peak_std_trend Table: Hydro_features Description: Number of standard deviations from the mean for the largest cepstrum ampli-

tude where the cepstrum is computed with the trend of the NSE-detrended spectrum.

Format: float(24) External: f9.4NA Value: –1.0 Units: standard deviationsRange: cep_peak_std_trend > 0.0

Name: cep_var_signal Table: Hydro_features Description: Variance of the cepstrum computed using NSE-detrended spectrum.Format: float(24) External: f9.4NA Value: –1.0 Units: secondsRange: cep_var_signal > 0.0

Name: cep_var_trend Table: Hydro_features Description: Variance of the cepstrum computed using the trend from the NSE-detrended

spectrum.Format: float(24) External: f9.4NA Value: –1.0 Units: standard deviationsRange: cep_var_trend > 0.0

207b e r 2 0 0 2

208

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: cfreq Table: Amp3c, Detection, Fkdisc

Description: Center frequency of a beam or f-k spectrum.Format: float(24) External: f7.2NA Value: –1.0 Units: HertzRange: cfreq > 0.0

Name: chan Table: Amplitude, Arrival, Attencoef, Beamaux, Chan_groups, Detection, Dlfile,

Evsc_regional, Fileproduct (Fs_stageproduct), Forbeamaux, Fsdisc, Fwgap, Outage, Producttypesta, Qcstats, Request, Sensor, Siteaux, Sitechan, Sitepoll, Wfconv, Wfdisc (Wfproto)

Description: Channel identifier. The value is an eight-character code that specifies a partic-ular channel within a network (station), which, taken together with sta and time, uniquely identifies seismic timeseries data, including the geographic location, spatial orientation, sensor, and subsequent data processing (beam channel descriptor).

Format: varchar2(8) External: a8 varchar2(6) for sitepoll

NA Value: NOT ALLOWEDRange: any lower-case string up to eight characters

Name: chanid Table: Arrival, Dlfile, Fsdisc, Sensor, Sitechan, Wfconv, Wfdisc (Wfproto) Description: Channel recording identifier. The value is a surrogate key used to uniquely

identify a specific recording. Chanid duplicates the information of the com-pound key sta, chan, time.

Format: number(8) External: i8NA Value: –1 Range: chanid > 0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: class Table: Chan_groups, Interval, Problem, Request

Description: Problem class or object class for interval and request.

Format: varchar2(16) External: a16 varchar2(33) for problem

NA Value: - (hyphen)Range: any free-format string up to the character limit

Name: clip Table: Amplitude, Arrival, Wfdisc (Wfproto) Description: Clipped data flag. The value is a single-character flag to indicate whether (c)

or not (n) the data were clipped. Format: varchar2(1) External: a1NA Value: - (hyphen)Range: clip ∈ {c, n}

Name: clrpth Table: Evsc_prod Description: Hydroacoustic clear-path flag. Set to ‘1’ if all paths within the location error

ellipse are clear to at least one hydroacoustic station in a given set.Format: number(1) External: i1NA Value: –1 Range: clrpth ∈ {0,1}

209b e r 2 0 0 2

210

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: coh_deldur Table: Infra_features

Description: Estimated standard deviation in coh_dur.Format: float(24) External: f7.2NA Value: –1.0 Units: secondsRange: coh_deldur > 0.0

Name: coh_dur Table: Infra_features

Description: Time period during which the spatial coherence (reckoned as F-Statistic) “beam” exceeded its threshold for the current time interval of spatial coher-ence in excess of its threshold value.

Format: float(24) External: f7.2NA Value: –999.0 Units: secondsRange: coh_dur > 0.0

Name: coh_per Table: Infra_features

Description: Dominant period of the spatially coherent signal. The value is estimated from the inverse of the frequency of the maximum power in a windowed spectrum of the traditional beamformed waveform data during the time interval defined by coinc_time and coh_dur.

Format: float(24) External: f7.2NA Value: –999.0 Units: secondsRange: coh_per > 0.0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: coh_snr Table: Infra_features

Description: Equivalent, equal channel, coherent signal-to-noise ratio; the inband power in the spatially coherent fraction of the arrival divided by the total inband non-coherent noise.

Format: float(24) External: f7.2NA Value: –1.0 Units: secondsRange: coh_snr > 0.0

Name: coh_time Table: Infra_features

Description: Earliest time at which the spatial coherence (determined as F-Statistic) “beam” exceeded its threshold for the current time interval of spatial coher-ence in excess of its threshold value.

Format: float(53) External: f17.5NA Value: –9999999999.999 Units: secondsRange: coh_time > –9999999999.999

Name: coinc_deldur Table: Infra_features

Description: Estimated standard deviation in coinc_dur.Format: float(24) External: f7.2NA Value: –1.0 Units: secondsRange: coinc_deldur > 0.0

211b e r 2 0 0 2

212

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: coinc_dur Table: Infra_features

Description: Time period during which both the STA/LTA on the traditional beam and the sample-by-sample F-Statistic beams exceed their respective thresholds for the current time interval of coincidence detection.

Format: float(24) External: f7.2NA Value: –999.0 Units: secondsRange: coinc_dur > 0.0

Name: coinc_time Table: Infra_features

Description: Earliest time at which the STA/LTA applied to the traditional beam and the spatial coherence “beam” both exceeded their respective thresholds for the current time interval of coincidence detection.

Format: float(53) External: f17.5NA Value: –9999999999.999 Units: secondsRange: coinc_time > –9999999999.999

Name: col_depth Table: Explo Description: Depth of collapse crater. Depth of the deepest point of the collapse crater rela-

tive to the original ground surface.Format: float(24) External: f7.4NA Value: –1 Units: kilometersRange: col_depth Š 0.0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: col_diameter Table: Explo Description: Diameter of collapse crater.Format: float(24) External: f7.4NA Value: –1 Units: kilometersRange: col_diameter Š 0.0

Name: col_interval Table: Explo Description: Collapse interval. Time interval after shot time of collapse, as determined by

geophone and television monitoring.Format: float(24) External: f10.0NA Value: –1 Units: secondsRange: col_interval Š 0.0

Name: col_volume Table: Explo Description: Volume of collapse crater.Format: float(24) External: f10.7NA Value: –1 Units: kilometers3

Range: col_volume Š 0.0

213b e r 2 0 0 2

214

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: colormapid Table: Colordisc, Mapcolor

Description: Colordisc identifier. Each colordisc is assigned a unique positive integer that identifies it in a database. The colormapid identifies color-lookup tables avail-able to maps.

Format: number(8) External: i8NA Value: NOT ALLOWEDRange: colormapid > 0

Name: colormapname Table: Colordisc Description: Colormap name that identifies the color-lookup table in a listing of available

tables.Format: varchar2(64) External: a64NA Value: NOT ALLOWEDRange: any string up to 64 characters

Name: colorname Table: Overlaydisc Description: Overlay color name.Format: varchar2(32) External: a32NA Value: - (hyphen)Range: any valid color name

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: command Table: Msgaux Description: Command that was being executed when the failure occurred. If this cannot

be determined, such as a caught signal from UNIX, then the value is set to “signal caught.”

Format: varchar2(24) External: a24NA Value: - (hyphen)Range: any string up to 24 characters

Name: commid

Table: Allocate_hour, Alphasite, Apma, Arrival, Assoc (Assoc_temp_ga), Channame, Datauser, Detection, Dlfile, Dlman, Event, Explo, Fkdisc, Fsave, Fsdisc, Infra_features, Location, Msgdisc, Netmag, Network, Origerr (Origerr_temp_ga), Origin (Originref, Origin_temp_ga), Outage, Remark, Siteaux, Stamag, Stassoc, Wfconv, Wfdisc (Wfproto)

Description: Comment identifier. The value is a key that points to free-form comments entered in the remark table. These comments store additional information about a record in another table. The remark table can have many records with the same commid and different lineno, but the same commid will appear in only one other record among the rest of the tables in the database (see lineno).

Format: number(8) External: i8NA Value: –1

NOT ALLOWED for remark

Range: commid > 0

Name: complete Table: Request Description: Percentage complete. Percentage of waveform data acquired for this request.Format: number(8) External: i8NA Value: NOT ALLOWEDRange: 0 ≤ complete ≤ 100

215b e r 2 0 0 2

216

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: complexity Table: Complexity Description: Signal complexity measure estimated by DFX application.Format: float(24) External: f11.4NA Value: –1.0 Range: complexity ≥ 0.0

Name: conf Table: Origerr (Origerr_temp_ga) Description: Confidence measure for a particular event identification method.Format: float(24) External: f5.3NA Value: NOT ALLOWEDRange: 0.5 ≤ conf ≤ 1.0

Name: connmanport Table: Dlman Description: Connection manager (ConnMan) port number used to send messages to the

diskloop manager application.Format: number(6) External: i6NA Value: 0 Range: 1 ≤ connmanport ≤ 16383

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: consider Table: Evsc_prod Description: Flag indicating whether (1) or not (0) an event was considered for screening.Format: number(1) External: i1NA Value: NOT ALLOWEDUnits: consider ∈ {0, 1}

Name: const Table: Qcstats Description: Amount of data in the detection processing interval masked due to constant

segments.Format: float(53) External: f17.5NA Value: –999.0 Units: secondsRange: const Š 0.0

Name: constrain_depth Table: Event_control (In_event_control) Description: Logical descriptor that tells location process whether or not to fix (constrain)

the current hypocentral depth. If TRUE (1), the depth will be fixed to the value specified on the first (summary) line of the DATA file or as specified by the depth column of the Origin (Originref, Origin_temp_ga) table. If FALSE (0), the depth is an independent solution parameter. Default is TRUE.

Format: number(1) External: i1NA Value: NOT ALLOWEDRange: constrain_depth ∈ {0, 1}

217b e r 2 0 0 2

218

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: constrain_latlon Table: Event_control (In_event_control) Description: Logical descriptor that tells location process whether or not to fix (constrain)

the current epicentral location. If TRUE (1), the latitude and longitude will be fixed to the value specified by the lat and lon columns of the Origin (Originref, Origin_temp_ga) table. If FALSE (0), the latitude and longitude are indepen-dent solution parameters. Default is FALSE.

Format: number(1) External: i1NA Value: NOT ALLOWEDRange: constrain_latlon ∈ {0, 1}

Name: constrain_ot Table: Event_control (In_event_control) Description: Logical descriptor that tells location process whether or not to fix (constrain)

the current origin time. If TRUE (1), the origin time will be fixed to the value specified by the time column of the Origin (Originref, Origin_temp_ga) table. If FALSE (0), the origin time is an independent solution parameter. Default is FALSE.

Format: number(1) External: i1NA Value: NOT ALLOWEDRange: constrain_ot ∈ {0, 1}

Name: controlport Table: Dlman Description: DataControl port. Number used to send commands to the diskloop manager

application.Format: number(6) External: i6NA Value: 0 Range: 0 ≤ controlport ≤ 16383

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: country Table: Site_address Description: Full country name for a sensor site.Format: varchar2(40) External: a40NA Value: - (hyphen)Range: any string up to 40 characters

Name: cov_depth_time Table: Event_control (In_event_control) Description: Coverage ellipse depth/time conversion factor. The value is the conversion

factor to be multiplied by the depth and origin time axes (sdepth and stime) of the confidence ellipse to recover the coverage ellipse without having to do a complete relocation.

Format: float(24) External: f9.4NA Value: –999.0 Range: cov_depth_time > 0.0

Name: cov_sm_axes Table: Event_control (In_event_control) Description: Coverage ellipse semi-axis conversion factor. The value is the conversion fac-

tor to be multiplied by the semi-major and semi-minor axes of the confidence ellipse to recover the coverage ellipse without having to do a complete reloca-tion.

Format: float(24) External: f9.4NA Value: –999.0 Range: cov_sm_axes > 0.0

219b e r 2 0 0 2

220

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: cp_broad_band Table: Evsc_hydro Description: The cep_peak_std_signal from table Hydro_features in the 2–80 Hz band for a

given orid/sta pair.Format: float(24) External: f7.2NA Value: –1.0 Units: standard deviationsRange: cp_broad_band > 0.0

Name: crnr_delfreq Table: Infra_features Description: Estimated standard deviation in crnr_freq.Format: float(24) External: f7.2NA Value: –1.0 Units: HertzRange: crnr_delfreq > 0.0

Name: crnr_freq Table: Infra_features Description: Corner frequency estimated from a windowed traditional FFT spectrum (ren-

dered on a dB power scaling) applied to the traditional beam-formed wave-form data.

Format: float(24) External: f7.2NA Value: –1.0 Units: HertzRange: crnr_freq > 0.0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: ctype Table: Sitechan Description: Channel type. This column specifies the type of data channel: n (normal, a

normal instrument response), b (beam, a coherent beam formed with array data), or i (an incoherent beam or energy stack).

Format: varchar2(4) External: a4NA Value: - (hyphen)Range: ctype ∈ {n, b, i}

Name: cycle_size Table: Productcriteria Description: Size to which a subscription product should be allowed to grow before distrib-

uting.Format: number(8) External: i8NA Value: –1 Units: KilobytesRange: cycle_size > 0

Name: cycle_time Table: Productcriteria Description: Period of cyclicity for a product in the Subscription Subsystem that is how

often a product should be delivered.Format: number(4) External: i4NA Value: –1 Units: HoursRange: cycle_time > 0

221b e r 2 0 0 2

222

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: dasta Table: Ex_an Description: Difference in number of regional array stations contributing to the analyst and

expert system origins. The value is [asta (analyst) – asta (expert system)] for analyst versus expert system comparisons or [asta (bulletin1) – asta (bulletin2)] for more general bulletin comparisons.

Format: number(8) External: i8NA Value: –999 Range: dasta > –999

Name: data_info Table: Dataready Description: Miscellaneous data information for the Subscription Subsystem, such as the sta-

tion name for station processing.Format: varchar2(24) External: a24NA Value: - (hyphen)Range: any character string up to 24 characters

Name: dataday Table: Rebdone_dataday_flag Description: Julian day of this dataday.Format: number(12) External: i12NA Value: NOT ALLOWEDRange: Julian dates are of the form yyyyddd

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: dataid Table: Dataready, Prodtrack Description: Unique identifier for the dataready table.Format: number(8) External: i8NA Value: –1 Range: dataid ≥ 0

Name: datatype Table: Fsave, Fsdisc, Wfdisc (Wfproto) Description: Numeric data storage. This column specifies the format of a data series in the

file system. Data types i4, f4, and s4 are typical values. Datatype i4denotes a 4-byte integer and f4 denotes a 32-bit real number. s4 is an integer where the most significant byte is in the low address position in memory and is opposite to the i4 order. Machine-dependent formats are supported for common hardware to allow data transfer in native machine binary formats. ASCII formats have also been defined to retain full precision of any binary data type. ASCII may be used when exchanging data between computer sys-tems with incompatible binary types. (See the wfport command manual page for information about converting formats.) Datatype can only describe single values or arrays of one data type.

Format: varchar2(2) External: a2NA Value: - (hyphen)Range: The currently recognized types (lower case is mandatory) are as follows:

a0 = 15-byte ASCII single precision b0 = 24-byte ASCII double precision c0 = 12-byte ASCII integer a# = 15-byte ASCII single precision b# = 24-byte ASCII double precision c# = 12-byte ASCII integer t4 = 4-byte SUN IEEE single precision real t8 = 8-byte SUN IEEE double precision real s4 = 4-byte SUN IEEE integer s2 = 2-byte SUN IEEE short integer f4 = 4-byte VAX IEEE single precision real f8 = 8-byte VAX IEEE double precision real

223b e r 2 0 0 2

224

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

i4 = 4-byte VAX IEEE integer i2 = 2-byte VAX IEEE short integer g2 = 2-byte NORESS gain-ranged

Name: datatype Table: Arch_data_type Description: Data type (or class of data).Format: varchar2(24) External: a24NA Value: - (hyphen)Range: any string up to 24 characters

Name: datsw Table: Fkdisc Description: A switch to indicate a data format data type. Proper values will be defined

through the software libraries and include files. A manual (man) page will explain the meaning of datsw values and reference related software man pages.

Format: number(10) External: i10NA Value: NOT ALLOWEDRange: datsw > 0

Name: ddepth Table: Bull_comp, Ex_an

Description: Difference in depth between corresponding origin locations. For depth com-parisons between analysts and the expert system, the value is [depth (analyst) – depth (expert system)]. For more general bulletin compari-sons, the value is [depth (bulletin1) – depth (bulletin2)].

Format: float(24) External: f6.1NA Value: –999.0 Units: kilometersRange: ddepth > –999.0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: ddepthp Table: Ex_an Description: Difference in the number of defining depth phases associated with analyst and

expert system origins. A depth phase is a member of the set, {sP, pP, sS}. The value is: [(number-analyst-phases) – (number-expert-phases)].

Format: number(8) External: i8NA Value: –999 Range: ddepthp > –999

Name: ddist Table: Bull_comp, Ex_an

Description: Difference in distance between corresponding origins in a bulletin compari-son.

Format: float(24) External: f8.3NA Value: –1.0 Units: kilometersRange: ddist ≥ 0.0

Name: deast Table: Site Description: Distance east. This column gives the “easting,” or the relative position of an

array element east of the location of the array center specified by the value of refsta (see dnorth).

Format: float(24) External: f9.4NA Value: 0.0 Units: kilometersRange: –20,000.0 ≤ deast ≤ 20,000.0

225b e r 2 0 0 2

226

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: delaz Table: Arrival, Detection, Hydro_arr_group Description: Azimuth uncertainty. This column is an estimate of the standard deviation of

the azimuth of a signal.Format: float(24) External: f7.2NA Value: –1.0 Units: degreesRange: delaz > 0.0

Name: deliv_meth Table: Subs Description: Delivery method for subscription products.Format: varchar2(6) External: a6NA Value: - (hyphen)Range: deliv_meth ∈ {ftp, email, www}

Name: delivid Table: Prodtrack, Productcriteria Description: Identifier that is unique and consecutive for each product constraint.Format: number(8) External: i8NA Value: –1 Range: delivid ≥ 0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: delslo Table: Arrival, Detection

Description: Slowness uncertainty. This column is an estimate of the standard deviation of the slowness of a signal.

Format: float(24) External: f7.2NA Value: –1.0 Units: seconds/kilometers for detection

seconds/degree for arrival

Range: delslo > 0.0

Name: delta Table: Assoc (Assoc_temp_ga), Evsc_regional, Parrival, Stamag

Description: Source-receiver distance. This column is the arc length, over the earth’s sur-face, of the path the seismic phase follows from source to receiver. The loca-tion of the origin is specified in the Origin (Originref, Origin_temp_ga) record referenced by the column orid. The column arid points to the record in the Arrival table that identifies the receiver. The value of the column can exceed 360 degrees. The geographic distance between source and receiver is deltamodulo(180).

Format: float(24) External: f8.3NA Value: –1.0 Units: degreesRange: delta ≥ 0.0

Name: deltim Table: Arrival, Detection

Description: Arrival time uncertainty. This column is an estimate of the standard deviation of an arrival time.

Format: float(24) External: f6.3NA Value: –1.0 Units: secondsRange: deltim > 0.0

227b e r 2 0 0 2

228

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: depdp Table: Origin (Originref, Origin_temp_ga) Description: Depth as estimated from depth phases. The value is a measure of event depth

estimated from a depth phase or an average of several depth phases. Depth is measured positive in a downwards direction starting from the earth’s surface (see ndp).

Format: float(24) External: f9.4NA Value: –999.0 Units: kilometersRange: 0.0 ≤ depdp < 1000.0

Name: depth Table: Evsc_prod, Origin (Originref, Origin_temp_ga), Stassoc

Description: Source depth. This column gives the depth (positive down) of the event ori-gin. Negative depth implies an atmospheric event. In stassoc, this may be an analyst estimate.

Format: float(24) External: f9.4NA Value: –999.0 Units: kilometersRange: –100.0 ≤ depth < 1000.0

0 ≤ depth < 1000.0 for evsc_prod

Name: depth_conf Table: Producttypeevsc Description: Confidence level of a one-sided confidence interval of the source depth, used

for the depth screening criterion.Format: float(24) External: f7.2NA Value: –999.0 Range: 0 < depth_conf < 1.0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: depth_kvalue Table: Producttypeevsc Description: Depth uncertainty k-value, used to specify additional uncertainty in seismic

free-depth solutions. Format: float(24) External: f7.2NA Value: –999.0 Units: kilometersRange: 0.0 < depth_kvalue < 1000.0

Name: depth_thresh Table: Producttypeevsc Description: Depth screening threshold. An event with a one-sided confidence interval for

its source depth that is deeper than this threshold is screened out at the confi-dence level given by depth_conf.

Format: float(24) External: f7.2NA Value: –999.0 Units: kilometersRange: 0.0 < depth_thresh < 1000.0

Name: deptherr Table: Evsc_prod Description: Depth error. This is the size of the one-sided depth confidence interval used

for event screening for a confidence level given by depth_conf in table Pro-ducttypeevsc. A model uncertainty term, given by depth_kvalue in table pro-ducttypeevsc, is included for free-depth solutions.

Format: float(24) External: f7.2NA Value: –999.0 Units: kilometersRange: deptherr > 0.0

229b e r 2 0 0 2

230

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: depthp Table: Ev_summary (Ex_summary, An_summary) Description: Number of time-defining depth phases. A depth phase is a member of the set

{sP, pP, sS}.Format: number(8) External: i8NA Value: –1 Range: depthp ≥ 0

Name: descr Table: Ampdescript Description: Text description. Describes amplitude measurement parameters.Format: varchar2(255) External: a255NA Value: - (hyphen)Range: any free-format string up to column size

Name: descrip Table: Glossary, Location, Problem, Ref_loc, Sitechan

Description: Text description. Format: varchar2(50) External: a128

varchar2(80) for ref_loc, glossary varchar2(129) for problem

NA Value: - (hyphen)Range: any free-format string up to the character limit

Name: dest Table: Mig_rules Description: Destination database for migration.Format: varchar2(10) External: a10NA Value: NOT ALLOWEDRange: any string up to 10 characters that is a valid name of database server

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: dest_tbl Table: Mig_rules Description: Destination table for database migration.Format: varchar2(30) External: a30NA Value: NOT ALLOWEDRange: any string up to 30 characters that is a valid table name

Name: detendtime Table: Qcstats Description: End time of actual interval used for detection processing.Format: float(53) External: f17.5NA Value: –999.0 Units: secondsRange: detendtime < 9999999999.999

Name: dettime Table: Qcstats Description: Start time of actual interval used for detection processing.Format: float(53) External: f17.5NA Value: –999.0 Units: secondsRange: dettime < 9999999999.999

Name: dfid Table: Dlfile Description: Diskloop file identifier.Format: number(8) External: i8NA Value: NOT ALLOWEDRange: dfid > 0

231b e r 2 0 0 2

232

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: dfile Table: Colordisc, Dlfile, Fileproduct (Fs_stageproduct), Fkdisc, Fsave, Fsdisc, Fwfile,

Glossary, Instrument, Mapdisc, Msgdisc, Overlaydisc, Problemlog, Wfdisc (Wfproto)

Description: Name of data file. Name of the heap file (fwfile). In fkdisc, the value is the file-name of an f-k disk file. In fsdisc, the value is the filename of a Fourier Spec-trum disk file (see dir), and so on.

Format: varchar2(32) External: a32 varchar2(65) for problemlog

NA Value: NOT ALLOWEDRange: any string up to the character limit that conforms to UNIX filename syntax

Name: dfilesize Table: Fwfile Description: Buffer file size for temporary storage of continuous data.Format: number(9) External: i9NA Value: NOT ALLOWEDRange: 0 < dfilesize < disk partition size

Name: did Table: Ex_an Description: Difference in event type between the analyst and expert system origins (see

etype). Did is y if the event types are the same or n if the event types are dif-ferent.

Format: varchar2(4) External: a4NA Value: - (hyphen)Range: did ∈ {y, n}

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: digital Table: Instrument Description: Flag denoting whether this instrument record describes an analog (a) or digi-

tal (d) recording system.Format: varchar2(1) External: a1NA Value: - (hyphen)Range: digital ∈ {d, a}

Name: dimx Table: Mapdisc Description: Width (or x-dimension) of the map in pixels.Format: number(8) External: i8NA Value: NOT ALLOWEDUnits: pixelsRange: dimx > 0

Name: dimy Table: Mapdisc Description: Height (or y-dimension) of the map in pixels.Format: number(8) External: i8NA Value: NOT ALLOWEDUnits: pixelsRange: dimy > 0

233b e r 2 0 0 2

234

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: dir Table: Colordisc, Dlfile, Fileproduct (Fs_stageproduct), Fkdisc, Fsave, Fsdisc, Fwfile,

Glossary, Instrument, Mapdisc, Msgdisc, Overlaydisc, Problemlog, Wfdisc (Wfproto)

Description: Directory. This column is the directory part of a path name. Relative path names or “.” (dot), the notation for the current directory, may be used. Direc-tory where the heap file is located (fwfile). Directory to find file (msgdisc).

Format: varchar2(64) External: a64 varchar2(129) for problemlog

NA Value: NOT ALLOWEDRange: any string that conforms to UNIX directory name syntax

Name: dist Table: Stassoc Description: Estimated distance. This column gives the approximate source-receiver dis-

tance as calculated from slowness (array measurements only), incident angle, or (S–P) times.

Format: float(24) External: f7.2NA Value: –1.0 Units: degreesRange: 0.0 ≤ dist ≤ 180.0

Name: dlat Table: Seisindex (Dseisindex) Description: Latitude increment between grid cells in Seisgrid (Dseisgrid).Format: float(24) External: f9.4NA Value: NOT ALLOWEDUnits: degreesRange: dlat ≥ 0.0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: dlid Table: Alphasite, Dlfile, Dlman

Description: Diskloop manager identification.Format: number(8) External: i8NA Value: NOT ALLOWEDRange: dlid > 0

Name: dlon Table: Seisindex (Dseisindex) Description: Longitude increment between grid cells in Seisgrid (Dseisgrid).Format: float(24) External: f9.4NA Value: NOT ALLOWEDUnits: degreesRange: dlon ≥ 0.0

Name: dlsta Table: Ex_an Description: In a comparison of bulletins, dlsta is the difference in the number of local sta-

tions contributing to the same event from the corresponding bulletins. The value is [lsta (analyst) – lsta (expert system)] for analyst versus expert system comparisons, and [lsta (bulletin1) – lsta (bulletin2)] for more general bulletin comparisons.

Format: number(8) External: i8NA Value: –999 Range: dlsta > –999

235b e r 2 0 0 2

236

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: dmax Table: Attencoef Description: Maximum distance for which the regional distance correction is applicable.Format: float(24) External: f7.2NA Value: –999.0 Units: kilometersRange: 0.0 < dmax < 2500.0

Name: dmin Table: Attencoef Description: Minimum distance for which the regional distance correction is applicable.Format: float(24) External: f7.2NA Value: –999.0 Units: kilometersRange: 0.0 < dmin < 2500.0

Name: dnarr Table: Bull_comp Description: Absolute difference in the number of associated arrivals between correspond-

ing origins.Format: number(8) External: i8NA Value: –1 Range: dnarr ≥ 0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: dndef Table: Bull_comp, Ex_an Description: Difference in the number of defining phases between corresponding origins.

A phase is defining only if its time-component is defining. The value is [ndef(analyst) – ndef (expert system)] for analyst versus expert system compari-sons, and [ndef (bulletin1) – ndef (bulletin2)] for more general bulletin com-parisons.

Format: number(8) External: i8NA Value: –1 Range: dndef ≥ 0

Name: dnorth Table: Site Description: Distance north. This column gives the “northing,” or relative position of array

element north of the array center specified by the value of refsta (see deast).Format: float(24) External: f9.4NA Value: 0.0 Units: kilometersRange: –20,000.0 ≤ dnorth ≤ 20,000.0

Name: dnsta Table: Ex_an Description: In a comparison of bulletins, dnsta is the difference in the number of contrib-

uting stations between the corresponding bulletin locations. The value is [nsta(analyst) – nsta (expert systems)] for analyst versus expert system compari-sons, and [nsta (bulletin1) – nsta (bulletin2)] for more general bulletin com-parisons.

Format: number(8) External: i8NA Value: –999 Range: dnsta > –999

237b e r 2 0 0 2

238

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: dom_to_send Table: Productcriteria Description: Day of month to send product.Format: number(2) External: i2NA Value: –1 Range: 0 < dom_to_send ≤ 31

Name: domain Table: Datauser, Subsuser Description: Domain name for a Subscription Subsystem user.Format: varchar2(48) External: a48NA Value: - (hyphen)

NOT ALLOWED for datauser

Range: any string up to 48 characters that is a valid internet domain

Name: donetime Table: Rebdone_dataday_flag Description: Epoch time that REB was completed.Format: float(53) External: f17.5NA Value: NOT ALLOWEDRange: any valid epoch time

Name: dow_to_send Table: Productcriteria Description: Day of week to deliver a product.Format: number(2) External: i2NA Value: –1 Range: 1 ≤ dow_to_send ≤ 7

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: dprimp Table: Ex_an Description: In a comparison of bulletins, dprimp is the difference in the number of primary

phases between corresponding origins. For a phase to be primary it must be time-defining, a member of the set {P, Pn, Pg, PKP, PKPdf}, and the first arrival at a particular station. The value is [(number-analyst-phases) – (num-ber-expert-phase)] for analyst versus expert-system comparisons and [(num-ber-bulletin1-phases) – (number-bulletin2-phases)] for more general bulletin comparisons.

Format: number(8) External: i8NA Value: –999 Range: dprimp > –999

Name: dropped Table: Qcstats Description: Flag that indicates if the interval was dropped by DFX due to excessive mask-

ing.Format: number(8) External: i8NA Value: –1 Range: dropped ∈ {0, 1}

Name: drsta Table: Ex_an Description: In a comparison of bulletins, drsta is the difference in the number of regional

non-array stations contributing to corresponding bulletin origins. The value is [rsta (analyst) – rsta (expert system)] for analyst versus expert-system com-parisons or [rsta (bulletin1) – rsta (bulletin2)] for more general bulletin com-parisons.

Format: number(8) External: i8NA Value: –999 Range: drsta > –999

239b e r 2 0 0 2

240

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: dscore Table: Evsc_prod Description: Score for the depth event-screening criterion.Format: float(24) External: f7.2NA Value: –999.0 Range: dscore > –999.0

Name: dsecondp Table: Ex_an Description: In a comparison of bulletins, dsecondp is the difference in the number of sec-

ondary phases between corresponding bulletin origins. For a phase to be sec-ondary, it must be defining and cannot be a member of the phase set {P, Pn, Pg, PKP, PKPdf}. The value is [(number-analyst-phases) – (number-expert-phases)] for analyst versus expert-system comparisons, and [(number-bulletin1-phases) – (number-bulletin2-phases)] for more general bulletin comparisons.

Format: number(8) External: i8NA Value: –999 Range: dsecondp > –999

Name: dsize Table: Fileproduct (Fs_stageproduct) Description: Size of data file in bytes.Format: number(10) External: i10NA Value: NOT ALLOWEDUnits: bytesRange: 0 < dsize < 99,999,999

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: dtime Table: Bull_comp, Ex_an

Description: Difference in the origin time between corresponding origins. The value is [time (analyst) – time (expert system)] for analyst versus expert-system com-parisons, and [time (bulletin1) – time (bulletin2)] for more general bulletin comparisons.

Format: float(24) External: f8.3NA Value: –999.0 Units: secondsRange: dtime > –999.0

Name: dtsta Table: Ex_an Description: Difference in the number of teleseismic stations (station/event distance >

2000 km) contributing to the analyst and expert system origins. The value is [tsta (analyst) – tsta (expert system)] for analyst versus expert-system compar-isons, and [tsta (bulletin1) – tsta (bulletin2) for more general bulletin compar-isons.

Format: number(8) External: i8NA Value: –999 Range: dtsta > –999

241b e r 2 0 0 2

242

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: dtype Table: Origin (Originref, Origin_temp_ga) Description: Depth determination flag. This single-character flag indicates the method by

which the depth was determined or constrained during the location process. The recommended values are f (free), d (from depth phases), r (restrained by location program) or g (restrained by geophysicist). In cases r or g, either the auth column should indicate the agency or person responsible for this action, or the commid column should point to an explanation in the Remark table.

Format: varchar2(1) External: a1NA Value: - (hyphen)Range: dtype ∈ {f, d, r, g}

Name: duration Table: Amplitude Description: Total duration of amplitude window. Combined with start_time, the entire

amplitude time window is specified. May also be employed to compute a coda duration magnitude if amp and per columns contain NA values.

Format: float(24) External: f7.2NA Value: –999.0 Units: secondsRange: duration ≥ 0

Name: duration Table: Chan_groups Description: Not used.Format: numberNA Value: –1 Range: none

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: eavcep Table: Timefreq Description: Average maximum value in the two-dimensional cepstrum of the east compo-

nent traces.Format: float(24) External: f7.2NA Value: NOT ALLOWEDRange: eavcep ≥ 0

Name: eavcor Table: Timefreq Description: Average autocorrelation along the time axis across all frequencies excluding

randomized points of the east component traces.Format: float(24) External: f7.2NA Value: NOT ALLOWEDRange: eavcor ≥ 0

Name: eavpct Table: Timefreq Description: Average ratio of bad points to total of the east component traces.Format: float(24) External: f7.2NA Value: NOT ALLOWEDRange: 0 ≤ eavpct ≤ 1

243b e r 2 0 0 2

244

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: edepth Table: Sitechan Description: Emplacement depth. This column gives the depth at which the instrument is

positioned, relative to the value of elev in the Site table.Format: float(24) External: f9.4NA Value: NOT ALLOWEDUnits: kilometersRange: edepth ≥ 0.0

Name: elev Table: Explo, Location, Site Description: Surface elevation. This column is the elevation of the surface of the earth

above a shot point (explo), mine / test site (location), or a seismic station (site) relative to mean sea level.

Format: float(24) External: f9.4NA Value: –999.0 Units: kilometersRange: –10.0 ≤ elev ≤ 10.0

Name: ema Table: Arrival Description: Emergence angle. This column is the emergence angle of an arrival, as

observed at a three-component station or array. The value increases from the vertical direction towards the horizontal.

Format: float(24) External: f7.2NA Value: –1.0 Units: degreesRange: 0.0 ≤ ema ≤ 90.0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: emaillimit Table: Datauser Description: Maximum size of message that will be delivered via email in the Message Subsystem.Format: number(8) External: i8NA Value: –1 Units: bytesRange: emaillimit ≥ 0

Name: emailto Table: Msgdest Description: Destination email address.Format: varchar2(64) External: a64NA Value: - (hyphen)Range: any string up to 64 characters

Name: emares Table: Assoc (Assoc_temp_ga) Description: Emergence angle residual. This column is the difference between an observed

emergence angle and the theoretical prediction for the same phase, assuming an event location as specified by the accompanying orid.

Format: float(24) External: f7.1NA Value: –999.0 Units: degreesRange: –90.0 ≤ emares ≤ 90.0

245b e r 2 0 0 2

246

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: end_date Table: Participation Description: Date a station was discontinued from a network.Format: number(8) External: i8NA Value: –1 Range: any valid Julian date where end_date > begin_date (yyyyddd)

Name: end_time Table: Request Description: Ending time of comparison or processing.Format: float(53) External: f17.5NA Value: NOT ALLOWEDUnits: secondsRange: any valid epoch time

Name: endtime Table: Beamaux, Datadays, Fileproduct (Fs_stageproduct), Fwgap, Interval, Outage,

Problem, Qcstats, Sensor, Wfdisc (Wfproto)

Description: Epoch time. Epochal time is given as seconds and fractions of a second since hour 0 January 1, 1970, and is stored in a double-precision floating number. This represents the ending time of the last gap for the sta/chan pair.

Format: float(53) External: f17.5 number(17,5) for problem

NA Value: +9999999999.999 Units: secondsRange: endtime < +9999999999.999

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: eng_deldur Table: Infra_features

Description: Estimated standard deviation in eng_dur.Format: float(24) External: f7.2NA Value: –1.0 Units: secondsRange: eng_deldur > 0.0

Name: eng_dur Table: Infra_features

Description: Time period during which the STA/LTA on the traditional beam exceeded its threshold for the current time interval.

Format: float(24) External: f7.2NA Value: –999.0 Units: secondsRange: eng_dur > 0.0

Name: eng_time Table: Infra_features

Description: Earliest time at which the STA/LTA applied to the traditional beam exceeded its threshold for the current time interval.

Format: float(53) External: f17.5NA Value: –9999999999.999 Units: secondsRange: eng_time > –9999999999.999

247b e r 2 0 0 2

248

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: eorid Table: Ex_an Description: Expert system origin identifier in an expert system versus analyst origin com-

parison.Format: number(8) External: i8NA Value: –1 Range: eorid > 0

Name: epfixf Table: Origaux Description: Flag designating that an epicenter is fixed.Format: varchar2(1) External: a1NA Value: - (hyphen)Range: any alphabetic lower-case character

Name: esaz Table: Assoc (Assoc_temp_ga) Description: Event-to-station azimuth measured in degrees clockwise from North.Format: float(24) External: f7.2NA Value: –999.0 Units: degreesRange: 0.0 ≤ esaz ≤ 360.0

Name: etype Table: Origin (Originref, Origin_temp_ga), Stassoc

Description: Event type. Describes the type of event. Format: varchar2(7) External: a7NA Value: - (hyphen)Range: etype ∈ {QUAKE, BLAST, EXPL, IND}

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: event Table: Origaux Description: Unique event identification (string).Format: varchar2(8) External: a8NA Value: - (hyphen)Range: any string up to eight characters

Name: evid Table: Discard, Event, Event_control (In_event_control), Explo, Netmag, Origaux,

Origin (Originref, Origin_temp_ga), Parrival, Request, Stamag

Description: Event identifier. Each event is assigned a unique positive integer that identi-fies it in a database. Several records in the origin table can have the same evid. Analyst have several opinions about the location of the event.

Format: number(8) External: i8NA Value: –1

NOT ALLOWED for event

Range: evid > 0

Name: evname Table: Event Description: Event name. This is the common name of the event identified by evid. Format: varchar2(15) External: a15NA Value: - (hyphen)Range: any free-format string up to 15 characters

249b e r 2 0 0 2

250

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: expcode Table: Explo Description: Explosion type code.

A four-character code indicates the type and setting of the explosion as fol-lows: Character 1: Type of explosion. N = nuclear; C = chemical Character 2: Medium. A = air; W = water; U = underground Character 3: Confidence. C = confirmed; P = presumed Character 4: Country. U = U.S.; S = USSR; F = France; C = China; I = India; G = Great Britain; P = Pakistan. A five-character code is the same as the four-character code, except that a sec-ond Country character is added when a second country is involved. A ten-character code indicates multiple shots (for example, NUCS_SALVO). A “-” is used for “unknown.”

Format: varchar2(10) External: a10NA Value: - (hyphen)Range: upper case string up to 10 characters long

Name: exptype Table: Explo Description: Explosion type.

“Air”, “Airburst”, “Airdrop”, “Balloon”, “Barge”, “Rocket”, “Space”, “Sur-face”, or “Tower” for air explosions. “Tunnel”, “Shaft”, or “Crater” for underground explosions. “Underwater”, or “Water Surface” for water explosions.

Format: varchar2(15) External: a15NA Value: - (hyphen)Range: any string up to 15 characters long

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: ext_chan Table: Exception_chanmap, Std_chanmap

Description: External channel identifier. The name of the channel as supplied by the data provider and received by data acquisition software.

Format: varchar2(8) External: a8NA Value: NOT ALLOWEDRange: any string up to eight characters

Name: extern_auth Table: Channame Description: The external authority using the station name. Not used for translation.Format: varchar2(20) External: a20NA Value: - (hyphen)Range: any string up to 20 characters

Name: extern_chan Table: Channame Description: The name of the channel as supplied in the data format frame of the CD-1 pro-

tocol. The name is chosen by the data provider. Along with extern_sta, a pri-mary key.

Format: varchar2(8) External: a8NA Value: NOT ALLOWEDRange: any string up to eight characters

251b e r 2 0 0 2

252

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: extern_sta Table: Channame Description: The name of the station as supplied in data format frame of the CD-1 protocol.

The name is chosen by the data provider. Along with extern_chan, a primary key.

Format: varchar2(6) External: a6NA Value: NOT ALLOWEDRange: any upper-case string up to six characters

Name: extmsgid Table: Msgdisc Description: Value of the msgid column in a message that is received by the message sys-

tem.Format: varchar2(20) External: a20NA Value: –1 Range: any string up to 20 characters

Name: fileoff Table: Msgdisc Description: Number of bytes to the first character of the email file (first character of the

email header). fileoff will always be 0 on the operations system, but will be reset when archived.

Format: number(10) External: i10NA Value: –1 Units: bytes Range: fileoff > 0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: filesize Table: Msgdisc Description: Size of file.Format: number(10) External: i10NA Value: –1 Units: bytes Range: fileoff > 0

Name: fkid Table: Fkdisc Description: Uniquely identifies a f-k spectrum file.Format: number(8) External: i8NA Value: NOT ALLOWEDRange: fkid > 0

Name: fkqual Table: Detection Description: An integer quantifying the quality of the f-k spectrum. An fkqual = 1 is high

quality; an fkqual = 4 is low quality.Format: number(4) External: i4NA Value: –1 Range: 1 ≤ fkqual ≤ 4

Name: fkrid Table: Fkdisc Description: Uniquely defines a f-k spectrum recipe.Format: number(8) External: i8NA Value: –1 Range: fkrid > 0

253b e r 2 0 0 2

254

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: fktyp Table: Fkdisc Description: String that identifies the type of f-k spectrum; examples are monochromatic

(mono) and broadband (broa).Format: varchar2(4) External: a4NA Value: NOT ALLOWEDRange: any lower-case string up to four characters

Name: fm Table: Arrival Description: First motion. This is a two-character indication of first motion. The first char-

acter describes first motion seen on short-period channels and the second holds for long-period instruments. Compression on a short-period sensor is denoted by c, dilatation by a d; and compression on a long-period sensor is denoted by u, dilatation by an r. Empty character positions will be indicated by dots (for example, “.r” for dilatation on a long-period sensor).

Format: varchar2(2) External: a2NA Value: - (hyphen)Range: all two-letter permutations of {c | d | .}, {u | r | .}

Name: fmax Table: Spvar Description: Maximum frequency of a band with snr > 3 dB used for the spectral variance

calculation.Format: float(24) External: f7.2NA Value: NOT ALLOWEDUnits: HertzRange: fmax > fmin

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: fmin Table: Spvar Description: Minimum frequency of a band with snr > 3 dB used for the spectral variance

calculation.Format: float(24) External: f7.2NA Value: NOT ALLOWEDUnits: HertzRange: 0 < fmin < fmax

Name: foff Table: Fileproduct (Fs_stageproduct), Fkdisc, Fsave, Fsdisc, Msgdatatype, Msgdisc,

Wfdisc (Wfproto) Description: File offset; the byte offset of a data segment within a physical data file. This

column is nonzero if the data reference does not occur at the beginning of the file.

Format: number(8) External: i10 number(10) for fileproduct, fkdisc, fsave, fsdisc, msgdisc

NA Value: NOT ALLOWEDRange: foff ≥ 0

Name: ford Table: Hydro_features, Infra_features

Description: Filter order. In infra_features, this column identifies the order of the Infinite Impulse Response (IIR) filter used to extract the spectral band in which the standard fk spectrum calculation was performed.

Format: number(8) External: i8NA Value: 0 Range: ford > 0

255b e r 2 0 0 2

256

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: forid Table: Ex_an Description: Final origin identifier; the origin identification of the analyst orid in an expert

system versus analyst origin comparison.Format: number(8) External: i8NA Value: NOT ALLOWEDRange: forid > 0

Name: forwardport Table: Dlman Description: Forwarder port used by the diskloop manager.Format: number(6) External: i6NA Value: 0 Range: 1 ≤ forwardport ≤ 16383

Name: fpid Table: Fileproduct (Fs_stageproduct) Description: File product identifier.Format: number(8) External: i8NA Value: NOT ALLOWEDRange: fpid > 0

Name: framesize Table: Fwgap Description: Time that each data frame represents. This column is determined from the

Data Format Frame of the Alpha Protocol.Format: float(53) External: f17.5NA Value: –1.0 Range: framesize > 0.0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: freq Table: Apma Description: Center frequency of the wideband polarization analysis. For example, if only

the 2 – 4 Hz and 4 – 8 Hz bands satisfy the signal-to-noise ratio criterion, then freq is set to 5.0 Hz.

Format: float(24) External: f7.2NA Value: –1.0 Units: HertzRange: freq > 0.0

Name: fsdesc Table: Fsrecipe Description: String describing the Fourier spectrum recipe.Format: varchar2(15) External: a15NA Value: - (hyphen)Range: any string up to 15 characters

Name: fsid Table: Fsdisc, Fstag, Spvar

Description: Fourier spectrum identifier.Format: number(8) External: i8NA Value: NOT ALLOWED

–1 for spvar

Range: fsid > 0

257b e r 2 0 0 2

258

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: fsrid Table: Fsdisc, Fsrecipe

Description: Fourier spectrum recipe identifier.Format: number(8) External: i8NA Value: NOT ALLOWEDRange: fsrid > 0

Name: fstat Table: Detection Description: F-statistic; a measure of the signal-to-noise ratio at the peak in the f-k spec-

trum.Format: float(24) External: f5.2NA Value: –1.0 Range: fstat ≥ 0

Name: fstype Table: Fsave, Fsdisc Description: String specifying the type of Fourier spectrum; for example, amplitude

(ampl), phase (phas), complex (comp), and power (powe).Format: varchar2(4) External: a4NA Value: NOT ALLOWEDRange: any lower-case string up to four characters

Name: ftp_address Table: Ftpfailed, Ftplogin Description: FTP address of site from which PIDC is attempting to transfer data message.Format: varchar2(64) External: a64NA Value: NOT ALLOWEDRange: any string up to 64 characters

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: ftype Table: Hydro_features Description: Filter type. This indicates the type of filtering that was performed for a Butter-

worth filter. “BP” indicates a band-pass filter between low_cut and high_cut; “LP” indicates a low-pass filter below high_cut; “HP” indicates a high-pass fil-ter above low_cut; “BR” indicates a band-reject filter outside low_cut and high_cut.

Format: varchar2(2) External: a2NA Value: - (hyphen)Range: ftype ∈ {BP, LP, HP, BR}

Name: full Table: Dlfile Description: File is full (y/n). full is set to “y” if the diskloop file is full and “n” otherwise.Format: varchar2(1) External: a1NA Value: - (hyphen)Range: full ∈ {n,y}

Name: fwfid Table: Fwfile Description: Identifier of the AlphaForward process that reads from the heap file.Format: number(8) External: i8NA Value: –1 Range: fwfid > 0

259b e r 2 0 0 2

260

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: fwgid Table: Fwgap Description: Forwarding gap identifier. This identifier is placed into a newly inserted gap

record. The value for the counter is retrieved by gdi_get_counter.Format: number(8) External: i8NA Value: –1 Range: fwgid > –1

Name: fwhid Table: Fwfile Description: Identifier of the AlphaDLHeap process that writes to the heap file.Format: number(8) External: i8NA Value: –1 Range: fwhid > 0

Name: fzp Table: Hydro_features Description: Filter causality. This flag indicates zero-phase filtering. If it is 1, the filter is

zero-phase (noncausal); if it is 0, the filter is not zero-phase (causal).Format: number(8) External: i1NA Value: NOT ALLOWEDRange: fzp ∈ {0,1}

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: gap Table: Origaux Description: Gap in azimuthal coverage.Format: number(4) External: i3NA Value: –1 Units: degreesRange: 0 ≤ gap ≤ 360

Name: gctp1 through gctp15

Table: Mapdisc Description: General cartographic transformation package variable. The default for all val-

ues is 0.Format: float(24) External: f10.4NA Value: NOT ALLOWEDRange: see mapdisc man page

Name: grdname Table: Seisgrid (Dseisgrid), Seisindex (Dseisindex)

Description: Name for identifying the basis of a natural seismicity grid.Format: varchar2(6) External: a6NA Value: NOT ALLOWEDRange: any free-format string up to six characters

261b e r 2 0 0 2

262

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: grn Table: Ev_summary (Ex_summary, An_summary), Gregion, Origin (Originref,

Origin_temp_ga)

Description: Geographic region number, as defined by [Fli74].Format: number(8) External: i8NA Value: –1 Range: grn > 0

Name: grname Table: Gregion Description: Geographic region name. This column is the common name of a geographic

region, as given in [Fli74]. Names may have changed due to changing politi-cal circumstances (for example, old RHODESIA = new ZIMBABWE) (see grnand srname).

Format: varchar2(40) External: a40NA Value: NOT ALLOWEDRange: any upper-case string up to 40 characters

Name: grpname Table: Producttypeevsc Description: Group name for subscriptions.Format: varchar2(24) External: a24NA Value: - (hyphen)Range: any valid string up to 24 characters

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: gvhi Table: Ampdescript Description: High group velocity for determining a time window. This column defines the

start time of an amplitude measurement window if toff is null. If gvhi is used, then gvlo must be used to define the end time of the window.

Format: float(24) External: f5.2NA Value: –999.0 Units: kilometers/secondRange: gvhi > gvlo

Name: gvlo Table: Ampdescript Description: Low group velocity for determining a time window. This column defines the

end time of an amplitude measurement window if tlen is null or if gvhi is used to define the start time of the window.

Format: float(24) External: f5.2NA Value: –999.0 Units: kilometers/secondRange: gvlo > 0

Name: hamp Table: Amp3c Description: Horizontal amplitude. Absolute maximum amplitude (nm) measured on the

root of the sum of the squares of two horizontally-oriented components fil-tered in a frequency band centered at cfreq Hz.

Format: float(24) External: f11.2NA Value: –999.0 Units: nanometersRange: hamp ≥ 0.0

263b e r 2 0 0 2

264

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: hang Table: Sitechan Description: Horizontal orientation of seismometer. This column specifies the orientation

of the seismometer in the horizontal plane, measured clockwise from North. For a North-South orientation with the seismometer pointing toward the north, hang = 0.0; for East-West orientation with the seismometer pointing toward the west, hang = 270.0 (see vang).

Format: float(24) External: f6.1NA Value: NOT ALLOWEDUnits: degreesRange: 0.0 ≤ hang ≤ 360.0

Name: header_fpid Table: Fpdescription Description: fpid pointing to the header row for this product type.Format: number(8) External: i8NA Value: –1 Range: header_fpid > 0

Name: high_cut Table: Hydro_features Description: High-cut frequency of filter.Format: float(24) External: f9.4NA Value: –1.0 Units: HertzRange: 0.0 ≤ high_cut ≤ sample rate/2

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: hmxmn Table: Apma Description: Maximum-to-minimum horizontal amplitude ratio defined as (λ1/λ2)1/2 where

λ1 and λ2 are the maximum and minimum eigenvalues obtained by solving the 2-D eigensystem using only the horizontal components. This S-type value is calculated at the time of maximum 3-component amplitude.

Format: float(24) External: f7.2NA Value: –1.0 Range: hmxmn ≥ 0.0

Name: hour Table: Allocate_hour Description: Starting hour of a time block for interactive analysis.Format: number(2) External: i2NA Value: NOT ALLOWEDUnits: hoursRange: 0 ≤ hour ≤ 23

Name: hour_to_send Table: Productcriteria Description: Hour at which the product is to be sent.Format: number(2) External: i2NA Value: NOT ALLOWEDUnits: hoursRange: 0 ≤ hours_to_send ≤ 23

265b e r 2 0 0 2

266

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: hscore Table: Evsc_prod Description: Score for the hydroacoustic event-screening criterion.Format: float(24) External: f7.2NA Value: –999.0 Range: hscore > –999.0

Name: hsnr Table: Amp3c Description: Horizontal signal-to-noise ratio. Ratio of hamp to the root-mean-square ampli-

tude of the root of the sum of the squares of two horizontallyoriented compo-nents filtered in a frequency band centered at cfreq Hz.

Format: float(24) External: f10.2NA Value: –999.0 Range: hsnr ≥ 0.0

Name: htov Table: Amp3c Description: Horizontal-to-vertical power ratio. One-half times the square of the ratio of

hamp to vamp.Format: float(24) External: f10.2NA Value: –999.0 Range: htov ≥ 0.0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: hvrat Table: Apma Description: Horizontal-to-vertical power ratio defined as

(C3 + C2)/2C1 where C1, C2, and C3 are the diagonal elements of the covariance matrix (C1corresponds to the vertical component). This is an S-phase-type value that is calculated at the time of the maximum 3-component amplitude.

Format: float(24) External: f7.2NA Value: –1.0 Range: hvrat ≥ 0.0

Name: hvratp Table: Apma Description: Horizontal-to-vertical power ratio defined as

(C3 + C2)/2C1 where C1, C2, and C3 are the diagonal elements of the covariance matrix (C1corresponds to the vertical component). This is a P-phase-type value that is calculated at the time of maximum rectilinearity.

Format: float(24) External: f7.2NA Value: –1.0 Range: hvratp ≥ 0.0

267b e r 2 0 0 2

268

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: hydro_cp_thresh Table: Producttypeevsc Description: Threshold of the hydroacoustic cepstral peak screening criterion.Format: float(24) External: f7.2NA Value: –999.0 Units: dB re µPaRange: 0.0 < hydro_cp_thresh < 999.0

Name: hyd_grp_phase Table: Hydro_arr_group Description: Flag that indicates if the interval was dropped by DFX due to excessive mask-

ing.Format: varchar2(8) External: a8NA Value: - (hyphen)Range: any string up to eight characters; currently hyd_grp_phase ∈ {H, T, N}

Name: hydro_id Table: Hydro_arr_group, Hydro_assoc Description: Identifier which is the primary key in the hydro_arr_group table and the for-

eign key in hydro_assoc.Format: number(8) External: i8NA Value: NOT ALLOWEDRange: hydro_id > 0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: hydro_te_thresh Table: Producttypeevsc Description: Threshold of the hydroacoustic total energy screening criterion.Format: float(24) External: f7.2NA Value: –999.0 Units: dB re µPaRange: 0.0 < hydro_te_thresh < 999.0

Name: icell Table: Seisgrid (Dseisgrid) Description: Grid cell index.Format: number(8) External: i8NA Value: NOT ALLOWEDRange: icell > 0

Name: id Table: Ga_tag Description: Arrival or origin identifier.Format: number(8) External: i8NA Value: NOT ALLOWEDRange: id > 0

Name: idate Table: Msgdisc

Description: Initial Julian date message that was received.Format: number(8) External: i8NA Value: –1 Range: any valid Julian date

269b e r 2 0 0 2

270

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: ident Table: Origaux Description: Identifier assigned to an origin by an external source in an incoming origin

data message.Format: varchar2(8) External: a8NA Value: - (hyphen)Range: any string up to eight characters

Name: imb Table: Stassoc Description: Initial body wave magnitude. This column is an analyst’s estimate of the body

wave magnitude using data from a single station (see iml, ims, magnitude, magtype, mb, ml, and ms).

Format: float(24) External: f7.2NA Value: –999.0 Range: imb > –2.0

Name: imethod Table: Msgdisc Description: Method of transmission for a message.Format: varchar2(8) External: a8NA Value: - (hyphen)Range: imethod ∈ {email, ftp}

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: iml Table: Stassoc Description: Initial local magnitude. This column is an analyst’s estimate of the local using

data from a single station (see imb, ims, magnitude, magtype, mb, ml, and ms).Format: float(24) External: f7.2NA Value: –999.0 Range: iml > –2.0

Name: ims Table: Stassoc Description: Initial surface wave magnitude. The value in this column is an analyst’s esti-

mate of surface wave magnitude using data from a single station (see iml, imb, magnitude, magtype, mb, ml, and ms).

Format: float(24) External: f7.2NA Value: –999.0 Range: ims > –2.0

Name: inang1 Table: Apma Description: Apparent incidence angle (measured from the vertical) of the eigenvector (e1)

associated with the largest eigenvalue (λ1). This column is also called the long-axis incidence angle or the emergence angle. This P-type value is calcu-lated at the time of maximum rectilinearity.

Format: float(24) External: f7.2NA Value: –1.0 Units: degreesRange: 0.0 ≤ inang1 < 90.0

271b e r 2 0 0 2

272

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: inang3 Table: Apma Description: Apparent incidence angle (measured from the vertical) of the eigenvector (e3)

associated with the smallest eigenvalue (λ3). This column is also called the short-axis incidence angle. This S-type value is measured at the time of the maximum 3-component amplitude.

Format: float(24) External: f7.2NA Value: –1.0 Units: degreesRange: 0.0 ≤ inang3 < 90.0

Name: inarrival Table: Amplitude

Description: Flag to indicate whether or not amp is the same as it is in the Arrival table.Format: varchar2(1) External: a1NA Value: NOT ALLOWEDRange: inarrival ∈ {y, n}

Name: inauth Table: Wfconv Description: Flag showing if input data are authenticated.Format: varchar2 (1) External: a1NA Value: - (hyphen)Range: inauth ∈ {y, n}

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: incomp Table: Wfconv Description: Input data compression type. The only type currently supported is Canadian

compression (CA).Format: varchar2(2) External: a2NA Value: - (hyphen)Range: incomp ∈ {CA}

Name: inid Table: Instrument, Sensor

Description: Instrument identifier. This column is a unique key to the instrument table and inid provides the only link between sensor and instrument.

Format: number(8) External: i8NA Value: NOT ALLOWED

–1 for sensor.Range: inid > 0

Name: initialdate Table: Subs Description: Initial date of a subscription.Format: date External: a17NA Value: NOT ALLOWEDRange: any valid ORACLE date

Name: inloop Table: Dlfile Description: File is part of a diskloop (y/n).Format: varchar2(1) External: a1NA Value: NOT ALLOWEDRange: inloop ∈ {n, y}

273b e r 2 0 0 2

274

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: insamp Table: Wfconv Description: Number of input samples per packet.Format: number(8) External: i8NA Value: 0 Range: insamp > 0

Name: insname Table: Instrument Description: Instrument name. This character string contains the name of the instrument.Format: varchar2(50) External: a50NA Value: - (hyphen)Range: any free-format string up to 50 characters

Name: instant Table: Sensor Description: Snapshot indicator. When instant = y, the snapshot was taken at the time of a

discrete procedural change, such as an adjustment of the instrument gain; when instant = n, the snapshot is of a continuously changing process, such as calibration drift. This value is important for tracking time corrections and cal-ibrations. The default value is y.

Format: varchar2(1) External: a1NA Value: NOT ALLOWEDRange: instant ∈ {y, n}

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: instype Table: Instrument, Wfdisc (Wfproto) Description: Instrument type. This character string is used to indicate the instrument type.

Some examples are: SRO, ASRO, DWWSSN, LRSM, and S-750.Format: varchar2(6) External: a6NA Value: - (hyphen)Range: upper-case instrument type

Name: int_chan Table: Exception_chanmap, Std_chanmap Description: Internal channel identifier. The name of a channel that was historically stored

in the archive database.Format: varchar2(8) External: a8NA Value: NOT ALLOWEDRange: any string up to eight characters

Name: intern_chan Table: Channame Description: The name of the channel as chosen by the data consumer. The translation is

from extern_chan to intern_chan.Format: varchar2(8) External: a8NA Value: NOT ALLOWEDRange: any lower-case string up to eight characters

275b e r 2 0 0 2

276

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: intern_chanid Table: Channame Description: The chanid corresponding to the intern_sta, intern_chan. Foreign key into the

Sitechan table.Format: number(8) External: i8NA Value: –1 Range: intern_chanid > 0

Name: intern_sta Table: Channame Description: The name of the station as chosen by the data consumer. The translation is

from extern_sta to intern_sta.Format: varchar2(6) External: a6NA Value: NOT ALLOWEDRange: any upper-case string up to six characters

Name: intid Table: Msgdisc, Subs

Description: Internal identifier for message tracking.Format: number(8) External: i8NA Value: –1 Range: intid > 0

Name: intidtype Table: Msgdisc, Subs

Description: Identifier type for the intid.Format: varchar2(16) External: a16NA Value: - (hyphen)Range: any valid identifier in the schema

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: intvlid Table: Interval Description: Interval identifier. Each interval is assigned a unique positive integer that

identifies it in the database.Format: number(8) External: i8NA Value: NOT ALLOWEDRange: intvlid > 0

Name: intype Table: Wfconv Description: Input fixed width datatype.Format: varchar2(2) External: a2NA Value: - (hyphen)Range: same as datatype

Name: inwfactivity Table: Chan_groups Description: Not used.Format: number(1)NA Value: –1 Range: none

277b e r 2 0 0 2

278

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: iphase Table: Arrival Description: Reported phase. This eight-character column holds the name initially given to

a seismic phase. Standard seismological labels for the types of signals (or phases) are used (for example, P, PKP, PcP, pP). Both upper- and lower-case letters are available and should be used when appropriate, for example, pP or PcP (see phase).

Format: varchar2(8) External: a8NA Value: - (hyphen)Range: any string up to eight characters that conforms to seismological practice

Name: isrc Table: Msgdisc Description: Initial source of message.Format: varchar2(64) External: a64NA Value: - (hyphen)Range: any string up to 64 characters

Name: itime Table: Msgdest, Msgdisc

Description: Initial time when message was received.Format: float(53) External: f17.5NA Value: –9999999999.999 Units: seconds Range: any valid epoch time

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: jdate Table: Allocate_hour, Arrival, Datadays, Detection, Fkdisc, Fsdisc, Origin (Originref,

Origin_temp_ga), Qcstats, Scan_date, Sensor, Wfdisc (Wfproto) Description: Julian date; date of an arrival, origin, seismic recording, and so on. The same

information is available in epoch time, but the Julian date format is more con-venient for many types of searches. Dates B.C. are negative. The year will never equal 0000, and the day will never equal 000. Where only the year is known, the day of the year is 001; where only year and month are known, the day of year is the first day of the month. Only the year is negated for B.C., so 1 January of 10 B.C. is –0010001 (see time).

Format: number(8) External: i8NA Value: –1 Range: Julian dates are of the form yyyyddd; must be consistent with the accompany-

ing time column

Name: kbscause Table: Ex_an Description: Obsolete column.Format: varchar2(7) External: a7NA Value: - (hyphen)Range: any free-format string up to seven characters

Name: keyname Table: Lastid (Problastid, Rms_lastid) Description: Identifier type. This column contains the actual name of a key whose last

assigned numeric value is saved in keyvalue. Format: varchar2(15) External: a15NA Value: NOT ALLOWEDRange: keyname ∈ {arid, chanid, commid, evid, inid, orid, stassid, wfid,

dataid, prodid, subsid, and so on}

279b e r 2 0 0 2

280

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: keyvalue Table: Lastid (Problastid, Rms_lastid) Description: Current identifier value. This column maintains the last assigned value (a pos-

itive integer) of the counter for the specified keyname. The keyvalue is the last counter value used for the column keyname. Key values are maintained in the database to ensure uniqueness.

Format: number(8) External: i8NA Value: NOT ALLOWEDRange: keyvalue > 0

Name: kurtosis Table: Hydro_features Description: Kurtosis of the estimated signal energy between onset_time and

termination_time.Format: float(24) External: f9.4NA Value: –9999999999.999 Range: –10000000.0 < kurtosis< 10000000.0

Name: label Table: Mapdisc Description: Header for Map listing. A label, such as world, categorizes each Map. Label

is used to build a sorted list of maps in the Map program.Format: varchar2(65) External: a65NA Value: - (hyphen)Range: any string up to 65 characters

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: last_mig_date Table: Mig_date Description: Last date of database migration.Format: date External: a17NA Value: NOT ALLOWEDRange: any valid ORACLE date

Name: lastfailedtime Table: Ftpfailed Description: Time of most recent attempt to retrieve data message by FTP.Format: float(53) External: f17.5NA Value: NOT ALLOWEDRange: any valid epoch time

Name: lat Table: Location, Mappoint, Origin (Originref, Origin_temp_ga), Ref_loc, Site, Stassoc Description: Geographic latitude. Locations north of the equator have positive latitudes.Format: float(24) External: f9.4NA Value: –999.0 Units: degreesRange: –90.0 ≤ lat ≤ 90.0

Name: lat1 Table: Seisindex (Dseisindex) Description: Southern-most latitude of the first grid cell in Seisgrid (Dseisgrid).Format: float(24) External: f9.4NA Value: NOT ALLOWEDUnits: degreesRange: –90.0 ≤ lat1 ≤ 90.0

281b e r 2 0 0 2

282

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: latmajor Table: Mapdisc Description: Latitude interval for displaying major grid lines in the Map application.Format: float(24) External: f9.4NA Value: –999.0 Units: degreesRange: 0.0 < latmajor < 90.0

Name: latminor Table: Mapdisc Description: Latitude interval for displaying minor grid lines in the Map application.Format: float(24) External: f9.4NA Value: –999.0 Units: degreesRange: 0 < latminor < 90.0

Name: latorigradians Table: Mapdisc Description: Latitude origin radians. Coordinates in radians of the lower left corner in the

Map application. The Map application uses this for mercator projections only. Format: float(24) External: f9.4NA Value: –999.0 Units: radiansRange: –π/2 < latorigradians < π/2

Name: lddate

Table: Affiliation (Stanet), Allocate_hour, Allow_resid, Alphasite, Amp3c, Ampdescript, Amplitude, Apma, Arch_data_type, Arrival, Assoc (Assoc_temp_ga), Attencoef, Bull_comp, Ceppks, Chan_groups, Channame, Colordisc, Complexity, Datadays, Dataready, Datauser, Detection, Discard,

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Dlfile, Dlman, Ev_summary (Ex_summary, An_summary), Event, Event_control (In_event_control), Evsc_hydro, Evsc_prod, Evsc_regional, Ex_an, Exception_chanmap, Explo, Fileproduct (Fs_stageproduct), Fkdisc, Fpdescription, Fsave, Fsdisc, Fsrecipe, Fstag, Ftpfailed, Ftplogin, Fwfile, Fwgap, Fwsite, Glossary, Gregion, Hydro_arr_group, Hydro_assoc, Hydro_features, Infra_features, Instrument, Interval, Lastid (Problastid, Rms_lastid), Mapcolor, Mapdisc, Mapover, Mappoint, Mig_date, Location, Msgaux, Msgdatatype, Msgdest, Msgdisc, Netmag, Network, Origaux, Origerr (Origerr_temp_ga), Origin (Originref, Origin_temp_ga), Outage, Overlaydisc, Parrival, Participation, Problem, Problemlog, Problemmail, Prodtrack, Productcriteria, Producttypeevsc, Rebdone_dataday_flag, Ref_loc, Regcoef, Remark, Request, Revaudit, Seisgrid (Dseisgrid), Seisindex (Dseisindex), Sensor, Site, Site_address, Siteaux, Sitechan, Sitepoll, Splp, Spvar, Sregion, Stamag, Stassoc, Std_chanmap, Subs, Subsuser, Thirdmom, Timefreq, Timestamp, Weights, Wfconv, Wfdisc (Wfproto), Wftag, Xtag

Description: Load date. The date and time the record was inserted into the database. For the bull_comp table, lddate is the date of the comparison.

Format: date External: a17NA Value: NOT ALLOWEDRange: any valid ORACLE date

Name: length Table: Dlfile, Wfaux

Description: Length of file, bytes (dlfile), waveform length, bytes (wfaux).Format: number(10) External: i10NA Value: NOT ALLOWEDUnits: bytesRange: length > 0

Name: lg_snr Table: Evsc_regional Description: Signal-to-noise ratio of the Lg measurement.Format: float(24) External: f7.2NA Value: –999.0 Range: lg_snr > 0.0

283b e r 2 0 0 2

284

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: lineno Table: Remark, Glossary

Description: Line number. This integer is assigned as a sequence number for multiple line comments.

Format: number(8) External: i8 number(4) for glossary

NA Value: NOT ALLOWEDRange: lineno > 0

Name: loc_all_stas Table: Event_control (In_event_control) Description: Logical descriptor that informs the location process whether or not it should

use only stations with source-dependent corrections in event locations. If TRUE (1), use all stations in event location. If FALSE (0), only use phase data from stations possessing either an SSSC, SRST, or test-site correction. Any data without a valid correction will not be included in the final event location. Only meaningful if src_dpnt_corr is > 0. Default is TRUE.

Format: number(1) External: i1NA Value: NOT ALLOWEDRange: loc_all_stas ∈ {0, 1}

Name: loc_alpha_only Table: Event_control (In_event_control) Description: Logical descriptor that restricts phase data to be used in event location to only

those stations contained in the substation list. If FALSE (0), use all stations provided in the Site table. If TRUE (1), only “PRIMARY” station data are used to locate events. This is option desirable in cases where the station net-work has varying station qualities contributing to events. Default is FALSE.

Format: number(1) External: i1NA Value: NOT ALLOWEDRange: loc_alpha_only ∈ {0, 1}

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: loc_conf Table: Producttypeevsc Description: Confidence level of location error ellipse used to assess whether the error

ellipse was onshore, offshore or mixed (in other words, partially onshore and offshore).

Format: float(24) External: f7.2NA Value: –999.0 Range: 0.0 < loc_conf < 1.0

Name: loc_dist_varwgt Table: Event_control (In_event_control) Description: Logical descriptor that informs the location process if predefined distance

variance weighting should be applied to the event location. The predefined weighting is a set of data variances as a function of distance. If FALSE (0) and both user_var_wgt and srst_var_wgt are also set to FALSE, then variances are determined by the deltim, delslo, and delaz from Arrival. Default is FALSE.

Format: number(1) External: i1NA Value: NOT ALLOWEDRange: loc_dist_varwgt ∈ {0, 1}

Name: loc_sdv_mult Table: Event_control (In_event_control) Description: Large residual multiplier factor. This column is only meaningful when

loc_sdv_screen is set to TRUE (1). If TRUE, all data with travel-time/azimuth/slowness residuals greater than this factor times its data variance (standard error) will be ignored during any given iteration of the location process. Default is 3.0.

Format: float(24) External: f5.2NA Value: NOT ALLOWEDRange: loc_sdv_mult > 0.0

285b e r 2 0 0 2

286

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: loc_sdv_screen Table: Event_control (In_event_control) Description: Logical descriptor that tells the location process whether or not to ignore data

with travel-time/azimuth/slowness residuals greater than loc_sdv_mult times its data standard error in determining an event location. If FALSE (0), include data regardless of its residuals, provided it meets other pertinent conditions. Default is FALSE.

Format: number(1) External: i1NA Value: NOT ALLOWEDRange: loc_sdv_screen ∈ {0, 1}

Name: loc_src_dpnt_reg Table: Event_control (In_event_control) Description: Source-dependent region identifier for event location. If source-dependent

corrections are applied as part of event location process (src_dpnt_corr > 0), then loc_src_dpnt_reg indicates region name.

Format: varchar2(15) External: a15NA Value: - (hyphen)Range: any free-format string up to 15 characters

Name: locality Table: Site_address Description: Geographical location within a country.Format: varchar2(40) External: a40NA Value: - (hyphen)Range: any string up to 40 characters

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: location Table: Stassoc Description: Location description. This character string describes the location of an event

identified from data recorded at a single station. An examples is Fiji-Tonga.

Format: varchar2(32) External: a32NA Value: - (hyphen)Range: any free-format string up to 32 characters

Name: locid Table: Location, Explo Description: Location identification code.Format: varchar2(30) External: a30NA Value: - (hyphen)Range: any valid string up to 30 characters

Name: locname Table: Location Description: Location name.Format: varchar2(15) External: a15NA Value: - (hyphen)Range: any valid string up to fifteen characters

287b e r 2 0 0 2

288

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: logat Table: Arrival Description: Log of amplitude divided by period. This measurement of signal size is often

reported instead of the amplitude and period separately. This column is only filled if the separate measurements are not available.

Format: float(24) External: f7.2NA Value: –999.0 Units: log (nanometers/seconds) Range: logat > 0.0

Name: login Table: Problem, Problemlog, Problemmail

Description: Login name of originator of log entry or a mail subscriber.Format: varchar2(33) External: a32NA Value: NOT ALLOWEDRange: any valid string up to 33 characters that is a valid email address

Name: lon Table: Location, Mappoint, Origin (Originref, Origin_temp_ga), Ref_loc, Site, Stassoc

Description: Geographic longitude. Longitudes are measured positive east of the Green-wich meridian.

Format: float(24) External: f9.4NA Value: –999.0 Units: degreesRange: –180.0 ≤ lon ≤ 180.0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: lon1 Table: Seisindex (Dseisindex) Description: Western-most longitude of the first grid cell in Seisgrid (Dseisgrid).Format: float(24) External: f9.4NA Value: NOT ALLOWEDUnits: degreesRange: –180.0 ≤ lon1 ≤ 180.0

Name: lonmajor Table: Mapdisc Description: Longitude interval (in degrees) for displaying major grid lines in the Map

application.Format: float(24) External: f9.4NA Value: –999.0 Units: degreesRange: 0 < lonmajor < 180.0

Name: lonminor Table: Mapdisc Description: Longitude interval (in degrees) for displaying minor grid lines in the Map

application.Format: float(24) External: f9.4NA Value: –999.0 Units: degreesRange: –180.0 < lonminor < 180.0

289b e r 2 0 0 2

290

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: lonorigradians Table: Mapdisc Description: Longitude origin radians. Coordinates in radians of the lower left corner in the

Map application. Map uses this for mercator projections only.Format: float(24) External: f9.4NA Value: –999.0 Units: radiansRange: −π ≤ latorigradians ≤ π

Name: low_cut Table: Hydro_features Description: Low-cut frequency of filter.Format: float(24) External: f9.4NA Value: –1.0 Units: HertzRange: low_cut > 0.0

Name: lsta Table: Ev_summary (Ex_summary, An_summary) Description: Number of local arrival times associated with an event. “Local” is currently

defined as a station-event distance of less than 250 km.Format: number(8) External: i8NA Value: –1 Range: lsta > 0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: machine Table: Dlfile, Dlman, Fwsite

Description: Fully qualified domain name of the computer where the connection manager resides.

Format: varchar2(32) External: a32NA Value: - (hyphen)Range: any string up to 32 characters that points to a valid machine

Name: mag_all_stas Table: Event_control (In_event_control) Description: Logical descriptor that informs magnitude process whether or not it should

only use amplitude information from stations with magnitude test-site correc-tions. If TRUE (1), use all amplitude information in event magnitudes. If FALSE (0), use only amplitude data from stations possessing a magnitude test-site correction; any data without a valid correction will not be included in the magnitude determination. Only meaningful if mag_test_site is not null or “-.” Default is TRUE.

Format: number(1) External: i1NA Value: NOT ALLOWEDRange: mag_all_stas ∈ {0, 1}

Name: mag_alpha_only Table: Event_control (In_event_control) Description: Logical descriptor that restricts amplitude data to be used in the magnitude

determination to only those stations contained in the substation list. If FALSE (0), use all valid amplitudes. If TRUE (1), only “Primary seismic” station data are used for the magnitude calculation. This option is desirable in cases where the station network has varying station qualities contributing to the magni-tude. Default is FALSE.

Format: number(1) External: i1NA Value: NOT ALLOWEDRange: mag_alpha_only ∈ {0, 1}

291b e r 2 0 0 2

292

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: mag_sdv_mult Table: Event_control (In_event_control) Description: Magnitude large residual multiplier factor. This column is meaningful only

when mag_sdv_screen is set to TRUE (1). If TRUE, an amplitude with magni-tude residuals greater than this factor times its data variance (standard error) will be ignored by the magnitude process. Default is 3.0.

Format: float(24) External: f5.2NA Value: NOT ALLOWEDRange: mag_sdv_mult > 0.0

Name: mag_sdv_screen Table: Event_control (In_event_control) Description: Logical descriptor that tells magnitude process whether or not to ignore

amplitude data with magnitude residuals greater than mag_sdv_mult times its data standard error in determining the given magnitude. If FALSE (0), include data regardless of its residuals, provided it meets other pertinent conditions. Default is FALSE.

Format: number(1) External: i1NA Value: NOT ALLOWEDRange: mag_sdv_screen ∈ {0, 1}

Name: mag_src_dpnt_reg Table: Event_control (In_event_control) Description: Source-dependent region identifier for magnitude determination. If source-

dependent corrections are applied as part of the event magnitude determina-tion process, then mag_src_dpnt_reg indicates the region name.

Format: varchar2(15) External: a15NA Value: - (hyphen)Range: any free-format string up to 15 characters

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: magdef Table: Stamag Description: Magnitude defining switch. A one-character flag indicating whether or not a

station magnitude for a given stamag record was used in determining the net-work magnitude. This column is defining (magdef = d) if it is used in network magnitude calculation or nondefining (magdef = n) if it is not used.

Format: varchar2(1) External: a1NA Value: - (hyphen)Range: magdef ∈ {d, n}

Name: magid Table: Netmag, Stamag

Description: Network magnitude identifier. This value is assigned to identify a network magnitude in the netmag table. This column is required for every network magnitude. Magnitudes given in Origin (Originref, Origin_temp_ga) must ref-erence a network magnitude with magid = mbid, mlid or msid, whichever is appropriate (see mbid, mlid, or msid).

Format: number(8) External: i8NA Value: NOT ALLOWEDRange: magid > 0

Name: magnitude Table: Netmag, Stamag

Description: Magnitude. This column gives the magnitude value of the type indicated in magtype. The value is derived in a variety of ways, which are not necessarily linked directly to an arrival (see imb, iml, ims, magtype, mb, ml, and ms).

Format: float(24) External: f7.2NA Value: NOT ALLOWED

–999.0 for netmag

Units: magnitudeRange: magnitude > –2.0

293b e r 2 0 0 2

294

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: magpref_mb Table: Producttypeevsc Description: mb magnitude type used for screening (see Netmag.magtype). Default is

mb_ave.Format: varchar2(6) External: a6NA Value: NOT ALLOWED Range: any mb magnitude type up to six characters

Name: magpref_ms Table: Producttypeevsc Description: Ms magnitude type used for screening (see Netmag.magtype). Default is

ms_ave.Format: varchar2(6) External: a6NA Value: NOT ALLOWED Range: any Ms magnitude type up to six characters

Name: magres Table: Stamag Description: Magnitude residual. This column is the difference between the magnitude for

a given stamag record and the network magnitude.Format: float(24) External: f7.2NA Value: –999.0 Units: magnitudeRange: –10.0 < magres < 10.0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: magth Table: Seisgrid (Dseisgrid) Description: Magnitude threshold used to calculate the number of events per year in each

grid cell.Format: float(24) External: f7.2NA Value: NOT ALLOWED Range: any valid magnitude value

Name: magtype Table: Netmag, Producttypeorigin, Seisgrid (Dseisgrid), Stamag

Description: Magnitude type, for example, mb.Format: varchar2(6) External: a6

varchar2(4) for producttypeorigin

NA Value: NOT ALLOWED Range: any magnitude type up to six characters

Name: mapfiletype Table: Mapdisc Description: Specifies how the Map program handles the referenced Map file. If mapfiletype

= all, then the program reads the file in its entirety. If mapfiletype = blk, then the program reads only the blocks necessary for the display area.

Format: varchar2(4) External: a4NA Value: NOT ALLOWEDRange: mapfiletype ∈ {all, blk}

295b e r 2 0 0 2

296

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: mapid Table: Mapcolor, Mapdisc, Mapover

Description: Mapdisc identifier. Each mapdisc is assigned a unique positive integer that identifies it in a database.

Format: number(8) External: i8NA Value: NOT ALLOWEDRange: mapid > 0

Name: mapname Table: Mapdisc Description: Name of the map. Each map in the Map application is assigned a name for

identifying the map in a list of all maps.Format: varchar2(64) External: a64NA Value: NOT ALLOWEDRange: any string up to 64 characters

Name: maptype Table: Mapdisc Description: Type of map. A positive integer enumerator for identifying the output graphic

type, either raster or vector (maptype = 1 for raster and maptype = 2 for vec-tor).

Format: number(8) External: i8NA Value: NOT ALLOWEDRange: maptype ∈ {1, 2}

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: masked Table: Qcstats Description: Amount of data in the processing interval masked due to point-spikes, spikes,

or constant value segments.Format: float(53) External: f17.5NA Value: –999.0 Units: secondsRange: masked ≥ 0

Name: maxdelta Table: Allow_resid Description: Maximum station to event distance.Format: float(24) External: f8.3NA Value: –1.0 Units: degreesRange: maxdelta ≥ 0.0

Name: maxdep_err Table: Producttypeorigin Description: Maximum of depth_error product constraint.Format: float(24) External: f9.4NA Value: 999.0 Units: kilometersRange: mindeperr < maxdep_err < 999.0

297b e r 2 0 0 2

298

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: maxdepth Table: Producttypeorigin Description: Maximum depth value for a product constraint.Format: float(24) External: f9.4NA Value: 999.0 Units: kilometersRange: mindepth < maxdepth < 999.0

Name: maxdist Table: Origaux Description: Distance to farthest station.Format: float(24) External: f6.2NA Value: –1.0 Units: degreesRange: 0.0 ≤ maxdist ≤ 180.0

Name: maxesd Table: Producttypeorigin Description: Maximum distance between the event and a station.Format: float(24) External: f6.2NA Value: –1 Units: degreesRange: minesd ≤ maxesd ≤ 180.0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: maxf Table: Fsave, Fsdisc Description: Maximum frequency. Frequency of the last sample in a Fourier spectrum.Format: float(24) External: f9.4

float(9) for fsave

NA Value: –1.0 Units: HertzRange: maxf > 0.0

Name: maxkx Table: Fkdisc Description: Maximum wavenumber along x-axis in an f-k spectrum. F-k spectra are

assumed to be symmetrical, ranging from –maxkx to maxkx.Format: float(24) External: f7.4NA Value: –1.0 (Either maxkx or maxsx must be set.)Units: kilometers-1 Range: maxkx > 0.0

Name: maxky Table: Fkdisc Description: Maximum wavenumber along y-axis of an f-k spectrum. F-k spectra are

assumed to be symmetrical, ranging from –maxky to maxky.Format: float(24) External: f7.4NA Value: –1.0 (Either maxky or maxsy must be set.)Units: kilometers-1 Range: maxky > 0.0

299b e r 2 0 0 2

300

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: maxlat Table: Producttypeorigin, Producttypesta

Description: Maximum latitude. Locations north of the equator have positive latitude. Format: float(24) External: f9.4NA Value: 999.0 Units: degreesRange: –90.0 ≤ maxlat ≤ 90.0

Name: maxlon Table: Producttypeorigin, Producttypesta

Description: Maximum longitude. Locations east of the Greenwich Meridian have positive longitude.

Format: float(24) External: f9.4NA Value: 999.0 Units: degreesRange: –180.0 ≤ maxlon ≤ 180.0

Name: maxmag Table: Producttypeorigin Description: Maximum value of magnitude for a product constraint.Format: float(24) External: f7.2NA Value: 999.0 Units: magnitudeRange: minmag < maxmag < 999.0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: maxmb_ms Table: Producttypeorigin Description: Maximum value of mb – Ms.Format: float(24) External: f7.2NA Value: 999.0 Units: magnitudeRange: minmb_ms < maxmb_ms < 999.0

Name: maxsx Table: Fkdisc Description: Maximum slowness along the x-axis in a broadband f-k spectrum. F-k spectra

are assumed to be symmetrical, ranging from –maxsx to maxsx.Format: float(24) External: f7.4NA Value: –1.0 (Either maxkx or maxsx must be set.)Units: seconds/kilometerRange: maxsx > 0.0

Name: maxsy Table: Fkdisc Description: Maximum slowness along the y-axis in a broadband f-k spectrum. F-k spectra

are assumed to be symmetrical, ranging from –maxsy to maxsy.Format: float(24) External: f7.4NA Value: –1.0 (Either maxsy or maxky must be set.)Units: seconds/kilometerRange: maxsy > 0.0

301b e r 2 0 0 2

302

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: maxtime Table: Fwfile Description: Greatest time period that a gap in the data can span.Format: float(53) External: f17.5NA Value: –999.0 Units: secondsRange: maxtime > 0

Name: mb Table: Evsc_prod, Origin (Originref, Origin_temp_ga) Description: Body wave magnitude, mb.

(origin) This is the body wave magnitude of an event. The identifier mbid that points to magid in the Netmag table is associated with this column. The infor-mation in that record summarizes the method of analysis and data used (see imb, iml, ims, magnitude, magtype, ml, and ms). (evsc_prod) Body wave magnitude for event screening. The type of measure-ment is indicated by magtype_mb.

Format: float(24) External: f7.2NA Value: –999.0 Units: magnitudeRange: mb > –2.0

Name: mb_err Table: Producttypeevsc Description: Uncertainty of single-station mb magnitude estimates, used in the computa-

tion of the confidence interval of the network estimate of mb minus Ms. Format: float(24) External: f7.2NA Value: –999.0 Units: magnitudeRange: 0.0 < mb_err < 10.0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: mb_max_dist Table: Event_control (In_event_control) Description: Body wave magnitude (mb) station magnitudes at distances greater than

mb_max_dist will not be used in network magnitude calculations.Format: float(24) External: f9.4NA Value: –999.0 Units: degreesRange: 0.0 ≤ mb_max_dist ≤ 180.0

Name: mb_min_dist Table: Event_control (In_event_control) Description: Body wave magnitude (mb) station magnitudes at distances less than

mb_min_dist will not be used in network magnitude calculations.Format: float(24) External: f9.4NA Value: –999.0 Units: degreesRange: 0.0 ≤ mb_min_dist ≤ 180.0

Name: mbid Table: Origin (Originref, Origin_temp_ga) Description: Magnitude identifier for mb. This column stores the magid for a record in Net-

mag. Mbid is a foreign key joining origin to netmag where origin.mbid = net-mag.magid (see magid, mlid, and msid).

Format: number(8) External: i8NA Value: –1 Range: mbid > 0

303b e r 2 0 0 2

304

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: mbms Table: Evsc_prod Description: Difference of body and surface wave magnitudes, mb minus Ms, including a

slope term given by mbms_slope of table Producttypeevsc. Format: float(24) External: f7.2NA Value: –999.0 Units: magnitudeRange: mbms > –999.0

Name: mbms_conf Table: Producttypeevsc Description: Confidence level for the mb minus Ms screening criterion. This confidence

level is for a one-sided confidence interval for mb minus Ms.Format: float(24) External: f7.2NA Value: –999.0 Range: 0.0 < mbms_conf < 1.0

Name: mbms_slope Table: Producttypeevsc Description: Slope term (A) for the mb minus Ms relation (Amb – Ms) to account for cali-

bration of magnitude dependence of the screening criterion. The standard default value is 1.25. A typical range of reasonable values is from +1.0 to +2.0.

Format: float(24) External: f7.2NA Value: –999.0 Range: 0.0 < mbms_slope < 999.0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: mbms_thresh Table: Producttypeevsc Description: Threshold for the mb minus Ms screening criterion. Events with one-sided

confidence intervals for mb minus Ms (Amb – Ms, including the slope term) less than this threshold are screened out at the confidence level given by mbms_conf. Typical values of this threshold range from +1.0 to +4.0, depend-ing on the slope term given by mbms_slope.

Format: float(24) External: f7.2NA Value: –999.0 Units: magnitudeRange: 0.0 < mbms_thresh < 999.0

Name: mbmserr Table: Evsc_prod Description: Error of mb minus Ms. This is the size of the one-sided confidence interval

used for the mb minus Ms screening criterion for a confidence level given by mbms_conf of table Producttypeevsc.

Format: float(24) External: f7.2NA Value: –999.0 Units: magnitudeRange: mbmserr > –999.0

Name: mean_arrival_time Table: Hydro_features Description: Mean arrival time of the estimated signal energy, in epoch time.Format: float(53) External: f17.5NA Value: NOT ALLOWEDUnits: secondsRange: any valid epoch time

305b e r 2 0 0 2

306

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: medium Table: Explo Description: Explosion shot medium.Format: varchar2(48) External: a48NA Value: - (hyphen)Range: any lower-case string up to 48 characters

Name: merge_adjacent Table: Arch_data_type Description: Merge flag. If y, Archive should merge adjacent rows.Format: varchar2(2) External: a2NA Value: - (hyphen)Range: merge_adjacent ∈ {y, n}

Name: mfoff Table: Msgdisc Description: Offset in bytes to beginning of message.Format: number(10) External: i10NA Value: –1 Units: bytes Range: mfoff > 0

Name: min_dp_snr_pp Table: Producttypeevsc Description: Minimum pP depth phase signal-to-noise ratio required for depth phase analy-

sis.Format: float(24) External: f7.2NA Value: –999.0 Range: 0 < min_dp_snr_pp < 999

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: min_dp_snr_sp Table: Producttypeevsc Description: Minimum sP depth phase signal-to-noise ratio required for depth phase analy-

sis.Format: float(24) External: f7.2NA Value: –999.0 Range: 0 < min_dp_snr_sp < 999

Name: min_dt_pp Table: Evsc_prod Description: pP–P travel-time difference at nearest station beyond 25 deg.Format: float(24) External: f7.2NA Value: –999.0 Units: seconds Range: 0 < min_dt_pp < 999

Name: min_dt_sp Table: Evsc_prod Description: sP–P travel-time difference at nearest station beyond 25 deg.Format: float(24) External: f7.2NA Value: –999.0 Units: seconds Range: 0 < min_dt_sp < 999

307b e r 2 0 0 2

308

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: min_mb Table: Producttypeevsc Description: Minimum mb magnitude for application of event-screening criteria.Format: float(24) External: f7.2NA Value: –999.0 Units: magnitudeRange: min_mb > –999.0

Name: min_moveout_pp Table: Producttypeevsc Description: Minimum (pP–P) travel time moveout required for the depth screening crite-

rion to be applied to depth-phase solutions.Format: float(24) External: f7.2NA Value: –999.0 Units: secondsRange: –999.0 < min_moveout_pp < 999.0

Name: min_moveout_sp Table: Producttypeevsc Description: Minimum (sP–P) travel time moveout required for the depth screening crite-

rion to be applied to depth-phase solutions.Format: float(24) External: f7.2NA Value: –999.0 Units: secondsRange: –999.0 < min_moveout_sp < 999.0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: min_ndef Table: Producttypeevsc Description: Minimum number of defining phases required for the event-screening criteria

to be applied to a seismic-acoustic event.Format: number(8) External: i8NA Value: –1 Range: min_ndef > 0

Name: min_ndp_pp Table: Producttypeevsc Description: Minimum number of pP depth phases required for the depth screening crite-

rion to be applied to depth-phase solutions.Format: number(8) External: i8NA Value: –1 Range: min_ndp_pp > 0

Name: min_ndp_sp Table: Producttypeevsc Description: Minimum number of sP depth phases required for the depth screening crite-

rion to be applied to depth-phase solutions.Format: number(8) External: i8NA Value: –1 Range: min_ndp_sp > 0

309b e r 2 0 0 2

310

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: min_nsta_ms Table: Producttypeevsc Description: Minimum number of stations required to contribute to the network Ms esti-

mate for the mb minus Ms screening criterion to be applied.Format: number(8) External: i8NA Value: –1 Range: 0 < min_nsta_ms < 1000

Name: min_wdepth Table: Evsc_prod Description: Minimum depth of water within the location error ellipse defined by smaj_sc,

smin_sc, and strike.Format: float(24) External: f7.2NA Value: –999.0 Units: metersRange: min_wdepth > 0.0

Name: min_wdepth_thresh Table: Producttypeevsc Description: Minimum water depth threshold for application of the hydroacoustic screen-

ing criteria.Format: float(24) External: f7.2NA Value: –999.0 Units: kilometersRange: 0.0 < min_wdepth_thresh < 10.0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: mindelta Table: Allow_resid Description: Minimum station to event distance.Format: float(24) External: f8.3NA Value: –1.0 Units: degreesRange: mindelta ≥ 0.0

Name: mindep_err Table: Producttypeorigin Description: Minimum value of depth_error constraint.Format: float(24) External: f9.4NA Value: –999.0 Units: kilometersRange: –999.0 < mindep_err < maxdep_err

Name: mindepth Table: Producttypeorigin Description: Minimum depth product constraint.Format: float(24) External: f9.4NA Value: –999.0 Units: kilometersRange: –999.0 < mindepth < maxdepth

311b e r 2 0 0 2

312

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: mindist Table: Origaux Description: Distance to closest station.Format: float(24) External: f6.2NA Value: –1.0 Units: degreesRange: 0.0 ≤ maxdist ≤ 180.0

Name: minesd Table: Producttypeorigin Description: Minimum distance between an event and stations.Format: float(24) External: f6.2NA Value: –1.0 Units: degreesRange: 0.0 ≤ minesd ≤ maxesd

Name: minlat Table: Producttypeorigin, Producttypesta

Description: Minimum latitude. Locations north of the equator have positive latitude. Format: float(24) External: f9.4NA Value: –999.0 Units: degreesRange: –90.0 ≤ minlat ≤ 90.0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: minlon Table: Producttypeorigin, Producttypesta

Description: Minimum longitude defining a reference area. Locations east of the Green-wich Meridian have positive longitude.

Format: float(24) External: f9.4NA Value: –999.0

Units: degreesRange: –180.0 ≤ minlon ≤ 180.0

Name: minmag Table: Producttypeorigin Description: Minimum value of the magnitude constraint.Format: float(24) External: f7.2NA Value: –999.0 Units: magnitudeRange: –999.0 < minmag < maxmag

Name: minmb_ms Table: Producttypeorigin Description: Minimum value of mb – Ms product constraint.Format: float(24) External: f7.2NA Value: –999.0 Units: magnitudeRange: –999.0 < minmb_ms < maxmb_ms

313b e r 2 0 0 2

314

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: missing Table: Qcstats Description: Amount of missing data in the interval.Format: float(53) External: f17.5NA Value: NOT ALLOWEDUnits: secondsRange: masked < 9999999999.999

Name: ml Table: Origin (Originref, Origin_temp_ga) Description: Local magnitude (ML) of an event. The identifier mlid, which points to magid

in the Netmag table, is associated with this column. The information in that record summarizes the method of analysis and the data used (see imb, iml, ims, magnitude, magtype, mb, and ms).

Format: float(24) External: f7.2NA Value: –999.0 Units: magnitudeRange: ml > –2.0

Name: mlid Table: Origin (Originref, Origin_temp_ga) Description: Magnitude identifier for ml. This column stores the magid for a record in Net-

mag. Mlid is a foreign key joining origin to netmag, where table.mlid = table.magid (see magid, msid, and mbid).

Format: number(8) External: i8NA Value: –1 Range: mlid > 0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: mmodel Table: Event_control (In_event_control), Stamag

Description: Magnitude model. This character string identifies the magnitude model employed for station (stamag) or overall network magnitude calculation (event_control). In stamag, mmodel is the unique magnitude model as extracted from the magnitude correction file. In event_control, mmodel indicates only whether or not mixed models were employed (mixed) or a unique magnitude model was used for all stations. In the latter case, it would be identical to stamag.mmodel.

Format: varchar2(15) External: a15NA Value: - (hyphen)Range: any free-format string up to 15 characters

Name: modauthor Table: Request Description: Author of last state change.Format: varchar2(15) External: a15NA Value: - (hyphen)Range: any string up to 15 characters

Name: moddate Table: Interval Description: Modification date. The date and time the record was last updated (state col-

umn) in the database.Format: date External: a17NA Value: NOT ALLOWEDRange: any valid ORACLE date

315b e r 2 0 0 2

316

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: modtime Table: Request Description: Modification time. The epoch time that the record was last updated in the

database.Format: float(53) External: f17.5NA Value: NOT ALLOWEDUnits: secondsRange: any valid epoch time

Name: moist Table: Explo Description: Moisture content of explosion shot-point medium.Format: float(24) External: f5.2NA Value: –1 Units: 1/100%Range: moist ≤ 1.0

Name: moveout_pp Table: Evsc_prod Description: Moveout of (pP–P) travel times for seismic stations between 25 and 100

degrees from an event.Format: float(24) External: f7.2NA Value: –999.0 Units: secondsRange: moveout_pp > –999.0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: moveout_sp Table: Evsc_prod Description: Moveout of (sP–P) travel times for seismic stations between 25 and 100

degrees from an event.Format: float(24) External: f7.2NA Value: –999.0 Units: secondsRange: moveout_sp > –999.0

Name: mpdescrip Table: Mappoint Description: Arbitrary string describing the referenced geographic point.Format: varchar2(50) External: a50NA Value: - (hyphen)Range: any string up to 50 characters

Name: mplabel Table: Mappoint Description: String used as a label for the geographic point described by a record in the

mappoint table (for example, Paris, London, K8, and so on).Format: varchar2(65) External: a65NA Value: - (hyphen)Range: any string up to 65 characters

317b e r 2 0 0 2

318

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: mptype Table: Mappoint Description: String specifying the type of geographic point described by a record in the

mappoint table. Examples include cities, mines, and so on.Format: varchar2(20) External: a20NA Value: - (hyphen)Range: any free-format (spaces allowed) string up to 20 characters

Name: ms Table: Evsc_prod, Origin (Originref, Origin_temp_ga) Description: Surface wave magnitude. Format: (origin) This is the surface wave magnitude for an event. The identifier msid,

which points to magid in the Netmag table, is associated with this column. The information in that record summarizes the method of analysis and the data used (see imb, iml, ims, magnitude, magtype, mb, and ml). (evsc_prod) Surface wave magnitude for event screening.

Format: float(24) External: f7.2NA Value: –999.0 Units: magnitudeRange: ms > –2.0

Name: ms_err Table: Producttypeevsc Description: Uncertainty of single-station Ms magnitude estimates used in the computation

of the confidence interval of the network estimate of mb minus Ms. Format: float(24) External: f7.2NA Value: –999.0 Units: magnitudeRange: 0.0 < ms_err < 10.0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: mscore Table: Evsc_prod Description: Score for the mb minus Ms event-screening criterion.Format: float(24) External: f7.2NA Value: –999.0 Range: mscore > –999.0

Name: msgdformat Table: Fpdescription, Msgdatatype

Description: General format of the data that follows.Format: varchar2(16) External: a16NA Value: NOT ALLOWEDRange: any string up to 16 characters

Name: msgdid Table: Msgdest Description: Message destination identifier.Format: number(8) External: i8NA Value: –1 Range: msgdid > 0

Name: msgdtype Table: Fpdescription, Msgdatatype

Description: Data type of a data section within an AutoDRM message.Format: varchar2(16) External: a16NA Value: NOT ALLOWEDRange: any string up to 16 characters that is a recognized data type

319b e r 2 0 0 2

320

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: msgid Table: Ftpfailed, Msgaux, Msgdatatype, Msgdest, Msgdisc, Prodtrack Description: Message identifier. In msgdest, this column is the message identifier of the

response message created by AutoDRM.Format: number(8) External: i8NA Value: –1 Range: msgid > 0

Name: msgrow Table: Msgaux Description: Number of lines in a message.Format: number(4) External: i4NA Value: –1 Units: lines Range: msgrow > 0

Name: msgsrc Table: Msgdisc Description: Source code from where the message was sent.Format: varchar2(16) External: a16NA Value: - (hyphen)Range: any string up to 16 characters

Name: msgtype Table: Datauser, Msgdisc Description: Message type.Format: varchar2(16) External: a16NA Value: - (hyphen)Range: any string up to 16 characters

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: msgver Table: Msgdisc Description: Message Subsystem version number.Format: varchar2(8) External: a8NA Value: - (hyphen)Range: any string up to eight characters

Name: msid Table: Origin (Originref, Origin_temp_ga) Description: Magnitude identifier for ms. This column stores the magid for a record in Net-

mag. Msid is a foreign key joining origin to netmag, where table.msid = table.magid (see magid, mlid, and mbid).

Format: number(8) External: i8NA Value: –1 Range: msid > 0

Name: msize Table: Msgdatatype, Msgdisc

Description: Size of bytes of message or section of a message.Format: number(8) External: i8

number(10) for msgdisc NA Value: –1 Units: bytesRange: msize > 0

321b e r 2 0 0 2

322

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: mtype Table: Ampdescript Description: Measurement type. This column defines how the amplitude is measured in a

given time window. The following values are allowed: peak (maximum amplitude), stav (maximum short-term average amplitude), rms (root-mean-squared amplitude), peak2tr (maximum peak-to-trough amplitude), and 1stpeak (first motion amplitude).

Format: varchar2(8) External: a8NA Value: - (hyphen)Range: mtype ∈ {peak, stav, rms, peak2tr, 1stpeak}

Name: multev Table: Ex_an Description: Indicates whether or not another analyst event solution is within 50 km and 5

minutes of the analyst event (for example, multiple event).Format: varchar2(4) External: a4NA Value: - (hyphen)Range: multev ∈ {y, n}

Name: na_value Table: Na_value Description: Value to be inserted for a column when no other value is available.Format: varchar2(30) External: a30NA Value: NOT ALLOWEDRange: any string up to 30 characters that is valid for that column

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: name Table: Chan_groups, Explo, Fpdescription, Interval, Site_address

Description: Name of a constant, variable, or parameter.Format: varchar2(20) External: a20

varchar2(16) for chan_groups varchar2(32) for explo varchar2(64) for fpdescription

NA Value: - (hyphen)Range: any string up to (16, 20, 32, 64) characters

Name: narr1 Table: Bull_comp Description: Number of associated arrivals for orid1.

Format: number(8) External: i8NA Value: –1 Range: narr1 ≥ 0

Name: narr2 Table: Bull_comp Description: Number of associated arrivals for orid2.

Format: number(8) External: i8NA Value: –1 Range: narr2 ≥ 0

323b e r 2 0 0 2

324

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: nass Table: Origin (Originref, Origin_temp_ga) Description: Number of associated arrivals. This column gives the number of arrivals asso-

ciated with the origin.Format: number(4) External: i4NA Value: –1 Range: nass > 0

Name: navcep Table: Timefreq Description: Average maximum value in the two-dimensional cepstrum of the north com-

ponent traces.Format: float(24) External: f7.2NA Value: NOT ALLOWEDRange: navcep ≥ 0

Name: nave Table: Fsave Description: Number of spectra averaged to produce the averaged spectrum.Format: number(4) External: i4NA Value: NOT ALLOWEDRange: nave ≥ 1

Name: navcor Table: Timefreq Description: Average autocorrelation along the time axis across all frequencies excluding

randomized points of the north component traces.Format: float(24) External: f7.2NA Value: NOT ALLOWEDRange: navcor ≥ 0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: navpct Table: Timefreq Description: Average ratio of bad points to total of the north component traces.Format: float(24) External: f7.2NA Value: NOT ALLOWEDRange: 0 ≤ navpct ≤ 1

Name: ncalib Table: Beamaux, Instrument

Description: Nominal calibration factor. This conversion factor maps digital data to earth displacement. The factor holds true at the oscillation period specified by ncalper. A positive value means ground motion increasing in component direction (up, north, east) is indicated by increasing counts. A negative value means the opposite. Actual calibration for a particular recording is determined using the Wfdisc (Wfproto) and Sensor tables (see calratio).

Format: float(24) External: f16.6NA Value: NOT ALLOWEDUnits: nanometers/digital countRange: ncalib ≠ 0

Name: ncalper Table: Beamaux, Instrument

Description: Calibration period. This column is the period for which ncalib is valid.Format: float(24) External: f16.6NA Value: NOT ALLOWEDUnits: secondsRange: ncalper > 0.0

325b e r 2 0 0 2

326

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: nconstseg Table: Qcstats Description: Number of constant valued segments in the detection processing interval.Format: number(8) External: i8NA Value: –1 Range: nconstseg ≥ 0

Name: ndc Table: Fwfile, Fwgap, Fwsite

Description: Destination to which data are forwarded by the Continuous Data Subsystem.Format: varchar2(6) External: a6NA Value: - (hyphen)Range: any upper-case string up to six characters

Name: ndef Table: Ev_summary (Ex_summary, An_summary), Origin (Originref, Origin_temp_ga)

Description: Number of time-defining phases.Format: number(4) External: i4

number(8) for ev_summary

NA Value: –1 Range: 0 < ndef ≤ nass

Name: ndef1 Table: Bull_comp Description: Number of time-defining phases for orid1. Format: number(8) External: i8NA Value: –1 Range: ndef1 ≥ 0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: ndef1arr2 Table: Bull_comp Description: Number of defining arrivals for orid1 that are arrivals (defining or nondefin-

ing) for orid2.Format: number(8) External: i8NA Value: –1 Range: ndef1arr2 ≥ 0

Name: ndef2 Table: Bull_comp Description: Number of time-defining phases for orid2.

Format: number(8) External: i8NA Value: –1 Range: ndef2 ≥ 0

Name: ndef2arr1 Table: Bull_comp Description: Number of defining arrivals for orid2 that are arrivals (defining or nondefin-

ing) for orid1.

Format: number(8) External: i8NA Value: –1 Range: ndef2arr1 ≥ 0

Name: ndp Table: Origin (Originref, Origin_temp_ga) Description: Number of depth phases. This column gives the number of depth phases used

in calculating depth/depdp (see depdp).Format: number(4) External: i4NA Value: –1 Range: ndp ≥ 0

327b e r 2 0 0 2

328

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: ndp_snr_pp Table: Evsc_prod Description: Number of pP depth phases meeting the snr criterion defined by

min_dp_snr_pp of table Producttypeevsc.Format: number(8) External: i8NA Value: –1 Range: ndp_snr_pp > –1

Name: ndp_snr_sp Table: Evsc_prod Description: Number of sP depth phases meeting the snr criterion defined by

min_dp_snr_sp of table Producttypeevsc.Format: number(8) External: i8NA Value: –1 Range: ndp_snr_sp > –1

Name: nearaz Table: Ev_summary (Ex_summary, An_summary) Description: Azimuth from nearest station to the event.Format: float(24) External: f7.2NA Value: –1.0 Units: degreesRange: 0 ≤ nearaz < 360.0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: neardist Table: Ev_summary (Ex_summary, An_summary) Description: Distance from the event to the closest station.Format: float(24) External: f8.3NA Value: –1.0 Units: kilometersRange: neardist > 0.0

Name: nearsta Table: Ev_summary (Ex_summary, An_summary) Description: Code for the nearest station to the event.Format: varchar2(6) External: a6NA Value: - (hyphen)Range: any valid station code

Name: net Table: Affiliation (Stanet), Hydro_arr_group, Netmag, Network, Participation, Sitepoll,

Weights

Description: Unique network identifier. This character string is the name of a seismic net-work. One example is WWSSN.

Format: varchar2(8) External: a8 varchar2(6) for sitepoll

NA Value: NOT ALLOWED - (hyphen) for netmag

Range: any string up to eight characters

329b e r 2 0 0 2

330

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: netname Table: Network Description: Network name. String containing the name of a network.Format: varchar2(80) External: a80NA Value: - (hyphen)Range: any string up to 80 characters

Name: nettype Table: Network Description: Network type. This four-character string specifies the type of network (ar =

array, lo = local area, ww = world-wide) for the given value of net.Format: varchar2(4) External: a4NA Value: - (hyphen)Range: any lower-case string up to four characters

Name: nevyr Table: Seisgrid (Dseisgrid) Description: Average number of events per year with magnitude above magth whose loca-

tion is within the grid cell defined by icell.

Format: float(24) External: f9.2NA Value: NOT ALLOWEDRange: nevyr ≥ 0

Name: nf Table: Fsave, Fsdisc

Description: Number of frequency values in the spectrum file.Format: number(8) External: i4NA Value: NOT ALLOWEDRange: nf > 0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: nfft Table: Fsrecipe Description: Number of data points in FFT.Format: number(8) External: i8NA Value: NOT ALLOWEDRange: nfft > 1

Name: nhydarr Table: Hydro_arr_group Description: Number of arrivals in the group.Format: number(4) External: i4NA Value: –1 Range: nhydarr ≤ number of stations in the group

Name: nlat Table: Seisindex (Dseisindex) Description: Number of latitudes in Seisgrid (Dseisgrid).Format: number(8) External: i8NA Value: NOT ALLOWEDRange: nlat > 0.0

Name: nlon Table: Seisindex (Dseisindex) Description: Number of longitudes in Seisgrid (Dseisgrid).Format: number(8) External: i8NA Value: NOT ALLOWEDRange: nlon > 0.0

331b e r 2 0 0 2

332

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: nmatch Table: Bull_comp Description: Number of matching arrivals (defining or nondefining) between orid1 and

orid2.

Format: number(8) External: i8NA Value: NOT ALLOWED Range: nmatch ≥ 0

Name: nois Table: Siteaux Description: Nominal background seismic noise level.Format: float(24) External: f10.1NA Value: –1.0 Units: nanometersRange: nois ≥ 0.0

Name: noise_high_band Table: Evsc_hydro Description: Hydroacoustic noise level in the high-frequency band (32–64 Hz) from table

amplitude for a given orid/sta pair.Format: float(24) External: f7.2NA Value: –1.0 Units: dB re µPaRange: noise_high_band > 0.0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: noissd Table: Fsave, Siteaux

Description: Standard deviation of the log noise amplitude.Format: float(24) External: f5.2NA Value: –999.0 Range: noissd > 0.0

Name: note_missing_data Table: Arch_data_type Description: Missing data flag. If y, there are missing data for the datatype indicated in the

arch_data_type table.Format: varchar2(2) External: a2NA Value: - (hyphen)Range: note_missing_data ∈ {y, n}

Name: nsamp Table: Wfdisc (Wfproto) Description: Number of samples. This quantity is the number of samples in a waveform

segment. Format: number(8) External: i8NA Value: NOT ALLOWED Range: nsamp > 0

Name: nseg Table: Qcstats Description: Number of masked segments in the detection processing interval.Format: number(8) External: i8NA Value: –1 Range: nseg ≥ 0

333b e r 2 0 0 2

334

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: nsta Table: Ev_summary (Ex_summary, An_summary), Netmag, Origaux

Description: Number of stations. In ev_summary this column is the number of stations with an associated arrival. In netmag this column is the number of stations contrib-uting to the network magnitude estimate. In origaux this column is the number of defining stations.

Format: number(8) External: i8NA Value: –1 Range: nsta > 0

1 ≤ nsta ≤ 9999 for origaux

Name: nsta_mb Table: Evsc_prod Description: Number of stations contributing to the mb estimate used in event screening.Format: number(8) External: i8NA Value: –1 Range: nsta_mb > –1

Name: nsta_ms Table: Evsc_prod Description: Number of stations contributing to the Ms estimate used for event screening.Format: number(8) External: i8NA Value: –1 Range: nsta_ms > –1

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: num_cross Table: Hydro_features Description: Number of times that the estimated signal pressure squared crosses

noise_onset_thresh between onset_time and termination_time.Format: number(8) External: i8NA Value: –1 Range: num_cross > 0

Name: numfailedattempt Table: Ftpfailed Description: Number of failed attempts to retrieve message via FTP.Format: number(4) External: i4NA Value: 0 Range: numfailedattempt > 0

Name: nx Table: Fkdisc Description: Total number of X sample points (either slowness or wavenumber, depending

on fktyp) in a f-k spectrum.Format: number(4) External: i4NA Value: NOT ALLOWEDRange: nx > 0

Name: ny Table: Fkdisc Description: Total number of Y sample points (either slowness or wavenumber, depending

on fktyp) in a f-k spectrum.Format: number(4) External: i4NA Value: NOT ALLOWEDRange: ny > 0

335b e r 2 0 0 2

336

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: objtype Table: Ga_tag Description: Defines the id as either an arid (a) or an orid (o).Format: varchar2(1) External: a1NA Value: NOT ALLOWEDRange: objtype ∈ {a, o}

Name: obsolete Table: Fileproduct (Fs_stageproduct) Description: Flag to indicate if the data in the fileproduct file are obsolete. 0 indicates that

the data are not obsolete, and 1 indicates that the data are obsolete.Format: number(1) External: i1NA Value: NOT ALLOWEDRange: obsolete ∈ {0, 1}

Name: offdate Table: Arch_data_type, Chan_groups, Exception_chanmap, Regcoef, Site, Sitechan,

Std_chanmap, Subs, Weights Description: Turn off date. This column is the date after which the archive specifications,

regional coefficient, station, sensor, or subscription indicated was no longer applicable, turned off, dismantled, or moved (see ondate).

Format: number(8) External: a17 date for subs.

NA Value: –1 Jan 1, 4700 for subs

Range: Julian date of the form yyyyddd any valid oracle date for subs

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: ondate Table: Arch_data_type, Chan_groups, Exception_chanmap, Regcoef, Site, Sitechan,

Std_chanmap, Subs, Weights Description: Turn on date. This column is the date on which the archive specifications,

regional coefficient, station, sensor, or subscription indicated became applica-ble or began operating. Offdate and ondate are not intended to accommodate temporary downtimes, but rather to indicate the time period for which the col-umns of the station (lat, lon, elev) are valid for the given station code. Stations are often moved, but with the station code remaining unchanged.

Format: number(8) External: a17 date for subs

NA Value: NOT ALLOWEDRange: Julian date of the form yyyyddd

any valid oracle date for subs

Name: onset_time Table: Hydro_features Description: Estimated onset time of signal.Format: float(53) External: f17.5NA Value: NOT ALLOWEDUnits: secondsRange: any valid epoch time

Name: orderby Table: Seisindex (Dseisindex) Description: Grid order. The seismic grid can either be ordered by latitude or by longitude.Format: varchar2(6) External: a6NA Value: NOT ALLOWEDRange: orderby ∈ {lat, lon}

337b e r 2 0 0 2

338

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: orid Table: Assoc (Assoc_temp_ga), Ceppks, Complexity, Ev_summary (Ex_summary,

An_summary), Event_control (In_event_control), Evsc_hydro, Evsc_prod, Evsc_regional, Explo, Netmag, Origaux, Origerr (Origerr_temp_ga), Origin (Originref, Origin_temp_ga), Parrival, Request, Splp, Stamag, Timefreq

Description: Origin identifier that relates a record in these tables to a record in the origintable. In the disorigin table, orid refers to the analyst origin corresponding to a dissolved expert system event.

Format: number(8) External: i8NA Value: NOT ALLOWED

–1 for disorigin, origaux

Range: orid > 0

Name: orid1 Table: Bull_comp Description: Origin identifier from the bulletin1 database Origin (Originref,

Origin_temp_ga) table.Format: number(8) External: i8NA Value: –1 Range: orid1 > 0

Name: orid2 Table: Bull_comp Description: Origin identifier from the bulletin2 database Origin (Originref,

Origin_temp_ga) table.Format: number(8) External: i8NA Value: –1 Range: orid2 > 0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: otfixf Table: Origaux Description: Flag designating that an origin time is fixed.Format: varchar2(1) External: a1NA Value: - (hyphen)Range: otfixf ∈ {f}

Name: otgid Table: Outage Description: Outage identifier.Format: number(8) External: i8NA Value: NOT ALLOWEDRange: otgid > 0

Name: outauth Table: Wfconv Description: Flag showing if output data are authenticated.Format: varchar2(1) External: a1NA Value: - (hyphen)Range: outauth ∈ {y, n}

Name: outcomp Table: Wfconv Description: Output data compression type. The only type currently supported is Canadian

compression (CA).Format: varchar2(2) External: a2NA Value: 0 Range: outcomp ∈ {CA}

339b e r 2 0 0 2

340

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: outsamp Table: Wfconv Description: Number of output samples per packet.Format: number(8) External: i8NA Value: 0 Range: outsamp > 0

Name: outtype Table: Wfconv Description: Output fixed width datatype.Format: varchar2(2) External: a2NA Value: - (hyphen)Range: same as datatype

Name: overlap Table: Fsrecipe Description: Percent overlap of windows.Format: number(8) External: i3NA Value: NOT ALLOWEDRange: 0 < overlap < 100

Name: overlayid Table: Mapover, Overlaydisc Description: Overlay identifier.Format: number(8) External: i8NA Value: NOT ALLOWEDRange: overlayid > 0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: overlayname Table: Overlaydisc Description: Name of the map overlay.Format: varchar2(64) External: a64NA Value: - (hyphen)Range: any free format character string up to 64 characters

Name: paleodepth Table: Explo Description: Depth to the Paleozoic layer, measured from the surface.Format: float(24) External: f7.4NA Value: –1 Units: kilometersRange: paldep ≥ 0.0

Name: parid Table: Amplitude, Parrival Description: Predicted arrival identifier. Every event-based parrival measure is assigned a

unique positive integer that identifies it in the database. If an associated ampli-tude record exists, then parid links it to parrival.

Format: number(8) External: i8NA Value: NOT ALLOWED

–1 for amplitude

Range: parid > 0

341b e r 2 0 0 2

342

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: partition Table: Dlfile Description: Disk partition name.Format: varchar2(64) External: a64NA Value: NOT ALLOWEDRange: any string up to 64 characters that is a valid disk partition

Name: password Table: Ftplogin Description: Password for remote FTP site for pushing data messages from PIDC.Format: varchar2(16) External: a16NA Value: NOT ALLOWEDRange: any string up to 16 characters

Name: pctoffsh Table: Evsc_prod Description: Percentage of location error ellipse that is determined to be offshore. Format: float(24) External: f7.2NA Value: –999.0 Range: 0.0 ≤ pctoffsh < 100.0

Name: peak_level Table: Hydro_features Description: Pressure of largest absolute signal value.Format: float(24) External: f9.4NA Value: –1.0 Units: dB re µPaRange: peak_level ≥ 0.0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: peak_time Table: Hydro_features Description: Epoch time of largest absolute signal value.Format: float(53) External: f17.5NA Value: NOT ALLOWEDUnits: secondsRange: any valid epoch time

Name: per Table: Amplitude, Arrival Description: Measured period at the time of the amplitude measurement.Format: float(24) External: f7.2NA Value: –999.0 Units: secondsRange: per > 0.0

Name: phase Table: Allow_resid, Apma, Assoc (Assoc_temp_ga), Complexity, Parrival, Stamag,

Weights Description: Phase type. The identity of a phase that has been associated to an arrival. Stan-

dard labels for phases are used (for example, P, PKP, PcP, pP, and so on). Both upper- and lower-case letters are available and should be used when appropri-ate; for example, pP or PcP.

Format: varchar2(8), External: a8 varchar2(6) for complexity

NA Value: - (hyphen) if this column does not apply to seismic phasesRange: any string up to eight characters that conforms to scientific practice

343b e r 2 0 0 2

344

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: pkamp Table: Ceppks Description: Amplitude of consistent cepstral peak. This column value is set to zero if there

are no consistent peaks. Format: float(24) External: f7.5NA Value: 0.0 Units: nanometer-secondsRange: pkamp > 0.0

Name: pkqf Table: Ceppks Description: Frequency of consistent cepstral peak. This column value is set to zero if no

consistent peaks exist. Format: float(24) External: f8.4NA Value: 0.0 Units: secondsRange: pkqf > 0.0

Name: planlr Table: Apma Description: Planarity of an S-type polarization column defined as 1 – l3/l2, where l2 and l3

are eigenvalues from the decomposition of the covariance matrix. Planarity is measured at the time of maximum 3-component amplitude.

Format: float(24) External: f7.2NA Value: –1.0 Range: 0.0 ≤ planlr ≤ 1.0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: plans Table: Apma Description: Planarity of an S-type polarization column defined as 1 – l3/l2, where l2 and l3

are eigenvalues from the decomposition of the covariance matrix. Planarity is measured at the time of maximum 3-component amplitude. The only differ-ence between plans and planlr is in the definition of the overlapping time win-dows.

Format: float(24) External: f7.2NA Value: –1.0 Range: 0.0 ≤ plans ≤ 1.0

Name: plid Table: Problemlog Description: Problem log identifier.Format: number(8) External: i8NA Value: NOT ALLOWEDRange: plid > 0

Name: pn_snr Table: Evsc_regional Description: Signal-to-noise ratio of the Pn measurement.Format: float(24) External: f7.2NA Value: –999.0 Range: pn_snr > 0.0

345b e r 2 0 0 2

346

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: pnlg Table: Evsc_regional Description: Logarithm (base 10) of the distance corrected Pn/Lg ratio.Format: float(24) External: f7.2NA Value: –999.0 Range: pnlg > –999.0

Name: pnlg_qual Table: Evsc_regional Description: Data quality indicator for the Pn/Lg measurement. A string of zeros indicates

good data quality. See quality flag note for pnsn_qual.Format: varchar2(10) External: a10NA Value: - (hyphen)Range: any valid ORACLE string

Name: pnsmax Table: Evsc_regional Description: Maximum of the Pn/Sn and Pn/Lg ratios.Format: float(24) External: f7.2NA Value: –999.0 Range: pnsmax > –999.0

Name: pnsmax_corr Table: Evsc_regional Description: Correction term of the maximum of the Pn/Sn and Pn/Lg ratios.Format: float(24) External: f7.2NA Value: –999.0 Range: pnsmax_corr > –999.0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: pnsmax_err Table: Evsc_regional Description: Standard error of the maximum of the Pn/Sn and Pn/Lg ratios.Format: float(24) External: f7.2NA Value: –999.0 Range: pnsmax_err > –999.0

Name: pnsn Table: Evsc_regional Description: Logarithm (base 10) of the distance-corrected Pn/Sn amplitude ratio.Format: float(24) External: f7.2NA Value: –999.0 Range: pnsn > –999.0

Name: pnsn_qual Table: Evsc_regional Description: Data quality indicator for the Pn/Sn amplitude ratio measurement. A string of

zeros indicates good data quality. Each position in the quality string indicates the state of data quality test. A ‘0’ character indicates the data passed the test, a ‘1’ indicates the data failed the test. Reading from left-to-right, the test indi-cators are ordered as follows: 1. Missing data - ‘1’ indicates that Pn, Sn, Lg signal or noise values are not available for the calculation. 2. Signal-to-noise - ‘1’ indicates that the snr for a given amplitude ratio does not satisfy the input criteria. 3. No distance correction - ‘1’ indicates that there is no distance correction data available to apply to this amplitude ratio (see Attencoef). 4. Exceeds valid range of distance correction - ‘1’ indicates the event is out-side the valid range of applicability for the distance correction given in Atten-coef. 5. No correction grid file - ‘1’ indicates there is no correction grid file pro-vided for the station under consideration. 6. Exceeds valid range of correction grid file - ‘1’ indicates the event is out-side the valid range of the correction grid file provided for the station.

347b e r 2 0 0 2

348

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

7. Spare field (not currently used) - set to ‘0’. 8. Anomalous data value - ‘1’ indicates an anomalous regional phase ampli-tude measurement, invalidating the P/S measurement.

Format: varchar2(10) External: a10NA Value: - (hyphen)Range: any valid ORACLE string

Name: pocid Table: Datauser, Subsuser Description: Point of contact identifier.Format: number(8) External: i8NA Value: –1 Range: pocid > 0

Name: pointspike Table: Qcstats Description: Amount of data in the detection processing interval masked due to point-

spikes.Format: float(53) External: f17.5NA Value: –999.0 Units: secondsRange: pointspike ≥ 0.0

Name: port Table: Fwsite Description: Port on which the connection manager is listening.Format: number(6) External: i8NA Value: –1 Range: 1 < port < 16383

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: prefdlid Table: Alphasite Description: dlid for preferred DLMan for a given station.Format: number(8) External: i8NA Value: NOT ALLOWEDRange: prefdlid > 0

Name: prefer_loc Table: Event_control (In_event_control) Description: Preferred location identifier. This column indicates which of three possible

location solutions is the chosen location. The hypocenter can be either held to a surface location (S), determined with no constraints at all (free depth, F), or restrained based on the settings of constrain_ot, constrain_latlon, and constrain_depth, (R). The constrained location (R) can be fixed in origin time/latitude and longitude/depth. Prefer_loc takes precedence to the actual con-straint settings (constrain_ot, constrain_latlon, and constrain_depth) when prefer_loc indicates a surface (S) or free depth (F) location. Default is “S.”

Format: varchar2(1) External: a1NA Value: - (hyphen)Range: prefer_loc ∈ {F, S, R}

Name: prefor Table: Event Description: Preferred origin. This column holds the origin identifier (orid) that points to

the preferred origin for a seismic event.Format: number(8) External: i8NA Value: NOT ALLOWEDRange: prefor > 0

349b e r 2 0 0 2

350

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: prefport Table: Alphasite Description: Preferred network port for a given station.Format: number(6) External: i8NA Value: 0 Range: 1 ≤ prefport ≤ 16383

Name: prid Table: Problem, Problemlog

Description: Problem identifier.Format: number(8) External: i8NA Value: NOT ALLOWEDRange: prid > 0

Name: primarykey Table: Arch_data_type Description: Not used.Format: varchar2(24) External: a24NA Value: - (hyphen)Range: any string up to 24 characters

Name: primp Table: Ev_summary (Ex_summary, An_summary) Description: Number of primary time-defining phases. A primary phase is defined as the

first phase for a given station belonging to the set (P, Pn, Pg, PKP, PKPdf).Format: number(8) External: i8NA Value: –1 Range: primp ≥ 0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: priority Table: Datauser, Fwsite, Subsuser

Description: Priority assigned to process.Format: number(2) External: i2NA Value: –1

NOT ALLOWED for datauser Range: priority > 0

Name: prob_weight_time Table: Hydro_features Description: Probability weighted time. The weight for a sample is the probability that the

sample’s amplitude is the maximum amplitude associated with the arrival within the frequency band defined by low_cut, high_cut, ford, and ftype.

Format: float(53) External: f17.5NA Value: –999.0 Units: secondsRange: any valid epoch time

Name: procclass Table: Mig_date, Problem, Problemmail, Timestamp

Description: Process class used to group processes.Format: varchar2(16) External: a16

varchar2(17) for problem, problemmail

NA Value: NOT ALLOWEDRange: any string (upper case for mig_date) up to 16 characters

351b e r 2 0 0 2

352

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: procname Table: Mig_date, Problem, Timestamp

Description: Process name that identifies a process within a process class.Format: varchar2(16) External: a16

varchar2(17) for problem

NA Value: NOT ALLOWEDRange: any string (upper case for mig_date) up to character limit

Name: prodfmt Table: Productcriteria Description: Product format.Format: varchar2(6) External: a6NA Value: - (hyphen)Range: prodfmt ∈ {GSE2.0, IMS1.0}

Name: prodid Table: Evsc_prod, Prodtrack, Productcriteria, Producttypeevsc, Producttypeorigin,

Producttypesta, Subs

Description: Product identifier.Format: number(8) External: i8NA Value: –1 Range: prodid > 0

Name: prodname Table: Productcriteria Description: Name of the product.Format: varchar2(24) External: a24NA Value: - (hyphen)Range: any valid string up to 24 characters

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: prodsubtype Table: Productcriteria Description: Subtype of the product.Format: varchar2(12) External: a12NA Value: - (hyphen)Range: prodsubtype ∈ {sel1, sel2, sel3, reb, and so on}

Name: prodtype Table: Fpdescription, Productcriteria

Description: Product type.Format: varchar2(12) External: a12

varchar2(32) for productcriteria

NA Value: - (hyphen)Range: prodtype ∈ {origin, event, bulletin, arrival, detection, wave-

form}

Name: projection Table: Mapdisc Description: Projection of the Map; a positive integer enumerator for uniquely classifying

the stereographic projection of the Map. Azimuthal equidistant = 2; Mercator = 3.

Format: number(8) External: i8NA Value: NOT ALLOWEDRange: projection ∈ {2, 3}

353b e r 2 0 0 2

354

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: ptime Table: Apma Description: Epoch time at which P-type polarization columns are estimated. This column

value is the center of the time window with maximum rectilinearity.Format: float(53) External: f17.5NA Value: –9999999999.999 Units: secondsRange: any valid epoch time

Name: ptmcor Table: Siteaux Description: P-wave arrival time correction.Format: float(24) External: f6.3NA Value: –999.0 Units: secondsRange: ptmcor > –999.0

Name: ptyp Table: Ceppks Description: Consistent cepstral peak type. This column is FC-PHS if consistent Fourier

cepstral peaks are found across two or more phases for one array and no peak is in the noise cepstrum at this quefrency. Otherwise, it is “-” if no consistent cepstral peaks are found.

Format: varchar2(6) External: a6NA Value: - (hyphen)Range: ptyp ∈ {FC-PHS}

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: qcstatsid Table: Qcstats Description: Data quality statistics identifier.Format: number(8) External: i8NA Value: NOT ALLOWEDRange: qcstatsid > 0.0

Name: qual Table: Arrival Description: Onset quality. This single-character flag is used to denote the sharpness of the

onset of a seismic phase. This relates to the timing accuracy as follows: i (impulsive) – accurate to ±0.2 seconds e (emergent) – accuracy between ±(0.2 to 1.0 seconds) w (weak) – timing uncertain to > 1 second

Format: varchar (1) External: a1NA Value: - (hyphen)Range: qual ∈ {i, e, w}

Name: quer_seq_no Table: Mig_rules Description: Order of this part of the query for data migration.Format: number External: i4NA Value: NOT ALLOWEDRange: quer_seq_no ≥ 1

355b e r 2 0 0 2

356

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: query_type Table: Mig_rules Description: Type of query for data migration.Format: varchar2(20) External: a20NA Value: NOT ALLOWEDRange: query_type ∈ {COMMIT, CREATE_TABLE, DELETE, DROP_TABLE,

SELECT_INSERT}

Name: ratio Table: Splp Description: Ratio of short-period to long-period energy.Format: float(24) External: f10.8NA Value: NOT ALLOWEDRange: ratio > 0

Name: ratiotype Table: Attencoef Description: Amplitude ratio type. This identifies the type of P/S amplitude ratio (for

example, Pn/Lg or Pn/Sn) for which the attenuation coefficients apply.Format: varchar2(6) External: a6NA Value: - (hyphen)Range: any valid string up to 6 characters

Name: rcoefid Table: Regcoef Description: Linear coefficient set identifier. Format: varchar2(20) External: a20NA Value: - (hyphen)Range: any valid string up to 20 characters

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: rcoeftype Table: Regcoef Description: Type of linear weighting coefficient used in regional P/S screening criterion.Format: varchar2(10) External: a10NA Value: - (hyphen)Range: any valid string up to 10 characters

Name: rcoefvalue Table: Regcoef Description: Value of linear weighting coefficient used in regional P/S screening criterion.

Identified by rcoeftype.Format: float(24) External: f7.2NA Value: –999.0 Range: any valid floating point value

Name: rdepthp Table: Ex_an Description: Number of depth phases renamed by the analyst (see ddepthp for definition of

depth phase).Format: number(8) External: i8NA Value: –999 Range: rdepthp > 0

Name: reaptime Table: Dlfile Description: Time at which the contents of the disk loop file may be discarded and the file

re-used.Format: float(53) External: f17.5NA Value: 0.0 Range: any valid epoch time > 0.0

357b e r 2 0 0 2

358

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: reason Table: Discard Description: Reason an automated system event was discarded by an analyst.Format: varchar2(30) External: a30NA Value: NOT ALLOWEDRange: any string up to 30 characters

Name: rect Table: Apma, Arrival

Description: Signal rectilinearity defined as 1 – (l3 + l2)/2l1 where l1, l2, and l3 are the three eigenvalues from the decomposition of the covariance matrix. This column value is the maximum rectilinearity for all overlapping time windows.

Format: float(24) External: f7.3NA Value: –1.0 Range: 0.0 ≤ rect ≤ 1.0

Name: rectype Table: Complexity, Splp, Thirdmom, Timefreq

Description: Recipe type. This term identifies the algorithm used to calculate the parame-ter.

Format: varchar2(8) External: a8NA Value: - (hyphen)

NOT ALLOWED for timefreq, thirdmom

Range: any string up to eight characters

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: refaz Table: Ev_summary (Ex_summary, An_summary) Description: Azimuth to nearest reference point (reference locations are stored in the

Ref_loc table).Format: float(24) External: f7.2NA Value: –1.0 Units: degreesRange: 0.0 ≤ refaz < 360.0

Name: refdist Table: Ev_summary (Ex_summary, An_summary) Description: Distance to nearest reference point (reference locations are stored in the

Ref_loc table).Format: float(24) External: f8.3NA Value: –1.0 Units: kilometersRange: refdist ≥ 0.0

Name: refid Table: Ev_summary (Ex_summary, An_summary), Ref_loc

Description: Reference location identifier.Format: number(8) External: i8NA Value: –1 Range: refid > 0

359b e r 2 0 0 2

360

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: reflat Table: Mapdisc Description: Latitude reference; latitude of the center of the Map application’s projection

(used for azimuthal equidistant projections only).Format: float(24) External: f9.4NA Value: –999.0 Units: degreesRange: –90.0 ≤ reflat ≤ 90.0

Name: reflon Table: Mapdisc Description: Longitude reference. Longitude of the center of the Map application’s projec-

tion (used for azimuthal equidistant projections only).Format: float(24) External: f9.4NA Value: –999.0 Units: degreesRange: –180.0 ≤ reflon ≤ 180.0

Name: refname Table: Ref_loc Description: Reference location name.Format: varchar2(16) External: a16NA Value: NOT ALLOWEDRange: any upper case string up to 16 characters

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: refoffsetlat Table: Mapdisc Description: Latitude offset reference. This column value is the reference (in pixels) from

the lower left corner of the map to the center of the Map application’s projec-tion. In the case where the reference point is at the center of the map, the off-sets are equal to half the map width and height. For azimuthal equidistant projections only.

Format: float(24) External: f9.4NA Value: –1.0 Units: pixelsRange: refoffsetlat > 0

Name: refoffsetlon Table: Mapdisc Description: Longitude offset reference. This column value is the reference (in pixels) from

the lower left corner of the map to the center of the Map application’s projec-tion. For azimuthal equidistant projections only.

Format: float(24) External: f9.4NA Value: –1.0 Units: pixelsRange: refoffsetlon > 0

Name: refsta Table: Site Description: Reference station. This string specifies the reference station with respect to

which array members are located (see deast, dnorth).Format: varchar2(6) External: a6NA Value: - (hyphen)Range: any sta from tables

361b e r 2 0 0 2

362

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: reg_conf Table: Producttypeevsc Description: Confidence level of the regional seismic P/S screening criterion.Format: float(24) External: f7.2NA Value: –999.0 Range: 0.0 < reg_conf < 1.0

Name: regname Table: Producttypeevsc Description: Region name for subscriptions.Format: varchar2(24) External: a24NA Value: - (hyphen)Range: any valid string up to 24 characters

Name: rely Table: Siteaux Description: Station reliability. This column is an estimate of the percentage of time that

the station is up.Format: float(24) External: f5.2NA Value: –1.0 Range: 0.0 ≤ rely ≤ 1.0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: remark Table: Remark Description: Descriptive text. This single line of text is an arbitrary comment about a

record in the database. The comment is linked to its parent table only by for-ward reference from commid in the record of the table of interest (see commid, lineno).

Format: varchar2(80) External: a80NA Value: - (hyphen)Range: any string up to 80 characters

Name: reqid Table: Request Description: Request identifier. Unique key to allow tracking of requests by the Message

Subsystem.Format: number(8) External: i8NA Value: NOT ALLOWEDRange: reqid > 0

Name: requestor Table: Request Description: Original requestor of this data. The requestor is the person or program that

requests this waveform data.Format: varchar2(15) External: i15NA Value: - (hyphen)Range: any string up to 15 characters

363b e r 2 0 0 2

364

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: response Table: Fsrecipe Description: Flag specifying instrument response function.Format: varchar2(1) External: a1NA Value: NOT ALLOWEDRange: response ∈ {y, n}

Name: retime Table: Ex_an Description: Number of phases re-timed by an analyst.Format: number(8) External: i8NA Value: –1 Range: retime ≥ 0

Name: revfunction Table: Revaudit Description: Name of the revision function used.Format: varchar2(32) External: a32NA Value: NOT ALLOWED Range: any function name in rebrevise

Name: revid Table: Revaudit Description: Revision identifier.Format: number(8) External: i8NA Value: NOT ALLOWED Range: revid > 0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: revision Table: Fileproduct (Fs_stageproduct) Description: Revision number of a file product.Format: number(4) External: i4NA Value: –1 Range: revision > 0

Name: revstate Table: Revaudit Description: State of the revision.Format: varchar2(16) External: a16NA Value: NOT ALLOWEDRange: revstate ∈ {DONE|FAILED|ABORTED}

Name: revtagid1 Table: Revaudit Description: Value of the foreign key named in revtagname1.Format: number(8) External: i8NA Value: NOT ALLOWED Range: revtagid1 > 0

Name: revtagid2 Table: Revaudit Description: Value of the foreign key named in revtagname2.Format: number(8) External: i8NA Value: –1 Range: revtagid2 > 0

365b e r 2 0 0 2

366

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: revtagname1 Table: Revaudit Description: Name of the foreign key whose value is in revtagid1.Format: varchar2(8) External: a8NA Value: NOT ALLOWED Range: revtagname1 ∈ {valid identifier}

Name: revtagname2 Table: Revaudit Description: Name of the foreign key whose value is in revtagid2.Format: varchar2(8) External: a8NA Value: - (hyphen)Range: revtagname2 ∈ {valid identifier}

Name: rid Table: Amp3c Description: Recipe identifier.Format: varchar2(8) External: a8NA Value: - (hyphen)Range: any string up to eight characters long

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: rotation Table: Mapdisc Description: Map rotation. This is the rotation of the projection from 0°, or due north.

Rotation specifies the azimuth of the y-raster in degrees clockwise from north (for azimuthal equidistant projections only).

Format: float(24) External: f9.4NA Value: –1.0 Units: degreesRange: 0.0 ≤ rotation < 360.0

Name: rprimp Table: Ex_an Description: Number of primary phases renamed by the analyst (see dprimp for definition

of primary phase).Format: number(8) External: i8NA Value: –1 Range: rprimp ≥ 0

Name: rscore Table: Evsc_prod Description: Score for the regional seismic P/S event-screening criterion.Format: float(24) External: f7.2NA Value: –999.0 Range: rscore > –999.0

367b e r 2 0 0 2

368

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: rsecondp Table: Ex_an Description: Number of secondary phases renamed by the analyst (see dsecondp for defini-

tion of secondary phase).Format: number(8) External: i8NA Value: –1 Range: rsecondp ≥ 0

Name: rsptype Table: Instrument Description: Instrument response type. The column value denotes the style in which

detailed calibration data are stored. The neighboring column dfile tells where the calibration data are saved. Rsptype = paz indicates the data are the poles and zeroes of the Laplace transform. Rsptype = fap indicates the data are amplitude/phase values at a range of frequencies. Rsptype = fir indicates that the response type is a finite impulse response table. Rsptype = pazfir indi-cates a combination of poles, zeros, and finite impulse response. Other codes may be defined.

Format: varchar2(6) External: a6NA Value: NOT ALLOWEDRange: any lower-case string up to six characters

Name: rsta Table: Ev_summary (Ex_summary, An_summary) Description: Number of nonarray regional arrival times. “Regional” is defined as a station-

event distance not less than 250 km and up to 2000 km.Format: number(8) External: i8NA Value: –1 Range: rsta ≥ 0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: running Table: Dlman Description: Flag indicating whether or not DLMan is running.Format: varchar2(1) External: a1NA Value: - (hyphen)Range: running ∈ {y, n}

Name: samprate Table: Instrument, Wfdisc (Wfproto) Description: Sampling rate. This column is the sample rate in samples/second. In the

instrument table, the column value is specifically the nominal sample rate, not accounting for clock drift. In wfdisc, the value may vary slightly from the nominal to reflect clock drift.

Format: float(24) External: f11.7NA Value: NOT ALLOWEDUnits: 1/secondsRange: samprate > 0.0

Name: scale Table: Mapdisc Description: Map scale.Format: float(24) External: f9.4NA Value: –1.0 Units: radians per pixel for mercator projections; kilometers per pixel for azimuthal

equidistant projectionsRange: scale > 0

369b e r 2 0 0 2

370

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: scan Table: Scan_date Description: Status of analyst scanning for missed events.Format: varchar2(1) External: a1NA Value: NOT ALLOWEDRange: scan ∈ {y, n}

Name: score Table: Evsc_prod Description: Composite event-screening score. This score numerically indicates the degree

to which a particular event meets or does not meet the combined screening criteria.

Format: float(24) External: f7.2NA Value: –999.0 Range: score > –999.0

Name: sdepth Table: Origerr (Origerr_temp_ga) Description: Depth error. This is the maximum error of a depth estimate for a level of con-

fidence given by conf (see smajax, sminax, and sxx, syy, szz, stt, sxy, sxz, syz, stx, sty, stz).

Format: float(24) External: f9.4NA Value: –1.0 Units: kilometersRange: sdepth > 0.0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: sdobs Table: Origerr (Origerr_temp_ga) Description: Standard error of one observation. This column is derived from the discrepan-

cies in the arrival times of the phases used to locate an event. This column is defined as the square root of the sum of the squares of the time residuals divided by the number of degrees of freedom. The latter is the number of defining observations (ndef in Origin (Originref, Origin_temp_ga)) minus the dimension of the system solved (4 if depth is allowed to be a free variable, 3 if depth is constrained).

Format: float(24) External: f9.4NA Value: –1.0 Range: sdobs > 0.0

Name: seaz Table: Assoc (Assoc_temp_ga), Detection

Description: Station-to-event azimuth calculated from the station and event locations and measured clockwise from north.

Format: float(24) External: f7.2NA Value: –999.0 Units: degreesRange: 0.0 ≤ seaz ≤ 360.0

371b e r 2 0 0 2

372

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: seazlr Table: Apma Description: Azimuth of the eigenvector (e3) associated with the smallest eigenvalue (λ3).

This column is corrected by 180° to give an estimate of the station-to-event azimuth (with an 180° ambiguity). This column is an S-type column calcu-lated at the time of the maximum 3-component amplitude. The only difference between seazs and seazlr is in the definition of the overlapping time windows.

Format: float(24) External: f7.2NA Value: –999.0 Units: degreesRange: 0.0 ≤ seazlr ≤ 360.0

Name: seazp Table: Apma Description: Azimuth of the eigenvector (e1) associated with the largest eigenvalue (λ1).

The column value is corrected by 180° to give an estimate of the station-to-event azimuth. This P-type value is calculated at the time of maximum recti-linearity.

Format: float(24) External: f7.2NA Value: –999.0 Units: degreesRange: 0.0 ≤ seazp ≤ 360.0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: seazs Table: Apma Description: Azimuth of the eigenvector (e3) associated with the smallest eigenvalue (λ3).

This column is corrected by 180° to give an estimate of the station-to-event azimuth (with an 180° ambiguity). This column is an S-type column calcu-lated at the time of the maximum 3-component amplitude. The only difference between seazs and seazlr is in the definition of the overlapping time windows.

Format: float(24) External: f7.2NA Value: –999.0 Units: degreesRange: 0.0 ≤ seazs ≤ 360.0

Name: secondkey Table: Arch_data_type Description: Not used.Format: varchar2(24) External: a24NA Value: - (hyphen)Range: any string up to 24 characters

Name: secondp Table: Ev_summary (Ex_summary, An_summary) Description: Number of time-defining secondary phases. A secondary phase is any phase

not in the set (P, Pn, Ps, PkP, PKPdf).Format: number(8) External: i8NA Value: –1 Range: secondp ≥ 0

373b e r 2 0 0 2

374

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: segtype Table: Wfdisc (Wfproto) Description: Segment type. This column indicates if a waveform is o (original), v (virtual),

s (segmented), or d (duplicate).Format: varchar2(1) External: a1NA Value: - (hyphen)Range: segtype ∈ {o, v, s, d}

Name: seq_contents Table: Mig_rules Description: Contents of a query for data migration.Format: varchar2(200) External: a200NA Value: NOT ALLOWEDRange: any string up to 200 characters that is a valid SQL query

Name: seq_type Table: Mig_rules Description: Type of sequence to be added to the query.Format: varchar2(15) External: a15NA Value: NOT ALLOWEDRange: seq_type ∈ {END_LDDATE, START_LDDATE, TEXT}

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: servicetime Table: Datauser

Description: Last time a request from the user with the userid in the datauser table was ser-viced.

Format: float(53) External: f17.5NA Value: –999999999.999 Units: secondsRange: servicetime ≥ 0

Name: sigma_time Table: Hydro_features Description: Standard deviation of the probability weighted time.Format: float(53) External: f17.5NA Value: –999.0 Range: sigma_time ≥ 0

Name: sigtype Table: Msgdisc Description: Digital signature type.Format: varchar2(64) External: a64NA Value: - (hyphen)Range: ASCII character string

Name: skewness Table: Hydro_features Description: Skew of the estimated signal energy between onset_time and termination_time.Format: float(24) External: f9.4NA Value: –9999999999.999 Range: –10000000.0 < skewness < 10000000.0

375b e r 2 0 0 2

376

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: slodef Table: Assoc (Assoc_temp_ga) Description: Slowness defining code. This one-character flag indicates whether or not the

slowness of a phase was used to constrain the event location. This column is defining (slodef = d) or nondefining (slodef = n) for this arrival.

Format: varchar2(1) External: a1NA Value: - (hyphen)Range: slodef ∈ {d, n}

Name: slores Table: Allow_resid, Assoc (Assoc_temp_ga)

Description: Slowness residual. This column gives the difference between an observed slowness and a theoretical prediction. The prediction is calculated for the related phase and event origin described in the record.

Format: float(24) External: f7.2NA Value: –999.0 Units: seconds/degreeRange: slores > –999.0

Name: slow Table: Arrival, Detection, Hydro_arr_group, Parrival

Description: Observed slowness of a detected arrival. Units are seconds/kilometer in detec-tion, seconds/degree in arrival and parrival.

Format: float(24) External: f7.2NA Value: –1.0 Range: slow ≥ 0.0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: smaj_sc Table: Evsc_prod Description: Semi-major axis of error ellipse, used for onshore/offshore determination, for

a confidence level given by loc_conf of table Producttypeevsc.Format: float(24) External: f7.2NA Value: –999.0 Units: kilometersRange: smaj_sc > 0.0

Name: smajax Table: Origerr (Origerr_temp_ga) Description: Semi-major axis of error ellipse for a given confidence. The column value is

the length of the semi-major axis of the location error ellipse. The value is found by projecting the covariance matrix onto the horizontal plane. The level of confidence is specified by conf (see sdepth, sminax, and sxx, syy, szz, stt, sxy, sxz, syz, stx, sty, stz).

Format: float(24) External: f9.4NA Value: –1.0 Units: kilometersRange: smajax > 0.0

Name: smin_sc Table: Evsc_prod Description: Semi-minor axis of error ellipse, used for onshore/offshore determination, for

a confidence level given by loc_conf of table Producttypeevsc.Format: float(24) External: f7.2NA Value: –999.0 Units: kilometersRange: smin_sc > 0.0

377b e r 2 0 0 2

378

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: sminax Table: Origerr (Origerr_temp_ga) Description: Semi-minor axis of error ellipse. The column value is the length of the semi-

minor axis of the location error ellipse. The value is found by projecting the covariance matrix onto the horizontal plane. The level of confidence is speci-fied by conf (see sdepth, smajax, and sxx, syy, szz, stt, sxy, sxz, syz, stx, sty, stz).

Format: float(24) External: f9.4NA Value: –1.0 Units: kilometersRange: sminax > 0.0

Name: smoothvalue Table: Fsrecipe Description: Amount of spectral smoothing.Format: float(24) External: f5.2NA Value: –1.0 Units: HertzRange: smoothvalue > 0.0

Name: sn_snr Table: Evsc_regional Description: Signal-to-noise ratio of the Sn measurement.Format: float(24) External: f7.2NA Value: –999.0 Range: sn_snr > 0.0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: snr Table: Amplitude, Apma, Arrival, Complexity, Detection

Description: Signal-to-noise ratio. This is an estimate of the ratio of the amplitude of the signal to amplitude of the noise immediately preceding it. For apma, this value is based on the maximum 3-component amplitudes (see amps). This col-umn is the average signal-to-noise ratio for the frequency bands that contrib-uted to the final polarization estimates.

Format: float(24) External: f10.2NA Value: –1.0 Range: snr > 0.0

Name: snr_high_band Table: Evsc_hydro Description: Hydroacoustic signal-to-noise ratio in the high-frequency band (32–64 Hz)

from table Amplitude for a given orid/sta pair.Format: float(24) External: f7.2NA Value: –1.0 Range: snr_high_band > 0.0

Name: snthrsh Table: Siteaux Description: Nominal signal-to-noise ratio.Format: float(24) External: f5.2NA Value: –1.0 Range: snthrsh > 1.0

379b e r 2 0 0 2

380

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: spike Table: Qcstats Description: Amount of data in the detection processing interval masked due to spikes.Format: float(53) External: f17.5NA Value: –999.0 Units: secondsRange: spike ≥ 0.0

Name: splitev Table: Ex_an Description: Indicates whether or not the analyst event solution contains arrivals that were

previously associated with two or more expert system events.Format: varchar2(4) External: a4NA Value: - (hyphen)Range: splitev ∈ {y, n}

Name: sproid Table: Detection Description: Uniquely identifies a set of parameters used in the signal processing.Format: number(8) External: i8NA Value: –1 Range: sproid > 0

Name: src Table: Mig_rules Description: Source database for migration.Format: varchar2(10) External: a10NA Value: NOT ALLOWEDRange: any string up to 10 characters that is a valid name of a database server

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: src_dpnt_corr Table: Event_control (In_event_control) Description: Identification of whether or not, and what type of, source-dependent correc-

tions were applied to the location. 0 = No source-dependent corrections applied to the event location. 1 = Test-site travel-time corrections applied to the event location. 2 = Source-Region Station-Timing (SRST) corrections applied to the event location. 3 = Regional level source-specific station corrections (SSSC) applied to the event location. SRST correction is not applied, even if it exists. 4 = Local level SSSCs applied to the location. SRST correction is not applied, even if it exists.

Format: number(2) External: i2NA Value: 0 Range: src_dpnt_corr ∈ {0, 1, 2, 3, 4}

Name: src_tbl Table: Mig_rules Description: Source table for database migration.Format: varchar2(30) External: a30NA Value: NOT ALLOWEDRange: any string up to 30 characters that is a valid table name

Name: srn Table: Origin (Originref, Origin_temp_ga), Sregion

Description: Seismic region number, as given in [Fli74] (see grn, grname, and srname).Format: number(8) External: i8NA Value: –1

NOT ALLOWED for sregion

Range: srn > 0

381b e r 2 0 0 2

382

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: srname Table: Sregion Description: Seismic region name. This column is the common name of a seismic region,

as given in [Fli74]. Names may have changed due to changing political cir-cumstances (see srn and grname).

Format: varchar2(40) External: a40NA Value: NOT ALLOWEDRange: any upper-case string up to 40 characters

Name: sta Table: Affiliation (Stanet), Alphasite, Arrival, Assoc (Assoc_temp_ga), Attencoef,

Beamaux, Ceppks, Chan_groups, Complexity, Detection, Dlfile, Evsc_hydro, Evsc_regional, Exception_chanmap, Fileproduct (Fs_stageproduct), Fkdisc, Forbeamaux, Fsave, Fsdisc, Fwfile, Fwgap, Outage, Parrival, Participation, Producttypesta, Qcstats, Request, Sensor, Site, Site_address, Siteaux, Sitechan, Sitepoll, Splp, Stamag, Stassoc, Thirdmom, Timefreq, Wfconv, Wfdisc (Wfproto)

Description: Station code. This column value is the code name of a seismic, hydroacoustic, or infrasonic observatory and identifies a geographic location recorded in the site table. Generally only three to five characters are used.

Format: varchar2(6) External: a6NA Value: NOT ALLOWED

- (hyphen) for assoc, chan_groups, dlfile, fileproduct, fkdisc, fsdisc, qcstats, stassoc, thirdmom

Range: any upper-case string up to six characters

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: staname Table: Site Description: Station name/description. This column value is the full name of the station

whose codename is in sta. As an example, one record in the site table connects sta = ANMO to staname = ALBUQUERQUE, NEW MEXICO (SRO).

Format: varchar2(50) External: a50NA Value: - (hyphen)Range: any upper-case string up to 50 characters

Name: staper Table: Siteaux Description: Standard period at which noise estimates are made.Format: float(24) External: f5.2NA Value: –1.0 Units: secondsRange: staper > 0.0

Name: start_time Table: Amplitude, Request Description: Epoch start time of the data interval. Epochal time is given as seconds since

hour 0 January 1, 1970.Format: float(53) External: f17.5NA Value: NOT ALLOWEDUnits: secondsRange: any valid epoch time

383b e r 2 0 0 2

384

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: stassid Table: Arrival, Stassoc Description: Station association identification. The wavetrain from a single event may be

made up of a number of arrivals. A unique stassid joins those arrivals believed to have come from a common event as measured at a single station. Stassid is also the key to the stassoc table, which contains additional signal measure-ments not contained within the arrival table, such as station magnitude esti-mates and computed signal characteristics.

Format: number(8) External: i8NA Value: –1

NOT ALLOWED for stassoc

Range: stassid > 0

Name: stat_prov Table: Site_address Description: State or province of a country.Format: varchar2(40) External: a40NA Value: - (hyphen)Range: any string up to 40 characters

Name: state Table: Ga_tag, Interval, Rebdone_dataday_flag, Request

Description: Processing state. The processing state of the interval within the automated processing system.

Format: varchar2(16) External: a16 varchar2(12) for rebdone_dataday_flag varchar2(20) for ga_tag

NA Value: - (hyphen) NOT ALLOWED for ga_tag

Range: a set of strings defined at each installation for each automated processing sys-tem,

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

ga_tag ∈ {aa_processed, analyst_reviewed, assoc_first, driver_restricted, locked_association, probdet_restricted, requested, wc_restricted}

Name: state_count Table: Msgaux Description: Number of failures of the message system to process a request.Format: number(4) External: i4NA Value: NOT ALLOWEDRange: state_count ≥ 0

Name: statecount Table: Request Description: Count of failures. When state = failed, the statecount column records the

number of failures to acquire this data.Format: number(8) External: i8NA Value: NOT ALLOWEDRange: statecount ≥ 0

Name: status Table: Dataready, Datauser, Ftpfailed, Msgdatatype, Msgdest, Msgdisc, Outage,

Problem, Prodtrack, Subs, Subsuser

Description: Status of message (msgdisc), response message (msgdest), or problem (prob-lem).

Format: varchar2(32) External: a6 varchar2(8) for dataready, ftpfailed varchar2(6) for subs

385b e r 2 0 0 2

386

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

varchar2(24) for datauser, subsuser varchar2(12) for prodtrack varchar2(33) for problem

NA Value: - (hyphen) NOT ALLOWED for datauser

Range: any string up to the character limit status ∈ {DONE, FAILED} for msgdatatype status ∈ {ACTIVE, INACTIVE} for datauser

Name: statype Table: Allow_resid, Site, Weights

Description: Station type. This character string specifies the station type. Recommended entries are ss (single station) or ar (array).

Format: varchar2(4) External: a4NA Value: - (hyphen)Range: statype ∈ {ss, ar}

Name: stav Table: Detection Description: Short-term average used to describe the amplitude of a signal. The amplitude

is averaged over a small time interval, typically 1–2 seconds. This time win-dow is defined in Sigpro processing.

Format: float(24) External: f11.5NA Value: –1.0 Units: nanometersRange: stav > 0.0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: stdconstval Table: Qcstats Description: Standard deviation of data in masked constant segments.Format: float(53) External: f17.5NA Value: –999.0 Units: same as waveform dataRange: stdconstval ≥ 0.0

Name: stime Table: Origerr (Origerr_temp_ga) Description: Origin time error.Format: float(24) external: f8.2NA Value: –1.0 Units: seconds Range: stime ≥ 0.0

Name: stime Table: Apma, Msgdest

Description: In apma, this column is the epoch time at which S-type polarization columns are estimated. The value is the center of the time window with the maximum 3-component amplitude. In msgdest, this column is the time at which the cor-responding message was sent.

Format: float(53) External: f17.5NA Value: 9999999999.999 Units: seconds Range: any valid epoch time

387b e r 2 0 0 2

388

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: stmcor Table: Siteaux Description: S-wave arrival time correction.Format: float(24) External: f6.3NA Value: –999.0 Units: secondsRange: stmcor > –999.0

Name: strike Table: Evsc_prod, Origerr (Origerr_temp_ga) Description: Strike of major axis of error ellipse. This column is the strike of the semi-

major axis of the location error ellipse, measured in degrees clockwise from the North (see smajax).

Format: float(24) External: f6.2NA Value: –1.0 Units: degreesRange: 0.0 ≤ strike ≤ 360.0

Name: strip Table: Wfconv Description: Flag showing whether or not the data are stripped of headers (y/n).Format: varchar2(1) External: a1NA Value: - (hyphen)Range: strip ∈ {n, y}

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: stype Table: Arrival Description: Signal type. This single-character flag indicates the event or signal type. The

following definitions hold: l = local event r = regional event t = teleseismic event m = mixed or multiple event g = glitch (for example, non-seismic detection) e = calibration activity obfuscated the data l, r, and t are supplied by the reporting station or as an output of post-detec-tion processing. g and c come from analyst comment or from status bits from GDSN and RSTN data.

Format: varchar2(1) External: a1NA Value: - (hyphen)Range: stype ∈ {l, r, t, m, g, c}

Name: sub_status Table: Msgaux Description: Cause of failure.Format: varchar2(24) External: a24NA Value: NOT ALLOWEDRange: any string up to 24 characters

Name: subject Table: Msgdisc Description: Subject header from an email message.Format: varchar2(64) External: a64NA Value: - (hyphen)Range: any string up to 64 characters

389b e r 2 0 0 2

390

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: sublocname Table: Location Description: Sub-location name.Format: varchar2(25) External: a25NA Value: - (hyphen)Range: any valid string up to 25 characters

Name: subsid Table: Subs Description: Subscription identifier.Format: number(8) External: i8NA Value: –1 Range: subsid > 0

Name: subsname Table: Subs Description: Subscription name, which is defined by subscriber.Format: varchar2(24) External: a24NA Value: - (hyphen)Range: any string up to 24 characters

Name: subtype Table: Msgdisc Description: Specification of whether or not the request includes waveforms. In the future,

this column may contain indications of other message subtypes.Format: varchar2(2) External: a2NA Value: - (hyphen)Range: subtype ∈ {V, R, L}

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: supressempty Table: Productcriteria Description: Flag (if no) indicating that empty AutoDRM subscription messages should be

sent when no data are available.Format: char(2) External: a2NA Value: - (hyphen)Range: supressempty ∈ {yes, no}

Name: svar Table: Spvar Description: Variance of the detrended log spectrum between fmin and fmax. The spectrum

is measured in nm-sec.Format: float(24) External: f12.6NA Value: NOT ALLOWEDRange: any floating point value

Name: sweight Table: Weights Description: Slowness weight.Format: float(24) External: f5.2NA Value: 0.0 Range: sweight ≥ 0.0

391b e r 2 0 0 2

392

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: sxx, syy, szz, stt, sxy, sxz, syz, stx, sty, stz Table: Origerr (Origerr_temp_ga) Description: Elements of the covariance matrix for the location identified by orid. The

covariance matrix is symmetric (and positive definite) so that sxy = syx, and so on, (x, y, z, t) refer to latitude, longitude, depth, and origin time, respectively. These columns (together with sdobs, ndef, and dtype) provide the information necessary to construct the K-dimensional (K = 2, 3, 4) confidence ellipse or ellipsoids at any confidence limit desired.

Format: float(24) External: f15.4NA Value: –1.0 Units: sxx, syy, szz, sxy, szx, syz - kilometers squared (km2)

stt - seconds squared (sec2) stx, sty, stz - kilometers per second (km/sec)

Range: sxx, syy, szz, stt > 0.0

Name: table_name Table: Arch_data_type Description: Name of table encapsulating the data type.Format: varchar2(32) External: a32NA Value: - (hyphen)Range: any IDC database table name up to 32 characters

Name: tablename Table: Dataready Description: Database table name containing data ready to be distributed by the Subscrip-

tion Subsystem.Format: varchar2(24) External: a24NA Value: NOT ALLOWEDRange: any string up to 24 characters that is a valid table name

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: tagid Table: Dataready, Wftag

Description: Tagname value. This column contains the value of a foreign key identified in tagname. For example, if tagname is arid, then wftag may be joined to Arrival where arrival.arid = wftag.tagid. If tagname is orid, then wftag and Origin (Originref, Origin_temp_ga) may be joined where origin.orid = wftag.tagid.

Format: number(8) External: i10 number(10) for dataready

NA Value: NOT ALLOWEDRange: tagid > 0

Name: tagid2 Table: Dataready Description: Secondary tag value used by the Subscription Subsystem for data types that

require more than one identifier (for example, time range for origin).Format: number(10) External: i10NA Value: –1 Range: tagid2 > 0

Name: tagname Table: Dataready, Wftag

Description: Tagname type. This column value is the name of the foreign key whose value is in tagid.

Format: varchar2(8) External: a12 varchar2(12) for dataready

NA Value: NOT ALLOWEDRange: tagname ∈ {arid, evid, orid, stassid, msgid} for wftag;

any for dataready

393b e r 2 0 0 2

394

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: taper Table: Fsrecipe Description: Type of taper used to smooth input data to Fourier spectrum. If cosine is

specified, the taperstart and taperend values are used to determine the length of the taper.

Format: varchar2(8) External: a8NA Value: - (hyphen)Range: taper ∈ {hanning, hamming, cosine, bartlet, blackman}

Name: taperend Table: Fsrecipe Description: Length of the ending cosine taper used in smoothing data for Fourier spectra.

The value is in percentage of the data window.Format: number(8) External: i3NA Value: 0 Range: 1 < taperend < 50

Name: taperstart Table: Fsrecipe Description: Length of the starting cosine taper used in smoothing data for Fourier spectra.

The value is in percentage of the data window.Format: number(8) External: i3NA Value: 0 Range: 1 < taperstart < 50

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: task_num Table: Mig_rules Description: Order of this migration task.Format: number External: i4NA Value: NOT ALLOWEDRange: task_num ≥ 1

Name: tdepth Table: Location Description: Tunnel depth. This column gives the depth (positive down) of tunnels or other

subsites in the location table relative to the value of elev.Format: float(24) External: f9.4NA Value: –999.0 Units: kilometers Range: tdepth Š 0.0

Name: termination_time Table: Hydro_features Description: Estimated termination time of signal.Format: float(53) External: f17.5NA Value: –9999999999.999 Units: secondsRange: any valid epoch time

395b e r 2 0 0 2

396

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: testsite Table: Explo Description: Test site region.Format: varchar2(15) External: a15NA Value: - (hyphen)Range: any string up to 15 characters

Name: thatdb Table: Xtag Description: Database account for the records specified by thatname and thatid.Format: varchar2(32) External: a32NA Value: - (hyphen)Range: any character string up to 32 characters that is a valid account name

Name: thatid Table: Xtag Description: Identifier for thatname.Format: number(8) External: i8NA Value: NOT ALLOWEDRange: thatid > 0

Name: thatname Table: Xtag Description: Key for thatid.Format: varchar2(8) External: a8NA Value: NOT ALLOWEDRange: thatname ∈ {arid, orid, wfid …}

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: thisdb Table: Xtag Description: Database account for the records specified by thisname and thisid.Format: varchar2(32) External: a32NA Value: - (hyphen)Range: any character string up to 32 characters that is a valid account name

Name: thisid Table: Xtag Description: Identifier for thisname.Format: number(8) External: i8NA Value: NOT ALLOWEDRange: thisid > 0

Name: thisname Table: Xtag Description: Key for thisid.Format: varchar2(8) External: a8NA Value: NOT ALLOWEDRange: thisname ∈ {arid, orid, wfid …}

397b e r 2 0 0 2

398

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: time Table: Alphasite, Arrival, Beamaux, Datadays, Detection, Dlfile, Fileproduct

(Fs_stageproduct), Fkdisc, Fsdisc, Fwgap, Interval, Origin (Originref, Origin_temp_ga), Outage, Parrival, Problem, Problemlog, Qcstats, Sensor, Siteaux, Stassoc, Timestamp, Wfdisc (Wfproto)

Description: Epoch time, given as seconds since midnight, January 1, 1970, and stored in a double-precision floating number. time refers to the table in which it is found; for example, in arrival it is the arrival time, in origin it is the origin time, in wfdisc it is the start time of data, and in siteaux it is the start time for which measurements are valid. Where the date of historical events is known, time is set to the start time of that date. Where the date of contemporary arrival mea-surements is known but no time is given, then time is set to the NA Value. The double-precision floating point number allows 15 decimal digits. At one milli-second accuracy, this is a range of 3 *104 years. Where the date is unknown, or prior to February 10, 1653, time is set to the NA Value.

Format: float(53) External: f17.5 number (17, 5) for problem, problemlog

NA Value: –9999999999.999 Units: secondsRange: any valid epoch time

Name: time_spread Table: Hydro_features Description: Root-mean-square time spread of the estimated signal energy between

onset_time and termination_time.Format: float(24) External: f9.4NA Value: –1.0 Units: secondsRange: timespread > 0.0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: timedef Table: Assoc (Assoc_temp_ga) Description: Time-defining code. This one-character flag indicates whether or not the time

of a phase was used to constrain the event location. This column is defining (timedef = d) or nondefining (timedef = n).

Format: varchar2(1) External: a1NA Value: - (hyphen)Range: timedef ∈ {n, d}

Name: timelastsend Table: Productcriteria Description: Last epoch time that the product was delivered.Format: float(54) External: f17.5NA Value: –9999999999.999 Units: secondsRange: any valid epoch time

Name: timenextsend Table: Productcriteria Description: Next epoch time that product will be delivered.Format: float(54) External: f17.5NA Value: –9999999999.999 Units: secondsRange: any valid epoch time

399b e r 2 0 0 2

400

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: timeres Table: Allow_resid, Assoc (Assoc_temp_ga)

Description: Time residual. This column is a travel-time residual measured in seconds. The residual is found by taking the observed arrival time (saved in the Arrivaltable) of a seismic phase and subtracting the expected arrival time. The expected arrival time is calculated by a formula based on an earth velocity model (column vmodel), an event location and origin time (saved in table Ori-gin (Originref, Origin_temp_ga)), the distance to the station (column dist in table assoc), and the particular seismic phase (column phase in table assoc).

Format: float(24) External: f8.3NA Value: –999.0 Units: secondsRange: timeres > –999.0

Name: tlen Table: Ampdescript, Dlfile, Fkdisc, Fsdisc

Description: Time window length. Tlen should be NA in ampdescript if a velocity window is used.

Format: float(24) External: f10.3NA Value: –1.0 Units: secondsRange: tlen > 0.0

Name: tmf Table: Thirdmom Description: Third moment of frequency.Format: float(24) External: f7.2NA Value: NOT ALLOWEDRange: tmf ≥ 0.0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: tmfpct Table: Thirdmom Description: Percentage of signal spectrum amplitudes greater than their corresponding

noise spectrum amplitudes in the frequency range [tmf–fmin, tmf–fmax]. tmf–fmin and tmf–fmax are par-file parameters.

Format: float(24) External: f7.2NA Value: NOT ALLOWEDRange: 0 ≤ tmfpct ≤ 100

Name: toff Table: Ampdescript Description: Offset from theoretical or observed arrival time. This column is used to define

the start time of the amplitude measurement window and may be used in con-junction with either tlen to define a static window or with gvlo to define a dynamic window. If toff is set to –999, then gvhi must be used to define the start time of the window.

Format: float(24) External: f6.2NA Value: –999.0 Units: secondsRange: toff ≥ 0.0

Name: total_energy Table: Hydro_features, Infra_features

Description: Total energy in the signal between onset_time and termination_time for hydro_features and between eng_time and eng_dur for infra_features.

Format: float(24) External: f9.4NA Value: –1.0 Units: dB re µPa

(microbars)2 for infra_features

Range: total_energy > 0.0

401b e r 2 0 0 2

402

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: total_time Table: Hydro_features Description: Total time that the estimated signal pressure squared exceeds

noise_onset_thresh between onset_time and termination_time.Format: float(53) External: f17.5NA Value: –1.0 Units: seconds Range: total_time > 0.0

Name: transmeth Table: Msgdest

Description: Method by which the response is to be delivered to the requestor.Format: varchar2(16) External: a16NA Value: - (hyphen)Range: any string up to 16 characters

Name: tshift Table: Sensor Description: Correction for clock errors. This column is designed to accommodate discrep-

ancies between actual time and the numerical time written by data recording systems. Actual time is the sum of the reported time plus tshift.

Format: float(24) External: f6.2NA Value: NOT ALLOWEDUnits: secondsRange: any valid real number

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: tsta Table: Ev_summary (Ex_summary, An_summary) Description: Number of teleseismic observations for an event. A teleseismic observation is

currently defined as having a station-event distance ≥ 2000 km.Format: number(8) External: i8NA Value: –1 Range: tsta ≥ 0

Name: tweight Table: Weights Description: Time weight.Format: float(24) External: f5.2NA Value: 0.0 Range: tweight ≥ 0.0

Name: typeid Table: Fileproduct (Fs_stageproduct), Fpdescription Description: Identifier for the product type description.Format: number(8) External: i8NA Value: NOT ALLOWEDRange: typeid > 0

Name: uncertainty Table: Netmag, Stamag

Description: Magnitude uncertainty. This column value is the standard deviation of the accompanying magnitude measurement.

Format: float(24) External: f7.2NA Value: –1.0 Range: uncertainty > 0.0

403b e r 2 0 0 2

404

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: units Table: Amplitude Description: Units of amplitude measure. Format: varchar2(15) External: a15NA Value: - (hyphen)Range: units ∈ {nm}

Name: userid Table: Datauser, Msgdisc, Subs, Subsuser

Description: User identifier for Subscription and Message Subsystems.Format: number(8) External: i8NA Value: –1

NOT ALLOWED for datauser

Range: userid > 0

Name: username Table: Datauser, Ftplogin, Subsuser

Description: User name for FTP access or for Subscription Subsystem.Format: varchar2(16) External: a24

varchar2(24) for datauser, subuser

NA Value: - (hyphen) NOT ALLOWED for datauser

Range: any string up to (16, 24) characters that is a valid user name

Name: vamp Table: Amp3c Description: Vertical amplitude.Format: float(24) External: f11.2NA Value: –999.0 Range: vamp ≥ 0.0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: vang Table: Sitechan Description: Vertical orientation of seismometer. This column measures the angle between

the sensitive axis of a seismometer and the outward-pointing vertical direc-tion. For a vertically oriented seismometer, vang = 0. For a horizontally ori-ented seismometer, vang = 90 (see hang).

Format: float(24) External: f6.1NA Value: NOT ALLOWEDUnits: degreesRange: 0.0 ≤ vang ≤ 90.0

Name: verifstatus Table: Msgdisc Description: Status of verification.Format: varchar2(4) External: a4NA Value: - (hyphen)Range: ASCII character string

Name: version Table: Fileproduct (Fs_stageproduct) Description: Version of the software that generated the file product.Format: float(53) External: f6.2NA Value: –1 Range: version > 0.0

405b e r 2 0 0 2

406

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: vmodel Table: Assoc (Assoc_temp_ga), Parrival

Description: Velocity model. This character string identifies the velocity model of the earth used to compute the travel times of seismic phases. A velocity model is required for event location (if phase is defining) or for computing travel-time residuals.

Format: varchar2(15) External: a15NA Value: - (hyphen)Range: any string up to 15 characters

Name: vsnr Table: Amp3c Description: Vertical signal-to-noise ratio. Ratio of vamp to root-mean-square amplitude of

a vertically-oriented component filtered in a frequency band centered at cfreqHz.

Format: float(24) External: f10.2NA Value: –999.0 Range: vsnr ≥ 0.0

Name: waterdepth Table: Explo Description: Depth of static water table level. Depth from surface zero to the piezometric

surface in pre-Tertiary rocks, or to the composite piezometric surface.Format: float(24) External: f7.4NA Value: –1 Units: kilometersRange: watdep Š 0.0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: wfid Table: Fsdisc, Wfaux, Wfdisc (Wfproto), Wftag

Description: Unique waveform identifier for a wfdisc record.

Format: number(8) External: i8NA Value: –1 Range: wfid > 0

Name: wgt Table: Assoc (Assoc_temp_ga) Description: Location weight. This column gives the final weight assigned to the allied

arrival by the location program. This column is used primarily for location programs that adaptively weight data by their residuals.

Format: float(24) External: f6.3NA Value: –1.0 Range: 0.0 ≤ wgt < 1.0

Name: winlen Table: Fsrecipe Description: Number of points per window.Format: number(8) External: i8NA Value: NOT ALLOWEDRange: winlen > 0

Name: xavpct Table: Timefreq Description: Average ratio of bad points to total of the cross-correlation trace.Format: float(24) External: f7.2NA Value: NOT ALLOWEDRange: 0 ≤ xavpct ≤ 1

407b e r 2 0 0 2

408

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: xcoef Table: Attencoef Description: Constant coefficient in the distance correction formula.Format: float(24) External: f7.2NA Value: –999.0 Range: any valid floating point value

Name: xcor Table: Timefreq Description: For timefreq, xcor is the zero lag cross-correlation between the three pairs of

time-frequency matrices.Format: float(24) External: f9.4NA Value: NOT ALLOWEDRange: 0 ≤ xcor ≤ 1

Name: ycoef Table: Attencoef Description: Geometrical spreading coefficient in the distance correction formula.Format: float(24) External: f7.2NA Value: –999.0 Range: any valid floating point value

Name: yield Table: Explo Description: Explosion yield.Format: float(24) External: f9.3NA Value: –1 Units: kTRange: yield > 0.0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: yldmax Table: Explo Description: Estimated upper limit of explosion yield.Format: float(24) External: f9.3NA Value: –1 Units: kTRange: yldmax > 0.0

Name: zavcep Table: Timefreq Description: Average maximum value in the two-dimensional cepstrum of the vertical

component traces.Format: float(24) External: f7.2NA Value: NOT ALLOWEDRange: zavcep ≥ 0

Name: zavcor Table: Timefreq Description: Average autocorrelation along the time axis across all frequencies excluding

randomized points of the vertical component traces.Format: float(24) External: f7.2NA Value: NOT ALLOWEDRange: zavcor ≥ 0

409b e r 2 0 0 2

410

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: zavpct Table: Timefreq Description: Average ratio of bad points to total of the vertical component traces.Format: float(24) External: f7.2NA Value: NOT ALLOWEDRange: 0 ≤ zavpct ≤ 1

Name: zcoef Table: Attencoef Description: Attenuation coefficient in the distance correction formula.Format: float(24) External: f7.2NA Value: –999.0 Range: any valid floating point value

Name: zrcr_delfreq Table: Infra_features Description: The estimated standard deviation in zrcr_freq.Format: float(24) External: f7.2NA Value: –1.0 Units: HertzRange: zcr_delfreq > 0.0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 3 :

S /H/ I C o l um n Desc r ip t ions

Name: zrcr_freq Table: Infra_features Description: Frequency of the arrival as estimated from the zero-crossing rate of the tradi-

tional beam-formed waveform data in the time interval defined by coinc_timeand coinc_dur.

Format: float(24) External: f7.2NA Value: –1.0 Units: HertzRange: zcr_freq > 0.0

411b e r 2 0 0 2

412

Chap te r 3 :

S /H/ I Co lum n De sc r ip t io ns

U s e r G u i d e sI D C D O C U M E N T A T I O N

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Chapter 4: R a d i o n u c l i d e D a t a b a s e O v e r v i e w

This chapter describes the organization of the radionuclide database schema. The fol-lowing topics are covered:

■ Two-tier Database Schema

■ Database Organization

■ Radionuclide Object Descriptions

b e r 2 0 0 2 413

U s e r G u i d e sI D C D O C U M E N T A T I O N

414

Chapter 4: R a d i o n u c l i d e D a t a b a s e O v e r v i e w

TW O - T I E R D A T A B A S E S C H E M A

A two-tiered database is set up for analysis of IMS radionuclide data. One database is used for automatic analysis of sample data as they arrive. This database is owned by the user RMSAUTO. The second database is used for interactive analysis by the IDC radio-nuclide analysts. This database is owned by the user RMSMAN. A two-tiered database schema is used to preserve both the automatic analysis results and the interactive analy-sis results without one overwriting the other. All of the operations that the automatic pipeline performs effect changes in the RMSAUTO database. All operations that an ana-lyst performs effect changes in the RMSMAN database.

D A T A B A S E O R G A N I Z A T I O N

The radionuclide database tables are conceptually organized into four groups. These groups are described in this section.

R a w D a t a Ta b l e s ( r a w )

Raw data tables are tables that hold the original data received from the reporting stations. The RMSAUTO user owns these tables, but the RMSMAN user has permission to read the tables. RMSMAN creates synonyms for each table to facilitate queries.

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 4 :

R a d ion uc l id e D a t ab as e O verv iew

S t a t i c D a t a Ta b l e s ( s t a t i c )

The static tables hold data about detectors, stations, and tables used as the default pro-cessing parameters for sample data analysis. The RMSMAN user owns these tables, but the RMSAUTO user has permission to read the tables. RMSAUTO creates synonyms for each table to facilitate queries.

A n a l y s i s D a t a Ta b l e s ( a n a l y s i s )

Analysis tables hold the results of the analysis processing. Both the RMSAUTO and RMSMAN users own versions of these tables. The RMSMAN user is not permitted to make a change to the RMSAUTO analysis data tables, but the RMSAUTO user is per-mitted to make a change to the RMSMAN analysis data tables. Analysis data are com-piled first in RMSAUTO and are moved to RMSMAN by triggers. There are three triggers for each analysis data table; one each for insert, update, and delete. These trig-gers keep the RMSAUTO analysis data tables in sync during automatic analysis. After a record is inserted, updated, or deleted in the RMSAUTO version of these tables, a data-base trigger copies the change to the RMSMAN version of the tables.

I n d e p e n d e n t D a t a Ta b l e s ( i n d y )

Both the RMSAUTO and RMSMAN users own versions of these tables. Unlike the analysis tables, there are no triggers between the two versions of independent tables. These tables are owned by the two users and are unrelated to each other. Independent tables are used to hold the results of tests and analysis performed within the current user’s objects.

Table 123 provides a complete listing of the Release 3 database tables and the group to which each table belongs. The third column indicates whether changes were made since the last release of the software (Release 2.1).

415b e r 2 0 0 2

416

Chap te r 4 :

R a d ion uc l id e D a t ab as e Overv iew

U s e r G u i d e sI D C D O C U M E N T A T I O N

TABLE 123: DATABASE TABLE GROUPS

Table Name Table Group Changes

debug indy unchanged

gards_alerts raw unchanged

gards_aux_lib static unchanged

gards_aux_lines_lib static unchanged

gards_b_energy_pairs analysis unchanged

gards_b_energy_pairs_orig analysis unchanged

gards_b_resolution_pairs analysis unchanged

gards_b_resolution_pairs_orig analysis unchanged

gards_bg_efficiency_pairs analysis unchanged

gards_bg_energy_cal analysis new

gards_cat_template analysis new

gards_codes static unchanged

gards_comments analysis modified

gards_comments_defs static modified

gards_data_log raw modified

gards_dbrole_owner static new

gards_detectors static unchanged

gards_dist_sample_queue static unchanged

gards_efficiency_cal analysis unchanged

gards_efficiency_pairs analysis unchanged

gards_energy_cal analysis unchanged

gards_energy_cal_orig analysis unchanged

gards_energy_pairs analysis unchanged

gards_energy_pairs_orig analysis unchanged

gards_environment raw unchanged

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 4 :

R a d ion uc l id e D a t ab as e O verv iew

gards_flags indy unchanged

gards_fpe indy unchanged

gards_histogram raw unchanged

gards_interval raw unchanged

gards_mdas2report static unchanged

gards_met_data raw unchanged

gards_notify static unchanged

gards_nucl_ided analysis unchanged

gards_nucl_ided_orig analysis unchanged

gards_nucl_lib static unchanged

gards_nucl_lines_ided analysis unchanged

gards_nucl_lines_ided_orig analysis unchanged

gards_nucl_lines_lib static unchanged

gards_nucl2quantify static unchanged

gards_peaks analysis unchanged

gards_peaks_orig analysis unchanged

gards_permissions static modified

gards_poc static unchanged

gards_proc_params_template static unchanged

gards_qchistory analysis unchanged

gards_qcparams static unchanged

gards_qctargets static unchanged

gards_query_results indy unchanged

gards_receipt_log raw unchanged

gards_refline_master static unchanged

TABLE 123: DATABASE TABLE GROUPS (CONTINUED)

Table Name Table Group Changes

417b e r 2 0 0 2

418

Chap te r 4 :

R a d ion uc l id e D a t ab as e Overv iew

U s e r G u i d e sI D C D O C U M E N T A T I O N

gards_relevant_nuclides static unchanged

gards_resolution_cal analysis unchanged

gards_resolution_cal_orig analysis unchanged

gards_resolution_pairs analysis unchanged

gards_resolution_pairs_orig analysis unchanged

gards_rlr raw unchanged

gards_roi_channels analysis unchanged

gards_roi_concs analysis unchanged

gards_roi_counts analysis unchanged

gards_roi_lib static unchanged

gards_roi_limits analysis unchanged

gards_roles static modified

gards_roles_permissions static unchanged

gards_sample_aux raw unchanged

gards_sample_cert raw unchanged

gards_sample_cert_lines raw unchanged

gards_sample_data analysis unchanged

gards_sample_description raw unchanged

gards_sample_flags analysis unchanged

gards_sample_proc_params analysis unchanged

gards_sample_ratios analysis unchanged

gards_sample_status analysis unchanged

gards_sample_update_params analysis unchanged

gards_sample_xe_proc_params analysis modified

gards_soh_char_data raw new

TABLE 123: DATABASE TABLE GROUPS (CONTINUED)

Table Name Table Group Changes

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 4 :

R a d ion uc l id e D a t ab as e O verv iew

R A D I O N U C L I D E O B J E C T D E S C R I P T I O N S

This chapter describes the objects in the IDC Radionuclide Schema (other than tables), for both the RMSAUTO database and the RMSMAN database. The table descriptions follow in a subsequent chapter.

gards_soh_code static modified

gards_soh_header raw unchanged

gards_soh_num_data raw new

gards_soh_sensor_data raw new

gards_spectrum raw unchanged

gards_stadet static unchanged

gards_station_assignments static unchanged

gards_stations static unchanged

gards_stations_schedule static unchanged

gards_total_effic analysis unchanged

gards_trendvue indy unchanged

gards_update_params_template static unchanged

gards_update_reflines static unchanged

gards_user_comments analysis modified

gards_userenv static unchanged

gards_users static modified

gards_users_roles static modified

gards_xe_nucl_lib static unchanged

gards_xe_nucl_lines_lib static unchanged

gards_xe_proc_params_template static modified

TABLE 123: DATABASE TABLE GROUPS (CONTINUED)

Table Name Table Group Changes

419b e r 2 0 0 2

420

Chap te r 4 :

R a d ion uc l id e D a t ab as e Overv iew

U s e r G u i d e sI D C D O C U M E N T A T I O N

L i n k s t o o t h e r D a t a b a s e s a n d Ta b l e s

Four objects reside outside the two-tiered database schema, which are of interest to radionuclide processing. These objects are lastid, fileproduct, fpdescription, and msgdisc. These objects are related to incoming message processing and are owned by the IDCX user (see the “S/H/I Table Descriptions” section for details). Synonyms created by the RMSAUTO and RMSMAN users establish a connection to these objects. The IDCX user grants permission to the RMSAUTO and RMSMAN users to allow updates to the objects.

D e s c r i p t i o n o f R M S A U T O O b j e c t s

Tables 124–130 fully describe all of the RMSAUTO user’s objects (other than tables).

TABLE 124: RMSAUTO INDEXES

Table Name Index Name Indexed Columns

gards_comments comments_ndx analyst, sample_id

gards_data_log data_log_ndx data_type, station_id, status

gards_efficiency_cal efficiency_cal_ndx sample_id

gards_efficiency_pairs efficiency_pairs_ndx sample_id

gards_energy_cal energy_cal_ndx sample_id

gards_energy_cal_orig energy_cal_orig_ndx sample_id

gards_energy_pairs energy_pairs_ndx sample_id

gards_energy_pairs_orig energy_pairs_orig_ndx sample_id

gards_environment environment_ndx sample_id

gards_met_data met_data_ndx end_time, start_time, station_id

gards_nic nic_ndx sample_id

gards_nucl_lines_ided nucl_lines_ided_ndx name, peak_sample_id

gards_nucl_lines_ided_orig nucl_lines_ided_orig_ndx name, peak_sample_id

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 4 :

R a d ion uc l id e D a t ab as e O verv iew

gards_peaks peaks_ndx energy, ided, peak_id, sample_id

gards_peaks_orig peaks_orig_ndx energy, ided, peak_id, sample_id

gards_qchistory qchistory_ndx sample_id

gards_resolution_cal resolution_cal_ndx sample_id

gards_resolution_cal_orig resolution_cal_orig_ndx sample_id

gards_resolution_pairs resolution_pairs_ndx sample_id

gards_resolution_pairs_orig resolution_pairs_orig_ndx sample_id

gards_sample_cert sample_cert_ndx sample_id

gards_sample_cert_lines sample_cert_lines_ndx sample_id

gards_sample_data sample_data_ndx collect_stop, data_type, detector_id, sample_type, spectral_qualifier, station_id

gards_sample_flags sample_flags_ndx sample_id

gards_sample_proc_params sample_proc_params_ndx sample_id

gards_sample_status sample_status_ndx sample_id, status

gards_sample_update_params sample_update_params_ndx sample_id

gards_soh_num_data soh_num_data_ndx station_id, dtg_begin, dtg_end, param_code

gards_soh_char_data soh_char_data_ndx station_id, dtg_begin, dtg_end, param_code

gards_total_effic total_effic_ndx sample_id

gards_user_comments user_comments_ndx comment_id

TABLE 124: RMSAUTO INDEXES (CONTINUED)

Table Name Index Name Indexed Columns

421b e r 2 0 0 2

422

Chap te r 4 :

R a d ion uc l id e D a t ab as e Overv iew

U s e r G u i d e sI D C D O C U M E N T A T I O N

TABLE 125: RMSAUTO UNIQUE DATA CONSTRAINTS

Table Name Index Name Constraint Column Names

gards_sample_data uq_sample_data acquisition_stop, collect_stop, detector_id, spectral_qualifier, station_id

TABLE 126: RMSAUTO PRIMARY KEY CONSTRAINTS

Table Name Index Name Constraint Column Names

gards_comments pk_comments comment_id

gards_flags pk_flags flag_id

gards_nucl_ided pk_nucl_ided name, sample_id

gards_nucl_ided_orig pk_nucl_ided_orig name, sample_id

gards_sample_aux pk_sample_aux sample_id

gards_sample_data pk_sample_data sample_id

gards_sample_description pk_sample_description sample_id

gards_sample_status pk_sample_status sample_id

TABLE 127: RMSAUTO FOREIGN KEY CONSTRAINTS

Table Name

Constraint Name

Foreign Table Name. Column Name

gards_bg_efficiency_pairs fk_bg_efficiency_pairs gards_sample_data. sample_id

gards_bg_energy_cal fk_bg_en_cal_sid gards_sample_data. (sample_id)

gards_b_energy_pairs fk_b_energy_pairs gards_sample_data. sample_id

gards_b_energy_pairs_orig fk_b_energy_pairs_orig gards_sample_data. sample_id

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 4 :

R a d ion uc l id e D a t ab as e O verv iew

gards_b_resolution_pairs fk_b_resolution_pairs gards_sample_data. sample_id

gards_b_resolution_pairs_orig fk_b_resolution_pairs_orig gards_sample_data. sample_id

gards_comments fk_comments gards_sample_data. sample_id

gards_efficiency_cal fk_efficiency_cal gards_sample_data. sample_id

gards_efficiency_pairs fk_efficiency_pairs gards_sample_data. sample_id

gards_energy_cal fk_energy_cal gards_sample_data. sample_id

gards_energy_cal_orig fk_energy_cal_orig gards_sample_data. sample_id

gards_energy_pairs fk_energy_pairs gards_sample_data. sample_id

gards_energy_pairs_orig fk_energy_pairs_orig gards_sample_data. sample_id

gards_environment fk_environment gards_sample_data. sample_id

gards_fpe fk_fpe gards_sample_data. sample_id

gards_histogram fk_histogram gards_sample_data. sample_id

gards_nic fk_nic gards_sample_data. sample_id

gards_nucl_ided fk_nucl_ided gards_sample_data. sample_id

gards_nucl_ided_orig fk_nucl_ided_orig gards_sample_data. sample_id

TABLE 127: RMSAUTO FOREIGN KEY CONSTRAINTS (CONTINUED)

Table Name

Constraint Name

Foreign Table Name. Column Name

423b e r 2 0 0 2

424

Chap te r 4 :

R a d ion uc l id e D a t ab as e Overv iew

U s e r G u i d e sI D C D O C U M E N T A T I O N

gards_nucl_lines_ided fk_nucl_lines_ided gards_sample_data. sample_id

gards_nucl_lines_ided_orig fk_nucl_lines_ided_orig gards_sample_data. sample_id

gards_peaks fk_peaks gards_sample_data. sample_id

gards_peaks_orig fk_peaks_orig gards_sample_data. sample_id

gards_qchistory fk_qchistory gards_sample_data. sample_id

gards_resolution_cal fk_resolution_cal gards_sample_data. sample_id

gards_resolution_cal_orig fk_resoultion_cal_orig gards_sample_data. sample_id

gards_resolution_pairs fk_resolution_pairs gards_sample_data. sample_id

gards_resolution_pairs_orig fk_resolution_pairs_orig gards_sample_data. sample_id

gards_roi_channels fk_roi_channels gards_sample_data. sample_id

gards_roi_concs fk_roi_concs gards_sample_data. sample_id

gards_roi_counts fk_roi_counts gards_sample_data. sample_id

gards_roi_limits fk_roi_limits gards_sample_data. sample_id

gards_sample_aux fk_sample_aux gards_sample_data. sample_id

gards_sample_cert fk_sample_cert gards_sample_data. sample_id

TABLE 127: RMSAUTO FOREIGN KEY CONSTRAINTS (CONTINUED)

Table Name

Constraint Name

Foreign Table Name. Column Name

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 4 :

R a d ion uc l id e D a t ab as e O verv iew

gards_sample_cert_lines fk_sample_cert_lines gards_sample_data. sample_id

gards_sample_description fk_sample_description gards_sample_data. sample_id

gards_sample_flags fk_sample_flags gards_sample_data. sample_id

gards_sample_proc_params fk_sample_proc_params gards_sample_data. sample_id

gards_sample_ratios fk_sample_ratios gards_sample_data. sample_id

gards_sample_status fk_sample_status gards_sample_data. sample_id

gards_sample_update_params fk_sample_update_params gards_sample_data. sample_id

gards_sample_xe_proc_params fk_sample_xe_proc_params gards_sample_data. sample_id

gards_spectrum fk_spectrum gards_sample_data. sample_id

gards_total_effic fk_total_effic gards_sample_data. sample_id

gards_user_comments fk_user_comments gards_comments. comment_id

TABLE 127: RMSAUTO FOREIGN KEY CONSTRAINTS (CONTINUED)

Table Name

Constraint Name

Foreign Table Name. Column Name

425b e r 2 0 0 2

426

Chap te r 4 :

R a d ion uc l id e D a t ab as e Overv iew

U s e r G u i d e sI D C D O C U M E N T A T I O N

TABLE 128: RMSAUTO COLUMN CONSTRAINTS

Table Name Constrained Columns Constraint Type

gards_interval class, name not null

gards_nucl_ided detector_id, sample_id, station_id

not null

gards_nucl_ided_orig detector_id, sample_id, station_id

not null

gards_nucl_lines_ided detector_id, sample_id, station_id

not null

gards_nucl_lines_ided_orig detector_id, sample_id, station_id

not null

gards_receipt_log pocid, prodid, subid, type not null

TABLE 129: RMSAUTO SYNONYMS

Synonym Name Owner Object Name Object Type

fileproduct IDCX fileproduct table

fpdescription IDCX fpdescription table

gards_aux_lib RMSMAN gards_aux_lib table

gards_aux_lines_lib RMSMAN gards_aux_lines_lib table

gards_cat_template RMSMAN gards_cat_template table

gards_codes RMSMAN gards_codes table

gards_comments_defs RMSMAN gards_comments_defs table

gards_comments_seq RMSMAN gards_comments_seq sequence

gards_detectors RMSMAN gards_detectors table

gards_detector_id RMSMAN gards_detector_id sequence

gards_dist_sample_queue RMSMAN gards_dist_sample_queue table

gards_dl_id_seq RMSMAN gards_dl_id_seq sequence

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 4 :

R a d ion uc l id e D a t ab as e O verv iew

gards_fpid_seq RMSMAN gards_fpid_seq sequence

gards_mdas2report RMSMAN gards_mdas2report table

gards_method_id_seq RMSMAN gards_method_id_seq sequence

gards_nic_init RMSMAN gards_nic_init table

gards_notify RMSMAN gards_notify table

gards_nucl2quantify RMSMAN gards_nucl2quantify table

gards_nucl_lib RMSMAN gards_nucl_lib table

gards_nucl_lines_lib RMSMAN gards_nucl_lines_lib table

gards_permissions RMSMAN gards_permissions table

gards_perm_id_seq RMSMAN gards_perm_id_seq sequence

gards_poc RMSMAN gards_poc table

gards_pocid_seq RMSMAN gards_pocid_seq sequence

gards_proc_params_template RMSMAN gards_proc_params_ template

table

gards_prcessing_errors RMSMAN gards_processing_errors table

gards_qcparams RMSMAN gards_qcparams table

gards_qctargets RMSMAN gards_qctargets table

gards_qviewer_seq RMSMAN gards_qviewer_seq sequence

gards_read_sample_cat RMSMAN gards_sample_cat table

gards_refline_master RMSMAN gards_refline_master table

gards_relevant_nuclides RMSMAN gards_relevant_nuclides table

gards_rlr_seq RMSMAN gards_rlr_seq sequence

gards_roi_lib RMSMAN gards_roi_lib table

gards_role_id_seq RMSMAN gards_role_id_seq sequence

gards_roles RMSMAN gards_roles table

gards_roles_permissions RMSMAN gards_roles_permissions table

TABLE 129: RMSAUTO SYNONYMS (CONTINUED)

Synonym Name Owner Object Name Object Type

427b e r 2 0 0 2

428

Chap te r 4 :

R a d ion uc l id e D a t ab as e Overv iew

U s e r G u i d e sI D C D O C U M E N T A T I O N

gards_sample_cat RMSMAN gards_sample_cat table

gards_sample_id_seq RMSMAN gards_sample_id_seq sequence

gards_soh_code RMSMAN gards_soh_code table

gards_soh_id_seq RMSMAN gards_soh_id_seq sequence

gards_stadet RMSMAN gards_stadet table

gards_stations RMSMAN gards_stations table

gards_stations_schedule RMSMAN gards_stations_schedule table

gards_station_assignments RMSMAN gards_station_assignments table

gards_station_id RMSMAN gards_station_id sequence

gards_update_params_ template

RMSMAN gards_update_params_ template

table

gards_update_reflines RMSMAN gards_update_reflines table

gards_user_id_seq RMSMAN gards_user_id_seq sequence

gards_userenv RMSMAN gards_userenv table

gards_users RMSMAN gards_users table

gards_users_roles RMSMAN gards_users_roles table

gards_write_sample_cat RMSAUTO gards_auto_sample_cat table

gards_xe_nucl_lib RMSMAN gards_xe_nucl_lib table

gards_xe_nucl_lines_lib RMSMAN gards_xe_nucl_lines_lib table

gards_xe_proc_params_ template

RMSMAN gards_xe_proc_params_ template

table

gsd RMSAUTO gards_sample_data table

gss RMSAUTO gards_sample_status table

interval RMSAUTO gards_interval table

lastid IDCX lastid view

msgdisc IDCX msgdisc table

TABLE 129: RMSAUTO SYNONYMS (CONTINUED)

Synonym Name Owner Object Name Object Type

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

429ID

C-5.1.1R

ev5 October 2002

Database Schem

a

Chapter 4:

Radionuclide D

atabase Overview

Use

r Gu

ide

sI

DC

D

OC

UM

EN

TA

TI

ON

N Tables Updated

_efficiency_pairs

energy_pairs

energy_pairs_orig

resolution_pairs

resolution_pairs_orig

mments

iciency_cal

iciency_pairs

TABLE 130: RMSAUTO TRIGGERS

Trigger Name Table Name Type/Event RMSMA

bg_efficiency_pairs_i_u_d gards_bg_efficiency_pairs after insert, update, or delete

gards_bg

b_energy_pairs_i_u_d gards_b_energy_pairs after insert, update_or delete

gards_b_

b_energy_pairs_orig_i_u_d gards_b_energy_pairs_orig after insert, update, or delete

gards_b_

b_resolution_pairs_i_u_d gards_b_resolution_pairs after insert, update, or delete

gards_b_

b_resolution_pairs_orig_i_u_d gards_b_resolution_pairs_orig after insert, update, or delete

gards_b_

comments_i_u_d gards_comments after insert, update, or delete

gards_co

efficiency_cal_i_u_d gards_efficiency_cal after insert, update, or delete

gards_eff

efficiency_pairs_i_u_d gards_efficiency_pairs after insert, update, or delete

gards_eff

October 2002 ID

C-5.1.1R

ev5

Database Schem

a

Chapter 4:

Radionuclide D

atabase Overview

Use

r Gu

ide

sI

DC

D

OC

UM

EN

TA

TI

ON

430

energy_cal_i_u_d gards_energy_cal after insert, update, or

gards_energy_cal

gards_energy_cal_orig

gards_energy_pairs

gards_energy_pairs_orig

gards_bg_energy_cal

gards_sample_cat

gards_nucl_ided

gards_nucl_ided_orig

TABLE 130: RMSAUTO TRIGGERS (CONTINUED)

Trigger Name Table Name Type/Event RMSMAN Tables Updated

delete

energy_cal_orig_i_u_d gards_energy_cal_orig after insert, update, or delete

energy_pairs_i_u_d gards_energy_pairs after insert, update, or delete

energy_pairs_orig_i_u_d gards_energy_pairs_orig after insert, update, or delete

gards_bg_energy_cal_i_u_d gards_bg_energy_cal after insert, update, or delete

gards_sample_cat_i_u_d gards_sample_cat after insert, update, or delete

nucl_ided_i_u_d gards_nucl_ided after insert, update, or delete

nucl_ided_orig_i_u_d gards_nucl_ided_orig after insert, update, or delete

431ID

C-5.1.1R

ev5 October 2002

Database Schem

a

Chapter 4:

Radionuclide D

atabase Overview

Use

r Gu

ide

sI

DC

D

OC

UM

EN

TA

TI

ON

cl_lines_ided

cl_lines_ided_orig

aks

aks_orig

history

solution_cal

solution_pairs

solution_cal_orig

TABLE 130: RMSAUTO TRIGGERS (CONTINUED)

N Tables Updated

nucl_lines_ided_i_u_d gards_nucl_lines_ided after insert, update, or delete

gards_nu

nucl_lines_ided_orig_i_u_d gards_nucl_lines_ided_orig after insert, update, or delete

gards_nu

peaks_i_u_d gards_peaks after insert, update, or delete

gards_pe

peaks_orig_i_u_d gards_peaks_orig after insert, update, or delete

gards_pe

qchistory_i_u_d gards_qchistory after insert, update, or delete

gards_qc

resolution_cal_i_u_d gards_resolution_cal after insert, update, or delete

gards_re

resolution_pairs_i_u_d gards_resolution_pairs after insert, update, or delete

gards_re

res_cal_orig_i_u_d gards_resolution_cal_orig after insert, update, or delete

gards_re

Trigger Name Table Name Type/Event RMSMA

October 2002 ID

C-5.1.1R

ev5

Database Schem

a

Chapter 4:

Radionuclide D

atabase Overview

Use

r Gu

ide

sI

DC

D

OC

UM

EN

TA

TI

ON

432

res_pairs_orig_i_u_d gards_resolution_pairs_orig after insert, update, or

gards_resolution_pairs_orig

gards_roi_channels

gards_roi_concs

gards_roi_counts

gards_roi_limits

gards_sample_data

gards_sample_flags

gards_sample_proc_params

TABLE 130: RMSAUTO TRIGGERS (CONTINUED)

Trigger Name Table Name Type/Event RMSMAN Tables Updated

delete

roi_channels_i_u_d gards_roi_channels after insert, update, or delete

roi_concs_i_u_d gards_roi_concs after insert, update, or delete

roi_counts_i_u_d gards_roi_counts after insert, update, or delete

roi_limits_i_u_d gards_roi_limits after insert, update, or delete

sample_data_i_u_d gards_sample_data after insert, update, or delete

sample_flags_i_u_d gards_sample_flags after insert, update, or delete

sample_proc_params_i_u_d gards_sample_proc_params after insert, update, or delete

433ID

C-5.1.1R

ev5 October 2002

Database Schem

a

Chapter 4:

Radionuclide D

atabase Overview

Use

r Gu

ide

sI

DC

D

OC

UM

EN

TA

TI

ON

mple_ratios

mple_status

mple_update_params

mple_xe_proc_params

al_effic

er_comments

TABLE 130: RMSAUTO TRIGGERS (CONTINUED)

N Tables Updated

D e s c r i p t i o n o f R M S M A N O b j e c t s

Tables 131–138 fully describe all of the RMSMAN user’s objects (other than tables).

sample_ratios_i_u_d gards_sample_ratios after insert, update, or delete

gards_sa

sample_status_i_u_d gards_sample_status after insert, update, or delete

gards_sa

sample_update_params_i_u_d gards_sample_update_params after insert, update, or delete

gards_sa

sample_xe_proc_params_i_u_d gards_sample_xe_proc_params after insert, update, or delete

gards_sa

total_effic_i_u_d gards_total_effic after insert, update, or delete

gards_tot

user_comments_i_u_d gards_user_comments after insert, update, or delete

gards_us

Trigger Name Table Name Type/Event RMSMA

434

Chap te r 4 :

R a d ion uc l id e D a t ab as e Overv iew

U s e r G u i d e sI D C D O C U M E N T A T I O N

TABLE 131: RMSMAN INDEXES

Table Name Index Name Indexed Columns

gards_comments comments_ndx analyst, sample_id

gards_efficiency_cal efficiency_cal_ndx sample_id

gards_efficiency_pairs efficiency_pairs_ndx sample_id

gards_energy_cal energy_cal_ndx sample_id

gards_energy_cal_orig energy_cal_orig_ndx sample_id

gards_energy_pairs energy_pairs_ndx sample_id

gards_energy_pairs_orig energy_pairs_orig_ndx sample_id

gards_nic nic_ndx sample_id

gards_nucl_lines_ided nucl_lines_ided_ndx name, peak, sample_id

gards_nucl_lines_ided_orig nucl_lines_ided_orig_ndx name, peak, sample_id

gards_peaks peaks_ndx energy, ided, peak_id, sample_id

gards_peaks_orig peaks_orig_ndx sample_id

gards_qchistory qchistory_ndx sample_id

gards_resolution_cal resolution_cal_ndx sample_id

gards_resolution_cal_orig resolution_ndx sample_id

gards_resolution_pairs resolution_pairs_ndx sample_id

gards_resolution_pairs_orig resolution_pairs_orig_ndx sample_id

gards_sample_data sample_data_ndx collect_stop, data_type, detector_id, sample_type, spectral_qualifier, station_id

gards_sample_flags sample_flags_ndx sample_id

gards_sample_proc_params sample_proc_params_ndx sample_id

gards_sample_status sample_status_ndx sample_id, status

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 4 :

R a d ion uc l id e D a t ab as e O verv iew

gards_sample_update_params sample_update_params_ndx sample_id

gards_total_effic total_effic_ndx sample_id

gards_user_comments user_comments_ndx comment_id

TABLE 132: RMSMAN UNIQUE DATA CONSTRAINTS

Table Name Index Name Constraint Column Names

gards_dbrole_owner gards_dbrole_single owner

gards_detectors uq_detectors detector_code

gards_sample_data uq_sample_data acquisition_stop, collect_stop, detector_id, spectral_qualifier, station_id

gards_stations uq_stations station_code

gards_userenv uq_userenv name

TABLE 133: RMSMAN PRIMARY KEY CONSTRAINTS

Table Name Constraint Name Constraint Column Names

gards_comments pk_comments comment_id

gards_detectors pk_detectors detector_id

gards_dist_sample_queue pk_dist_sample_queue sample_id

gards_flags pk_flags flag_id

gards_nucl_ided pk_nucl_ided name, sample_id

gards_nucl_ided_orig pk_nucl_ided_orig name, sample_id

gards_stations pk_stations station_id

gards_poc pk_poc pocid

gards_sample_data pk_sample_data sample_id

TABLE 131: RMSMAN INDEXES (CONTINUED)

Table Name Index Name Indexed Columns

435b e r 2 0 0 2

436

Chap te r 4 :

R a d ion uc l id e D a t ab as e Overv iew

U s e r G u i d e sI D C D O C U M E N T A T I O N

gards_sample_status pk_sample_status sample_id

gards_permissions pk_permissions permission_id

gards_roles pk_roles role_id

gards_users pk_users user_id

TABLE 134: RMSMAN FOREIGN KEY CONSTRAINTS

Table Name

Constraint Name

Foreign Table Name. Column Name

gards_b_energy_pairs fk_b_energy_pairs gards_sample_data.sample_id

gards_b_energy_pairs_orig fk_b_energy_pairs_orig gards_sample_data.sample_id

gards_b_resolution_pairs fk_b_resolution_pairs gards_sample_data.sample_id

gards_b_resolution_pairs_ orig

fk_b_resolution_pairs_ orig

gards_sample_data.sample_id

gards_bg_efficiency_pairs fk_bg_efficiency_pairs gards_sample_data.sample_id

gards_bg_energy_cal fk_bg_en_cal_sid gards_sample_data.sample_id

gards_comments fk_comments gards_sample_data.sample_id

gards_dist_sample_queue fk_dist_sample_queue gards_sample_data.sample_id

gards_efficiency_cal fk_efficiency_cal gards_sample_data.sample_id

gards_efficiency_pairs fk_efficiency_pairs gards_sample_data.sample_id

gards_energy_cal fk_energy_cal gards_sample_data.sample_id

gards_energy_cal_orig fk_energy_cal_orig gards_sample_data.sample_id

gards_energy_pairs fk_energy_pairs gards_sample_data.sample_id

gards_energy_pairs_orig fk_energy_pairs_orig gards_sample_data.sample_id

gards_fpe fk_fpe gards_sample_data.sample_id

gards_nic fk_nic gards_sample_data.sample_id

TABLE 133: RMSMAN PRIMARY KEY CONSTRAINTS (CONTINUED)

Table Name Constraint Name Constraint Column Names

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 4 :

R a d ion uc l id e D a t ab as e O verv iew

gards_nucl_ided fk_nucl_ided gards_sample_data.sample_id

gards_nucl_ided_orig fk_nucl_ided_orig gards_sample_data.sample_id

gards_nucl_lines_ided fk_nucl_lines_ided gards_sample_data.sample_id

gards_nucl_lines_ided_orig fk_nucl_lines_ided_orig gards_sample_data.sample_id

gards_peaks fk_peaks gards_sample_data.sample_id

gards_peaks_orig fk_peaks_orig gards_sample_data.sample_id

gards_qchistory fk_qchistory gards_sample_data.sample_id

gards_resolution_cal fk_resolution_cal gards_sample_data.sample_id

gards_resolution_cal_orig fk_resoultion_cal_orig gards_sample_data.sample_id

gards_resolution_pairs fk_resolution_pairs gards_sample_data.sample_id

gards_resolution_pairs_orig fk_resolution_pairs_orig gards_sample_data.sample_id

gards_roi_channels fk_roi_channels gards_sample_data.sample_id

gards_roi_concs fk_roi_concs gards_sample_data.sample_id

gards_roi_counts fk_roi_counts gards_sample_data.sample_id

gards_roi_limits fk_roi_limits gards_sample_data.sample_id

gards_sample_flags fk_sample_flags gards_sample_data.sample_id

gards_sample_proc_params fk_sample_proc_params gards_sample_data.sample_id

gards_sample_ratios fk_sample_ratios gards_sample_data.sample_id

gards_sample_status fk_sample_status gards_sample_data.sample_id

gards_sample_update_ params

fk_sample_update_ params

gards_sample_data.sample_id

gards_sample_xe_proc_ params

fk_sample_xe_proc_ params

gards_sample_data.sample_id

gards_station_assignments fk_station_assignments gards_stations.station_id

gards_total_effic fk_total_effic gards_sample_data.sample_id

gards_user_comments fk_user_comments gards_sample_data.sample_id

TABLE 134: RMSMAN FOREIGN KEY CONSTRAINTS (CONTINUED)

Table Name

Constraint Name

Foreign Table Name. Column Name

437b e r 2 0 0 2

438

Chap te r 4 :

R a d ion uc l id e D a t ab as e Overv iew

U s e r G u i d e sI D C D O C U M E N T A T I O N

TABLE 135: RMSMAN COLUMN CONSTRAINTS

Table Name Constrained Columns Constraint Type

gards_notify dtg_begin, event not null

gards_nucl_ided detector_id, sample_id, station_id not null

gards_nucl_ided_orig detector_id, sample_id, station_id not null

gards_nucl_lines_ided detector_id, sample_id, station_id not null

gards_nucl_lines_ided_orig detector_id, sample_id, station_id not null

gards_poc email_address not null

TABLE 136: RMSMAN SEQUENCES

Sequence Name Sequenced Table Name

gards_comments_seq gards_comments

gards_detector_id gards_detectors

gards_dl_id_seq gards_data_log

gards_fpid_seq gards_fpe

gards_method_id_seq gards_cat_template

gards_perm_id_seq gards_permissions

gards_pocid_seq gards_poc

gards_qviewer_seq gards_trendvue

gards_rlr_seq gards_rlr

gards_role_id_seq gards_roles

gards_sample_id_seq gards_sample_data

gards_soh_id_seq gards_soh_header

gards_station_id gards_stations

gards_user_id_seq gards_users

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 4 :

R a d ion uc l id e D a t ab as e O verv iew

TABLE 137: RMSMAN SYNONYMS

Synonym Name Table Owner Table Name Object Type

fileproduct IDCX fileproduct table

fpdescription IDCX fpdescription table

gards_alerts RMSAUTO gards_alerts table

gards_data_log RMSAUTO gards_data_log table

gards_environment RMSAUTO gards_environment table

gards_histogram RMSAUTO gards_histogram table

gards_interval RMSAUTO gards_interval table

gards_met_data RMSAUTO gards_met_data table

gards_read_sample_cat RMSMAN gards_sample_cat table

gards_receipt_log RMSAUTO gards_receipt_log table

gards_rlr RMSAUTO gards_rlr table

gards_sample_aux RMSAUTO gards_sample_aux table

gards_sample_cert RMSAUTO gards_sample_cert table

gards_sample_cert_lines RMSAUTO gards_sample_cert_lines table

gards_sample_description RMSAUTO gards_sample_description table

gards_soh_char_data RMSAUTO gards_soh_char_data table

gards_soh_header RMSAUTO gards_soh_header table

gards_soh_num_data RMSAUTO gards_soh_num_data table

gards_soh_sensor_data RMSAUTO gards_soh_sensor_data table

gards_spectrum RMSAUTO gards_spectrum table

gards_write_sample_cat RMSMAN gards_sample_cat table

gsd RMSMAN gards_sample_data table

gss RMSMAN gards_sample_status table

lastid IDCX lastid view

msgdisc IDCX msgdisc table

439b e r 2 0 0 2

440

Chap te r 4 :

R a d ion uc l id e D a t ab as e Overv iew

U s e r G u i d e sI D C D O C U M E N T A T I O N

TABLE 138: RMSMAN TRIGGERS

Trigger Name Table Name Type/Event Tables Updated

sample_data_insert gards_sample_data after insert gards_stadet

sample_status_update gards_sample_status after update gards_fpe

stations_insert gards_stations after insert gards_station_ assignments

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Chapter 5: R a d i o n u c l i d e E n t i t y R e l a t i o n s h i p s

This chapter describes the relationships between selected tables for the IDC radionuclide database schema. The following topics are covered:

■ Overview

■ Radionuclide Tables

b e r 2 0 0 2 441

U s e r G u i d e sI D C D O C U M E N T A T I O N

442

Chapter 5: R a d i o n u c l i d e E n t i t y R e l a t i o n s h i p s

O V E R V I E W

This chapter contains entity-relationship diagrams that illustrate the relationships between database tables for the radionuclide database schema. The table name is always shown at the top of the table. Keys are shown below the table name. The primary key of a table is indicated with a filled symbol. Optional foreign keys are unshaded. Keys con-sisting of multiple columns are shown with a key symbol next to the first column of the key and the remaining columns are listed beneath with no symbols. All column names are shown below the key section in the diagrams. Not all foreign keys are identified.

R A D I O N U C L I D E TA B L E S

Figures 26 through 37 illustrate the relationships among the various tables in the radio-nuclide database. In the following figures, a table is linked by either a single or double arrow. A single arrow indicates that a single record exists in the relationship to the table from where the record came. A double arrow indicates that one or more records exist in the relationship. For example, a single gards_sample_status record exists for each gards_sample_data record. However, multiple gards_nucl_ided records are related to each gards_sample_data record.

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 5 :

R a d io nuc l id e En t i ty R e la t i ons h ips

FIGURE 26. RADIONUCLIDE EQUIPMENT

gards_stations

station_idpocid

station_idstation_codecountry_codetypedescriptionlatlonelevationdate_begindate_endstatuspocid

gards_poc

pocid

pocidemail_addressfirst_namelast_nametelephoneaddressadditional_info

gards_detectors

detector_id

detector_iddetector_codedescriptionlatlontypechannelsrated_efficiencyrated resolutionecal_range_maxdate_begindate_endstatus

gards_sample_data

sample_idstation_id

detector_id

site_det_codesample_idstation_iddetector_idinput_file_namesample_typedata_typegeometryspectral_qualifiertransmit_dtgcollect_startcollect_stopacquisition_startacquisition_stopacquisition_real_secacquisition_live_secquantity

443b e r 2 0 0 2

444

Chap te r 5 :

R a d ion uc l id e E n t i ty R e la t i onsh ips

U s e r G u i d e sI D C D O C U M E N T A T I O N

FIGURE 27. RAW SENSOR DATA

gards_data_log

dlidstation_id

station_iddata_typedate_receiveddtgmsg_idstatusfile_sizeauthrms_iddlid

gards_alerts

station_iddtg

station_idstation_codedtgalert_typealert_text

gards_soh_header

soh_idstation_id

detector_id

soh_idstation_iddetector_iddtg_begindtg_endtransmit_dtg

gards_rlr

rlr_idstation_id

detector_id

rlr_idstation_iddetector_idref_idcollect_startcollect_stoparrival_datetest_datetransmit_datefilename

gards_soh_char_data

station_iddetector_id

param_codedtg_begindtg_begin

station_iddetector_idparam_codevaluedtg_begindtg_end

gards_soh_num_data

station_iddetector_id

param_codedtg_begin

dtg_end

station_iddetector_idparamparam_codevaluedtg_begindtg_end

gards_soh_sensor_data

station_iddetector_idsensor_type

station_iddetector_idsensor_typesensor_namevaluedtg_begindtg_end

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 5 :

R a d io nuc l id e En t i ty R e la t i ons h ips

FIGURE 28. RAW PULSE HEIGHT DATA

gards_sample_aux

sample_idmsg_id

sample_idsample_ref_idmeasurement_idbkgd_measurement_idsample_heightcalibration_dtgmsg_idarchive_bottle_idgas_bkgd_measurement_idxe_collect_yieldxe_collect_yield_errxe_volumexe_volume_errsample_diameter

gards_sample_data

sample_idstation_id

detector_id

site_det_codesample_idstation_iddetector_idinput_file_namesample_typedata_typegeometryspectral_qualifiertransmit_dtgcollect_startcollect_stopacquisition_startacquisition_stopacquisition_real_secacquisition_live_secquantity

gards_spectrum

sample_id

sample_idsample_typefilenamechannelsenergy_span

gards_sample_description

sample_id

sample_iddescription

gards_histogram

sample_id

sample_idfilenameg_channelsb_channelsg_energy_spanb_energy_span

gards_data_log

dlidstation_id

station_iddata_typedate_receiveddtgmsg_idstatusfile_sizeauthrms_iddlid

445b e r 2 0 0 2

446

Chap te r 5 :

R a d ion uc l id e E n t i ty R e la t i onsh ips

U s e r G u i d e sI D C D O C U M E N T A T I O N

FIGURE 29. RAW PARTICULATE CALIBRATION DATA

gards_sample_data

sample_idstation_id

detector_id

site_det_codesample_idstation_iddetector_idinput_file_namesample_typedata_typegeometryspectral_qualifiertransmit_dtgcollect_startcollect_stopacquisition_startacquisition_stopacquisition_real_secacquisition_live_secquantity

gards_resolution_pairs

sample_idres_energysample_id

sample_idres_energyresolutionres_error

gards_efficiency_pairs

sample_ideffic_energy

sample_id

sample_ideffic_energyefficiencyeffic_error

gards_energy_pairs

sample_idcal_energysample_id

sample_idcal_energychannelcal_error

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 5 :

R a d io nuc l id e En t i ty R e la t i ons h ips

FIGURE 30. RAW NOBLE GAS DATA

gards_sample_data

sample_idstation_id

detector_id

site_det_codesample_idstation_iddetector_idinput_file_namesample_typedata_typegeometryspectral_qualifiertransmit_dtgcollect_startcollect_stopacquisition_startacquisition_stopacquisition_real_secacquisition_live_secquantity

gards_resolution_pairs

sample_idres_energysample_id

sample_idres_energyresolutionres_error

gards_energy_pairs

sample_idcal_energysample_id

sample_idcal_energychannelcal_error

gards_bg_efficiency_pairs

sample_idroi

sample_idroi

sample_idbg_efficiencybg_effic_errorroi

gards_b_energy_pairs

sample_idcal_energysample_id

sample_iddecay_modecal_energycal_errorchannel

gards_b_resolution_pairs

sample_idres_energysample_id

sample_idresolutionres_energyres_error

gards_sample_ratios

sample_idratio_id

sample_id

sample_idratio_idupper_roi_numberlower_roi_numbercount_ratiocount_ratio_err

gards_roi_limits

sample_idroi

sample_idroi

sample_idroiupper_roi_numberlower_roi_numbercount_ratiocount_ratio_err

447b e r 2 0 0 2

448

Chap te r 5 :

R a d ion uc l id e E n t i ty R e la t i onsh ips

U s e r G u i d e sI D C D O C U M E N T A T I O N

FIGURE 31. CALCULATED PARTICULATE CALIBRATION DATA

gards_sample_data

sample_idstation_id

detector_id

site_det_codesample_idstation_iddetector_idinput_file_namesample_typedata_typegeometryspectral_qualifiertransmit_dtgcollect_startcollect_stopacquisition_startacquisition_stopacquisition_real_secacquisition_live_secquantity

gards_resolution_cal

sample_id

sample_idcoeff1coeff2coeff3coeff4coeff5coeff6coeff7coeff8

gards_efficiency_cal

sample_id

sample_iddegreeefftypecoeff1coeff2coeff3coeff4coeff5coeff6coeff7coeff8

gards_energy_cal

sample_id

sample_idcoeff1coeff2coeff3coeff4coeff5coeff6coeff7coeff8energy_unitscnv_factorapedetmsetstatscore

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 5 :

R a d io nuc l id e En t i ty R e la t i ons h ips

FIGURE 32. CALCULATED PARTICULATE DETECTION AND CHARACTERIZATION DATA

gards_sample_data

sample_idstation_id

detector_id

site_det_codesample_idstation_iddetector_idinput_file_namesample_typedata_typegeometryspectral_qualifiertransmit_dtgcollect_startcollect_stopacquisition_startacquisition_stopacquisition_real_secacquisition_live_secquantity

gards_peaks

sample_idpeak_id

sample_id

sample_idpeak_idcentroidcentroid_errenergyenergy_errleft_chanwidthback_countback_uncerfwhmfwhm_errareaarea_erroriginal_areaoriginal_uncercounts_seccounts_sec_errefficiencyeff_errorback_channelidedfittedmultipletlcpeak_sigpeak_tolpss

gards_nucl_ided

sample_idname

sample_idstation_id

detector_idname

sample_idstation_iddetector_idnuclide_idnametypehalflifeave_activave_activ_erractiv_keyactiv_key_errmdamda_errnid_flagactiv_decayactiv_decay_errcomp_confidreport_mdapd_mod_flag

gards_sample_cat

sample_idnamename

sample_idnamemethod_idcategoryupper_boundlower_boundcentral_valuedeltaactivityhold

gards_nucl_lines_ided

sample_idname

energysample_idstation_id

detector_idname

sample_idstation_iddetector_idnameenergyenergy_errabundanceabundance_errpeakactivityactivity_errefficeffic_errmdakey_flagnuclide_id

449b e r 2 0 0 2

450

Chap te r 5 :

R a d ion uc l id e E n t i ty R e la t i onsh ips

U s e r G u i d e sI D C D O C U M E N T A T I O N

FIGURE 33. PARTICULATE PARAMETER AND STATUS DATA

gards_sample_update_params

sample_idmrp_sample_id

sample_idmrp_usedmrp_sample_idgainshiftZeroshiftarea_limuse_weightuse_multf_linearbootstrapmin_lookuprer_interceptrer_slopeecr_slopedo_reru

gards_sample_proc_params

sample_id

sample_iddo_backback_data_typeback_sample_idnuclide_libenergy_tolmda_levelnid_confidsquant_errbuildtypepeak_sensepeak_startpeak_endfwhm_mult_widthleft_fwhm_limright_fwhm_limback_chanback_typefit_singletscrit_levelfix_fwhmarea_rejectmdc_widthlc_abscissado_pd_calc

gards_sample_data

sample_idstation_id

detector_id

site_det_codesample_idstation_iddetector_idinput_file_namesample_typedata_typegeometryspectral_qualifiertransmit_dtgcollect_startcollect_stopacquisition_startacquisition_stopacquisition_real_secacquisition_live_secquantity

gards_sample_status

sample_id

sample_identry_datecnf_begin_datecnf_end_datereview_datereview_timeanalyststatuscategoryauto_category

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 5 :

R a d io nuc l id e En t i ty R e la t i ons h ips

FIGURE 34. CALCULATED NOBLE GAS DETECTION DATA

gards_sample_data

sample_idstation_id

detector_id

site_det_codesample_idstation_iddetector_idinput_file_namesample_typedata_typegeometryspectral_qualifiertransmit_dtgcollect_startcollect_stopacquisition_startacquisition_stopacquisition_real_secacquisition_live_secquantity

gards_roi_channels

sample_idroi

sample_idroi

sample_idroib_chan_startb_chan_stopg_chan_startg_chan_stop

gards_roi_concs

sample_idroi

sample_idroi

sample_idroiactivityactiv_errmdanid_flagreport_mda

gards_roi_counts

sample_idroi

sample_idroi

sample_idroigrossgross_errcomptoncompton_errinterferenceinterference_errmemorymemory_errdetector_backdetector_back_errnetnet_errlc

451b e r 2 0 0 2

452

Chap te r 5 :

R a d ion uc l id e E n t i ty R e la t i onsh ips

U s e r G u i d e sI D C D O C U M E N T A T I O N

FIGURE 35. NOBLE GAS PARAMETER AND STATUS DATA

gards_sample_xe_proc_params

sample_idroi

sample_idroi

sample_idroilc_abscissabeta_ecr_ordergamma_ecr_ordercomptondet_back_usedgas_back_used

gards_sample_data

sample_idstation_id

detector_id

site_det_codesample_idstation_iddetector_idinput_file_namesample_typedata_typegeometryspectral_qualifiertransmit_dtgcollect_startcollect_stopacquisition_startacquisition_stopacquisition_real_secacquisition_live_secquantity

gards_sample_status

sample_id

sample_identry_datecnf_begin_datecnf_end_datereview_datereview_timeanalyststatuscategoryauto_category

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 5 :

R a d io nuc l id e En t i ty R e la t i ons h ips

FIGURE 36. ANALYST COMMENT DATA

gards_sample_data

sample_idstation_id

detector_id

site_det_codesample_idstation_iddetector_idinput_file_namesample_typedata_typegeometryspectral_qualifiertransmit_dtgcollect_startcollect_stopacquisition_startacquisition_stopacquisition_real_secacquisition_live_secquantity

gards_user_comments

comment_idsample_id

sample_idcomment_idcomment_text

gards_comments

comment_idsample_idsample_id

peak_idsample_id

nucl_namecomment_type

sample_idpeak_idnucl_namecomment_idanalystdtgcomment_type

gards_comments_defs

comment_type

comment_typecomment_text

453b e r 2 0 0 2

454

Chap te r 5 :

R a d ion uc l id e E n t i ty R e la t i onsh ips

U s e r G u i d e sI D C D O C U M E N T A T I O N

FIGURE 37. MULTIPLE ANALYST REVIEW DATA

gards_sample_data

sample_idstation_id

detector_id

site_det_codesample_idstation_iddetector_idinput_file_namesample_typedata_typegeometryspectral_qualifiertransmit_dtgcollect_startcollect_stopacquisition_startacquisition_stopacquisition_real_secacquisition_live_secquantity

gards_stations

station_idpocid

station_idstation_codecountry_codetypedescriptionlatlonelevationdate_begindate_endstatuspocid

gards_dist_sample_queue

sample_iduser_idrole_id

sample_idused_idrole_id

gards_permissions

permission_id

permission_idpermission_namedb_name

gards_roles_permissions

role_idpermission_id

role_idpermission_id

role_idpermission_id

gards_roles

role_id

role_idrole_namedb_name

gards_station_assignments

station_iduser_id

station_iduser_id

gards_users

user_id

user_iduser_nameassignable

gards_users_roles

user_idrole_iduser_idrole_id

user_idrole_iddefault_role

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Chapter 6: R a d i o n u c l i d e Ta b l e D e s c r i p t i o n s

This chapter describes the tables that comprise the IDC radionuclide schema and defines the physical structure of each table as it exists within the ORACLE data dictionary. Brief descriptions of the columns are provided for convenience. “Radionuclide Column Descriptions” on page 579 contains detailed descriptions of the columns.

b e r 2 0 0 2 455

U s e r G u i d e sI D C D O C U M E N T A T I O N

456

Chapter 6: R a d i o n u c l i d e Ta b l e D e s c r i p t i o n s

G A R D S _ A L E R T S

The gards_alerts table contains data describing all radionuclide alert messages received.

Keys: Primary: station_id/dtg Foreign: station_id (gards_stations)

station_id/dtg (gards_data_log)1

TABLE 139: GARDS_ALERTS

Column Storage Type Description

1 station_id number station identifier

2 station_code char(5) station code

3 dtg date date alert received

4 alert_type varchar2(20) category of alert (current alert types are ALERT_TEMP, ALERT_FLOW, ALERT_SYSTEM, and ALERT_UPS)

5 alert_text varchar2(512) alert message text

1. The related gards_data_log entry can be found by matching the station_id and dtg between the two tables where gards_data_log.data_type = ‘ALERT’.

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ A U T O _ S A M P L E _ C A T

The gards_auto_sample_cat table contains original categorization values from automatic processing.

Keys: Primary: name Foreign: name (gards_nucl_lib)

TABLE 140: GARDS_AUTO_SAMPLE_CAT

Column Storage Type Description

1 sample_id number sample identifier

2 name varchar2(8) nuclide name

3 method_id number method identifier

4 category number categorization level

5 upper_bound number upper limit of the amount of a nuclide that can be acceptably found

6 lower_bound number lower limit of the amount of a nuclide that can be acceptably found

7 central_value number current estimate of the level of the random pro-cess

8 delta number value of a variable used in bounds estimation (EWMA algorithm)

9 activity number relates to gards_nucl_ided.activ_key

10 hold number flag that hold categorization bounds fixed and does not update values (0 = proceed, 1 = wait)

457b e r 2 0 0 2

458

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ A U X _ L I B

The gards_aux_lib table provides additional radionuclide information that is useful to the analyst and used in the parent-progeny calculation.

Keys: Primary: name Foreign: name (gards_nucl_lib)

TABLE 141: GARDS_AUX_LIB

Column Storage Type Description

1 name varchar2(8) nuclide name

2 branch_ratio number percentage of decays to given decay path

3 chain_id number decay chain index

4 chain_pos number position in decay chain

5 halflife_act varchar2(23) actual half-life

6 halflife_act_err varchar2(23) uncertainty of halflife_act

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ A U X _ L I N E S _ L I B

The gards_aux_lines_lib table provides additional radionuclide line information that is useful to the analyst and is used in the parent-progeny calculation.

Keys: Primary: name/energy Foreign: name/energy (gards_nucl_lines_lib)

TABLE 142: GARDS_AUX_LINES_LIB

Column Storage Type Description

1 name varchar2(8) nuclide name

2 energy number line energy (keV)

3 abundance_act number intensity of nuclear transition

4 abundance_act_err number uncertainty of abundance_act

5 line_comment varchar2(500) description of line properties

6 line_type varchar2(8) type of radiation causing the line

7 reference varchar2(8) reference for line properties

459b e r 2 0 0 2

460

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ B _ E N E R G Y _ P A I R S

The gards_b_energy_pairs table contains the energy calibration pairs information associ-ated with the beta axis of the spectrum used in rms_xanalyze. The values in the gards_b_energy_pairs and the gards_b_energy_pairs_orig tables are identical.

Keys: Primary: sample_id/cal_energy Foreign: sample_id (gards_sample_data)

TABLE 143: GARDS_B_ENERGY_PAIRS

Column Storage Type Description

1 sample_id number sample identifier

2 decay_mode char(1) type of decay; B = beta particle, C = conversion electron

3 cal_energy number calibration energy (keV)

4 cal_error number uncertainty of channel

5 channel number peak centroid channel

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ B _ E N E R G Y _ P A I R S _ O R I G

The gards_b_energy_pairs_orig table contains the original energy calibration pairs infor-mation associated with the beta axis of the spectrum as specified in the PHD file. The values in the gards_b_energy_pairs and the gards_b_energy_pairs_orig tables are identi-cal. This table is not used by the rms_xanalyze process.

Keys: Primary: sample_id/cal_energy Foreign: sample_id (gards_sample_data)

TABLE 144: GARDS_B_ENERGY_PAIRS_ORIG

Column Storage Type Description

1 sample_id number sample identifier

2 decay_mode char(1) type of decay; B = beta particle, C = conversion electron

3 cal_energy number calibration energy (keV)

4 cal_error number uncertainty of channel

5 channel number peak centroid channel

461b e r 2 0 0 2

462

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ B _ R E S O L U T I O N _ P A I R S

The gards_b_resolution_pairs table contains the resolution calibration pairs information associated with the beta axis of the spectrum. This table is not used by the rms_xanalyzeprocess. The values in the gards_b_resolution_pairs and the gards_b_resolution_pairs_orig tables are identical.

Keys: Primary: sample_id/res_energy Foreign: sample_id (gards_sample_data)

TABLE 145: GARDS_B_RESOLUTION_PAIRS

Column Storage Type Description

1 sample_id number sample identifier

2 resolution number detector resolution (keV)

3 res_energy number resolution energy (keV)

4 res_error number uncertainty of resolution (keV)

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ B _ R E S O L U T I O N _ P A I R S _ O R I G

The gards_b_resolution_pairs_orig table contains the original resolution calibration pairs information associated with the beta axis of the spectrum as specified in the PHD file. This table is not used by the rms_xanalyze process. The values in the gards_b_resolution_pairs and the gards_b_resolution_pairs_orig tables are identical.

Keys: Primary: sample_id/res_energy Foreign: sample_id (gards_sample_data)

TABLE 146: GARDS_B_RESOLUTION_PAIRS_ORIG

Column Storage Type Description

1 sample_id number sample identifier

2 resolution number detector resolution (keV)

3 res_energy number resolution energy (keV)

4 res_error number uncertainty of resolution (keV)

463b e r 2 0 0 2

464

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ B G _ E F F I C I E N C Y _ P A I R S

The gards_bg_efficiency_pairs table contains the detection efficiency associated with a beta-gamma coincidence event as specified in the PHD file.

Keys: Primary: sample_id/roi Foreign: sample_id (gards_sample_data)

roi (gards_roi_lib)

TABLE 147: GARDS_BG_EFFICIENCY_PAIRS

Column Storage Type Description

1 sample_id number sample identifier

2 bg_efficiency number detection efficiency of β-γ coincidence event

3 bg_effic_error number uncertainty of bg_efficiency

4 roi number ROI identifier

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ B G _ E N E R G Y _ C A L

The gards_bg_energy_cal table contains the energy-to-channel ratios of a sample.

Keys: Primary: sample_id Foreign: sample_id (gards_sample_data)

TABLE 148: GARDS_BG_ENERGY_CAL

Column Storage Type Description

1 sample_id number sample identifier

2 beta_coeff1 number zero shift of the beta ECR equation

3 beta_coeff2 number linear coefficient of the beta ECR equa-tion

4 beta_coeff3 number quadratic coefficient of the beta ECR equation

5 gamma_coeff1 number zero shift of the gamma ECR equation

6 gamma_coeff2 number linear coefficient of the gamma ECR equation

7 gamma_coeff3 number quadratic coefficient of the gamma ECR equation

465b e r 2 0 0 2

466

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ C AT _ C R I T E R I A _ T E S T S

The gards_cat_criteria_tests table contains a list of all category criteria tests. The column active_flag is set to 0 if the test should not be run. A trigger updates the moddate column when any modification is made to another column.

Keys: Primary: test_id

TABLE 149: GARDS_CAT_CRITERIA_TESTS

Column Storage Type Description

1 test_id number unique identitifier

2 test_code varchar2(24) unique test code identifier string

3 test_name varchar2(48) test name label for display

4 lower_limit number lower limit bound of the test

5 upper_limit number upper limit bound of the test

6 units varchar2(16) unit values for the test bounds

7 active_flag number 0 if test is inactive

8 moddate date modification date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ C A T _ T E M P L A T E

The gards_cat_template table contains categorization initialization information for typi-cal nuclides.

TABLE 150: GARDS_CAT_TEMPLATE

Column Storage Type Description

1 station_id number station identifier

2 name varchar2(8) nuclide name

3 method_id number method identifier

4 method_type number type of categorization analysis to use

5 init_begin_date date start date for initialization data

6 init_end_date date end date for initialization data

7 begin_date date date initialization began

8 end_date date date initialization ended

9 analyst varchar2(30) name of analyst initializing nuclide cate-gorization

10 detector_id number detector identifier

11 comment_text varchar2(256) comment on the filter

12 upper_bound number upper limit of the amount of a nuclide that can be acceptably found

13 lower_bound number lower limit of the amount of a nuclide that can be acceptably found

14 central_value number current estimate of the level of the ran-dom process

15 delta number value of a variable used in bounds esti-mation (EWMA algorithm)

16 abscissa number acceptable number of standard devia-tions away from the central_value where the amount of a nuclide may be found (RDC algorithm)

467b e r 2 0 0 2

468

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

Keys: Primary: station_id/detector_id

17 num_samples number number of samples used to collect the average and define the standard devia-tion (RDC algorithm)

18 alpha number value of a variable used in bounds esti-mation (EWMA algorithm)

19 gamma number value of a variable used in bounds esti-mation (EWMA algorithm)

20 tstat number value of a variable used in bounds esti-mation (EWMA algorithm)

21 xform number code for transform function applied to measurement data

TABLE 150: GARDS_CAT_TEMPLATE (CONTINUED)

Column Storage Type Description

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ C O D E S

The gards_codes table contains codes for items used throughout radionuclide monitoring system.

Keys: Primary: type/code

TABLE 151: GARDS_CODES

Column Storage Type Description

1 type varchar2(15) category of code

2 code char(5) code symbol

3 description varchar2(40) code explanation

469b e r 2 0 0 2

470

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ C O M M E N T S

The gards_comments table contains automated analysis and interactive review comments related to peaks in the gards_peaks table and nuclides in the gards_nucl_ided table.

Keys: Primary: comment_id Foreign: sample_id (gards_sample_data)

sample_id/peak_id (gards_peaks) sample_id/nucl_name (gards_nucl_ided) comment_type (gards_comments_defs)

TABLE 152: GARDS_COMMENTS

Column Storage Type Description

1 sample_id number sample identifier

2 peak_id number peak identifier

3 nucl_name varchar2(8) nuclide name referenced by comment

4 comment_id number unique comment identifier

5 analyst varchar2(30) individual (or process) entering comment

6 dtg date comment entry date

7 comment_type number comment code

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ C O M M E N T S _ D E F S

The gards_comments_defs table contains predefined comments for automated analysis and interactive review.

Keys: Primary: comment_type

TABLE 153: GARDS_COMMENTS_DEFS

Column Storage Type Description

1 comment_type number predefined comment code

2 comment_text varchar2(256) predefined comment text

471b e r 2 0 0 2

472

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ C S C _ M O D C O E F F _ L I B

The gards_csc_modcoeff_lib table contains the cascade summing ratios used by rms_analyze.

Keys: Primary: detector_id, name, energy Foreign: detector_id (gards_detectors)

name (gards_nucl_lib)

TABLE 154: GARDS_CSC_MODCOEFF_LIB

Column Storage Type Description

1 detector_id number detector identifier

2 name varchar2(9) nuclide name

3 name_d varchar2(9) daughter nuclide name

4 energy number energy of nuclide line

5 abundance number abundance of line (%)

6 app_abundance number apparent abundance

7 app_abundance_err number absolute error in apparent abundance

8 csc_ratio number CSC correction factor

9 csc_ratio_err number error in CSC

10 moddate number row modification date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ D A T A _ L O G

The gards_data_log table contains data describing all radionuclide data messages received.

Keys: Primary: dlid Foreign: station_id (gards_stations)

TABLE 155: GARDS_DATA_LOG

Column Storage Type Description

1 station_id number station identifier

2 data_type varchar2(10) type of data message (current choices include: ALERT, MET, SOH, SPHD-B, SPHD-C, SPHD-D, SPHD-F, SPHD-P, SPHD-Q, SPHD-G)

3 date_received date data message arrival date (GMT)

4 dtg date date included within data message (GMT)

5 msg_id number message identifier sent in the mail header of the message

6 status char(1) status of data msg_id processing; U = sequencing has not been run on message, P = sequence process has checked mes-sage

7 file_size number data message size (KB)

8 auth number authentication status of associated mes-sage; 1 = authenticated, 0 = not authen-ticated

9 rms_id number internal identifier for message; either the sample_id for PHDs, the rlr_id for RLRs, or the soh_id for SOHs

10 dlid number data log identifier

473b e r 2 0 0 2

474

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ D B R O L E _ O W N E R

The gards_dbrole_owner table contains information used by the MAR tool to determine the database user that owns the RMS roles.

TABLE 156: GARDS_DBROLE_OWNER

Column Storage Type Description

1 owner varchar(12) name of database user who owns the RMS roles for the MAR tool

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ D E T E C T O R S

The gards_detectors table contains detector overviews and characteristics.

Keys: Primary: detector_id

TABLE 157: GARDS_DETECTORS

Column Storage Type Description

1 detector_id number unique detector identifier

2 detector_code varchar2(9) detector identification code

3 description varchar2(80) detector description

4 lat number latitude (degrees)

5 lon number longitude (degrees)

6 type varchar2(6) detector type

7 channels number number of channels

8 rated_efficiency number rated efficiency of detector

9 rated_resolution number rated resolution of detector

10 ecal_range_max number maximum detector calibration energy (keV)

11 date_begin date detector initialization date

12 date_end date detector decommissioning date

13 status varchar2(2) status of detector, if Y then data from this detector are automatically processed if N then they are not automatically pro-cessed

475b e r 2 0 0 2

476

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ D I S T _ S A M P L E _ Q U E U E

The gards_dist_sample_queue table contains a list of samples and the user or role to which they are assigned.

Keys: Primary: sample_id Foreign: user_id (gards_users)

rule_id (gards_roles)

TABLE 158: GARDS_DIST_SAMPLE_QUEUE

Column Storage Type Description

1 sample_id number sample identifier

2 user_id number user identifier

3 role_id number role identifier

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ E F F I C I E N C Y _ C A L

The gards_efficiency_cal table contains the efficiency calibration equation that is com-puted for each spectra.

Keys: Primary: sample_id Foreign: sample_id (gards_sample_data)

TABLE 159: GARDS_EFFICIENCY_CAL

Column Storage Type Description

1 sample_id number sample identifier

2 degree number degree of efficiency equation

3 efftype char(8) efficiency type

4 coeff1 number first order calibration coefficient

5 coeff2 number second order calibration coefficient

6 coeff3 number third order calibration coefficient

7 coeff4 number fourth order calibration coefficient

8 coeff5 number fifth order calibration coefficient

9 coeff6 number sixth order calibration coefficient

10 coeff7 number seventh order calibration coefficient

11 coeff8 number eighth order calibration coefficient

477b e r 2 0 0 2

478

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ E F F I C I E N C Y _ P A I R S

The gards_efficiency_pairs table contains efficiency calibration pairs as specified in the PHD file.

Keys: Primary: sample_id/effic_energy Foreign: sample_id (gards_sample_data)

TABLE 160: GARDS_EFFICIENCY_PAIRS

Column Storage Type Description

1 sample_id number sample identifier

2 effic_energy number efficiency energy (keV)

3 efficiency number efficiency

4 effic_error number uncertainty of efficiency

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ E N E R G Y _ C A L

The gards_energy_cal table contains efficiency calibration coefficients associated with spectra. The equation is calculated during energy calibration update.

TABLE 161: GARDS_ENERGY_CAL

Column Storage Type Description

1 sample_id number sample identifier

2 coeff1 number first order calibration coefficient

3 coeff2 number second order calibration coefficient

4 coeff3 number third order calibration coefficient

5 coeff4 number fourth order calibration coefficient

6 coeff5 number fifth order calibration coefficient

7 coeff6 number sixth order calibration coefficient

8 coeff7 number seventh order calibration coefficient

9 coeff8 number eighth order calibration coefficient

10 energy_units char(3) energy units

11 cnv_factor number conversion to keV

12 ape number average prediction error, a measure of the average confidence interval for the calculated energy vs. channel regression (ECR) over the range of 100 keV

13 det number determinant of the weighted design matrix, a measure of the spread of fitted data points and the error in the fitted points

479b e r 2 0 0 2

480

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

Keys: Primary: sample_id Foreign: sample_id (gards_sample_data)

14 mse number mean-squared error of the fit, a measure of how large the residuals are

15 tstat number percentage point of the t-statistic for Type I error with a probability set to 99%

16 score number score used when comparing this ECR to other ECRs, a measure of both the ape and determinant

TABLE 161: GARDS_ENERGY_CAL (CONTINUED)

Column Storage Type Description

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ E N E R G Y _ C A L _ O R I G

The gards_energy_cal_orig table contains original energy calibration equation informa-tion associated with samples (calculated using energy pair data).

TABLE 162: GARDS_ENERGY_CAL_ORIG

Column Storage Type Description

1 sample_id number sample identifier

2 coeff1 number first order calibration coefficient

3 coeff2 number second order calibration coefficient

4 coeff3 number third order calibration coefficient

5 coeff4 number fourth order calibration coefficient

6 coeff5 number fifth order calibration coefficient

7 coeff6 number sixth order calibration coefficient

8 coeff7 number seventh order calibration coefficient

9 coeff8 number eighth order calibration coefficient

10 energy_units char(3) energy units

11 cnv_factor number conversion to keV

12 ape number average prediction error, a measure of the average confidence interval for the calculated energy vs. channel regression (ECR) over the range of 100 keV

13 det number determinant of the weighted design matrix, a measure of the spread of fitted data points and the error in the fitted points

481b e r 2 0 0 2

482

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

Keys: Primary: sample_id Foreign: sample_id (gards_sample_data)

14 mse number mean-squared error of the fit, a measure of how large the residuals are

15 tstat number percentage point of the t-statistic for Type I error with a probability set to 99%

16 score number score used when comparing this ECR to other ECRs, a measure of both the ape and determinant

TABLE 162: GARDS_ENERGY_CAL_ORIG (CONTINUED)

Column Storage Type Description

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ E N E R G Y _ P A I R S

The gards_energy_pairs table contains energy calibration pairs information associated with the gamma axis of the spectrum.

Keys: Primary: sample_id/cal_energy Foreign: sample_id (gards_sample_data)

TABLE 163: GARDS_ENERGY_PAIRS

Column Storage Type Description

1 sample_id number sample identifier

2 cal_energy number calibration energy (keV)

3 channel number peak centroid channel

4 cal_error number uncertainty of channel

483b e r 2 0 0 2

484

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ E N E R G Y _ P A I R S _ O R I G

The gards_energy_pairs_orig table contains energy calibration pairs information associ-ated with the gamma axis of the spectrum. These values are as specified in the PHD file.

Keys: Primary: sample_id/cal_energy Foreign: sample_id (gards_sample_data)

TABLE 164: GARDS_ENERGY_PAIRS_ORIG

Column Storage Type Description

1 sample_id number sample identifier

2 cal_energy number calibration energy (keV)

3 channel number peak centroid channel

4 cal_error number uncertainty of channel

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ E N V I R O N M E N T

The gards_environment table contains atmospheric conditions and related sample infor-mation. This table is applicable to PHDs sent in IMS1.0 format or earlier. It does not apply to messages in IMS2.0 format or later.

Keys: Primary: sample_id Foreign: sample_id (gards_sample_data)

TABLE 165: GARDS_ENVIRONMENT

Column Storage Type Description

1 sample_id number sample identifier

2 flow_rate number flow rate through filter (m3/h)

3 pressure number outside pressure (mbar)

4 temperature number outside temperature (°C)

5 end_env_time date end date of environment data

6 end_env_time_sec number end time of environment data (seconds)

485b e r 2 0 0 2

486

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ F L A G S

The gards_flags table contains the name and thresholds for each of the tests run during rms_DBflags.

Keys: Primary: flag_id

TABLE 166: GARDS_FLAGS

Column Storage Type Description

1 flag_id number unique identifier for an event screening test

2 name varchar2(32) name of the event screening test

3 threshold number value against which the results in the test column are compared

4 units varchar2(16) units of the event screening test

5 test varchar2(8) calculated result of the test; this value is compared to the threshold value (exam-ples are <, = , >, >=)

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ F P E

The gards_fpe table contains one record for each sample associated with a fission prod-uct event.

Keys: Primary: fpid/sample_id Foreign: sample_id (gards_sample_data)

TABLE 167: GARDS_FPE

Column Storage Type Description

1 fpid number unique fission product identifier

2 revid number revision number

3 dtg date data product generation date

4 sample_id number sample identifier

487b e r 2 0 0 2

488

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ H I S T O G R A M

The gards_histogram table contains information regarding the three dimensional beta-gamma coincidence sample data.

Keys: Primary: sample_id Foreign: sample_id (gards_sample_data)

TABLE 168: GARDS_HISTOGRAM

Column Storage Type Description

1 sample_id number sample identifier

2 filename varchar2(256) name of file containing histogram data

3 g_channels number number of gamma channels in histogram

4 b_channels number number of beta channels in histogram

5 g_energy_span number gamma energy span of detector calibra-tion (keV)

6 b_energy_span number beta energy span of detector calibration (keV)

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ I N T E R V A L

The gards_interval table contains data used to update RMS data workflow.

Keys: Primary: class/name/start_time/end_time

TABLE 169: GARDS_INTERVAL

Column Storage Type Description

1 class varchar2(16) station name

2 name varchar2(16) detector/system identifier

3 start_time float start time of interval

4 end_time float end time of interval

5 state varchar2(16) specific activity of detector/system

6 moddate date modification date

7 lddate date load date

489b e r 2 0 0 2

490

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ M D A S 2 R E P O R T

The gards_mdas2report table contains the list of nuclides which have their minimum detectable activities reported in radionuclide reports.

Keys: Primary: name/sample_type

TABLE 170: GARDS_MDAS2REPORT

Column Storage Type Description

1 name varchar2(8) nuclide name

2 type varchar2(16) nuclide type: ACTIVATION, COSMIC, FISSION(G), FISSION(P), or NATURAL

3 mda_min number minimum bound for minimum detect-able activity (MDA) range (µBq/m3)

4 mda_max number maximum bound for MDA range (µBq/m3)

5 sample_type varchar2(2) sample type (P for particulate or G for gas)

6 dtg_begin date start date of bound applicability

7 dtg_end date end date of bound applicability

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ M E T _ D A T A

The gards_met_data table contains station local meteorological data.

Keys: Primary: station_id/start_time Foreign: station_id (gards_stations)

TABLE 171: GARDS_MET_DATA

Column Storage Type Description

1 station_id number station identifier

2 ave_humidity number average humidity (percent relative humidity)

3 ave_out_temp number average outside temperature (°C)

4 ave_pressure number average pressure (mbar)

5 ave_wind_dir number average wind direction (degrees from North)

6 ave_wind_speed number average wind speed (km/h)

7 total_rainfall number total rainfall (mm)

8 start_time date start time of measurement

9 end_time date end time of measurement

491b e r 2 0 0 2

492

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ N O T I F Y

The gards_notify table contains contact information for specific events. When the event occurs a message is automatically sent to the email_addr of the specified recipient.

Keys: Primary: event/email_addr/dtg_end

TABLE 172: GARDS_NOTIFY

Column Storage Type Description

1 event varchar2(10) type of occurrence (choices are: ALERT, FISS_FOUND, NIC_SIG34, NIC_SIG5, QC_ERROR, QC_WARNING, RADOPSCAL, RMS_ADMIN)

2 email_addr varchar2(80) recipient email addresses

3 description varchar2(80) general description of occurrence

4 dtg_begin date notification initialization date

5 dtg_end date notification termination date

6 pocid number not used

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ N U C L 2 Q U A N T I F Y

The gards_nucl2quantify table contains natural radionuclides quantified in radionuclide related reports.

Keys: Primary: name/dtg_begin

TABLE 173: GARDS_NUCL2QUANTIFY

Column Storage Type Description

1 name varchar2(8) nuclide name

2 dtg_begin date start of reporting period

3 dtg_end date end of reporting period

493b e r 2 0 0 2

494

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ N U C L _ I D E D

The gards_nucl_ided table contains information regarding nuclides identified during interactive review.

TABLE 174: GARDS_NUCL_IDED

Column Storage Type Description

1 sample_id number sample identifier

2 station_id number station identifier

3 detector_id number detector identifier

4 nuclide_id number nuclide identifier

5 name varchar2(8) nuclide name Canberra Parameter: CAM_T_NCLNAME

6 type varchar2(16) nuclide type (choices are: ACTIVATION, COS-MIC, FISSION(G), FISSION(P), or NATU-RAL)Canberra param: CAM_T_NCLSBHDR

7 halflife varchar2(23) half-life in seconds (S), hours (H), days (D), or years (Y)Canberra Parameter: CAM_T_NCLHLFLIFE

8 ave_activ number average activity for nuclide (µBq/m3)Canberra Parameter: CAM_T_NCLWTMEAN

9 ave_activ_err number uncertainty in average activity (µBq/m3)Canberra Parameter: CAM_T_NCLWTMERR

10 activ_key number key-line activity (µBq/m3)Canberra Parameter: CAM_G_NCLACTVTY

11 activ_key_err number uncertainty of key-line activity (µBq/m3)Canberra Parameter: CAM_G_NCLEER

12 mda number minimum detectable activity (µBq/m3)Canberra Parameter: CAM_G_NCLMDA

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

13 mda_err number minimum detectable activity uncertainty (µBq/m3)Canberra Parameter: CAM_G_NCLMDAERR

14 nid_flag number nuclide identification indicator (0 = nuclide was not identified by automated analysis; 1 = nuclide was identified by automated analysis; -1 = nuclide was identified initially by automated anal-ysis but later rejected because the concentration was < 0.0; 2 = nuclide was identified by auto-mated analysis but was removed by the analyst through the Inspectra)Canberra Parameter: CAM_G_NCLFIDENT

15 activ_decay number activity decay factorCanberra Parameter: CAM_G_NCLDECAY

16 activ_decay_err number uncertainty in activity decayCanberra Parameter: CAM_F_NCLDECAYERR

17 comp_confid number computed confidence indexCanberra Parameter: CAM_F_NCLCONFID

18 report_mda number indicator of whether MDA is to be reported

19 pd_mod_flag number flag that indicates if a nuclide’s activity was modi-fied by the parent/daughter calculation; 1 = the activity was modified, 0 = no modification

20 csc_ratio number multiplier used by analysis to update active_key and mda

21 csc_ratio_err number uncertainty in csc_ratio

22 csc_mod_flag number flag that indicates if cascade summing modified a nuclide: 1 = nuclide was modified, 0 = nuclide was not modified

TABLE 174: GARDS_NUCL_IDED (CONTINUED)

Column Storage Type Description

495b e r 2 0 0 2

496

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

Keys: Primary: sample_id/name Foreign: sample_id (gards_sample_data)

station_id (gards_stations) detector_id (gards_detectors) name (gards_nucl_lib)

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ N U C L _ I D E D _ O R I G

The gards_nucl_ided_orig table contains information regarding nuclides identified during automated analysis.

TABLE 175: GARDS_NUCL_IDED_ORIG

Column Storage Type Description

1 sample_id number sample identifier

2 station_id number station identifier

3 detector_id number detector identifier

4 nuclide_id number identification code of associated nuclide

5 name varchar2(8) nuclide nameCanberra Parameter: CAM_T_NCLNAME

6 type varchar2(16) nuclide type (choices are: ACTIVATION, COS-MIC, FISSION(G), FISSION(P), or NATU-RAL)Canberra Parameter: CAM_T_NCLSBHDR

7 halflife varchar2(23) half-life in seconds (S), hours (H), minutes (M), or years (Y)Canberra Parameter: CAM_T_NCLHLFLIFE

8 ave_activ number average activity for nuclide (µBq/m3)Canberra Parameter: CAM_T_NCLWTMEAN

9 ave_activ_err number uncertainty in average activity (µBq/m3)Canberra Parameter: CAM_T_NUCLWTMERR

10 activ_key number activity of key-line (µBq/m3)Canberra Parameter: CAM_G_NCLACTVTY

11 activ_key_err number uncertainty of key-line activity (µBq/m3)Canberra Parameter: CAM_G_NCLERR

12 mda number minimum detectable activity (µBq/m3)Canberra Parameter: CAM_G_NCLMDA

497b e r 2 0 0 2

498

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

Keys: Primary: sample_id/name Foreign: sample_id (gards_sample_data)

station_id (gards_stations) detector_id (gards_detectors) name (gards_nucl_lib)

13 mda_err number minimum detectable activity error (µBq/m3)Canberra Parameter: CAM_G_NCLMDAERR

14 nid_flag number nuclide identification indicator (0 = nuclide was not identified by automated analysis; 1 = nuclide was identified by automated analysis; -1 = nuclide was identified initially by automated anal-ysis but later rejected because the concentration was < 0.0; 2 = nuclide was identified by auto-mated analysis but was removed by the analyst through Inspectra)Canberra Parameter: CAM_G_NCLFIDENT

15 activ_decay number activity decay factorCanberra Parameter: CAM_G_NCLDECAY

16 activ_decay_err number uncertainty of activity decayCanberra Parameter: CAM_F_NCLDECAYERR

17 comp_confid number computed confidence indexCanberra Parameter: CAM_F_NCLCONFID

18 report_mda number indicator of whether MDA is to be reported

19 pd_mod_flag number flag that indicates if a nuclide’s activity was modi-fied by the parent/daughter calculation; 1 = the activity was modified, 0 = no modification

TABLE 175: GARDS_NUCL_IDED_ORIG (CONTINUED)

Column Storage Type Description

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ N U C L _ L I B

The gards_nucl_lib table contains nuclide library information used by the Inspectra when displaying nuclide data for particulate stations.

Keys: Primary: name

TABLE 176: GARDS_NUCL_LIB

Column Storage Type Description

1 nuclide_id number nuclide identifier

2 name varchar2(8) nuclide name

3 type varchar2(16) nuclide type (ACTIVATION, COSMIC, FISSION(G), FISSION(P), or NATURAL)

4 halflife_sec number half-life in seconds

5 halflife varchar2(23) half-life

6 halflife_err varchar2(23) uncertainty of half-life

7 num_lines number number of nuclide lines in library

499b e r 2 0 0 2

500

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ N U C L _ L I N E S _ I D E D

The gards_nucl_lines_ided table contains auxiliary information regarding lines identified by interactive review.

TABLE 177: GARDS_NUCL_LINES_IDED

Column Storage Type Description

1 sample_id number sample identifier

2 station_id number station identifier

3 detector_id number detector identifier

4 name varchar2(8) nuclide nameCanberra Parameter: CAM_T_NCLNAME

5 energy number line energy (keV)Canberra Parameter: CAM_F_NLENERGY

6 energy_err number uncertainty in line energyCanberra Parameter: CAM_F_NLENGERR

7 abundance number abundance of line (percent)Canberra Parameter: CAM_F_NLABUN

8 abundance_err number uncertainty of abundance (percent)Canberra Parameter: CAM_F_NLABUNERR

9 peak number peak identifierCanberra Parameter: CAM_L_NLPEAK

10 activity number line activity (µBq/m3)Canberra Parameter: CAM_G_NLACTVTY

11 activ_err number percent uncertainty of line activityCanberra Parameter: CAM_G_NLERR

12 effic number efficiency at energyCanberra Parameter: CAM_F_NLEFFICIENCY

13 effic_err number uncertainty of efficiencyCanberra Parameter: CAM_F_NLEFFERR

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

Keys: Primary: sample_id/name/energy Foreign: sample_id (gards_sample_data)

station_id (gards_stations) detector_id (gards_detectors) name (gards_nucl_lib)

14 mda number minimum detectable activity (µBq/m3)Canberra Parameter: CAM_F_NLMDA

15 key_flag number key line indicatorCanberra Parameter: CAM_V_NLF_KEYLINE

16 nuclide_id number nuclide number associated with line numberCanberra Parameter: CAM_L_NLNUCL

17 csc_ratio number multiplier used by analysis to update activ_key and mda

18 csc_ratio_err number uncertainty in csc_ratio

19 csc_mod_flag number flag that indicates if cascade summing modified a nuclide: 1 = nuclide was modified, 0 = nuclide was not modified.

TABLE 177: GARDS_NUCL_LINES_IDED (CONTINUED)

Column Storage Type Description

501b e r 2 0 0 2

502

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ N U C L _ L I N E S _ I D E D _ O R I G

The gards_nucl_lines_ided_orig table contains information regarding lines identified dur-ing automated analysis.

TABLE 178: GARDS_NUCL_LINES_IDED_ORIG

Column Storage Type Description

1 sample_id number sample identifier

2 station_id number station identifier

3 detector_id number detector identifier

4 name varchar2(8) nuclide nameCanberra Parameter: CAM_T_NCLNAME

5 energy number line energy (keV)Canberra Parameter: CAM_F_NLENERGY

6 energy_err number uncertainty of line energyCanberra Parameter: CAM_F_NLENGERR

7 abundance number abundance of line (percent)Canberra Parameter: CAM_F_NLABUN

8 abundance_err number uncertainty of abundance (percent)Canberra Parameter: CAM_F_NLABUNERR

9 peak number peak associated with lineCanberra Parameter: CAM_L_NLPEAK

10 activity number line activity (µBq/m3)Canberra Parameter: CAM_G_NLACTVTY

11 activ_err number percent uncertainty of line activityCanberra Parameter: CAM_G_NLERR

12 effic number efficiency at energyCanberra Parameter: CAM_F_NLEFFICIENCY

13 effic_err number uncertainty of efficiencyCanberra Parameter: CAM_F_NLEFFERR

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

Keys: Primary: sample_id/name/energy Foreign: sample_id (gards_sample_data),

station_id (gards_stations), detector_id (gards_detectors) name (gards_nucl_lib)

14 mda number minimum detectable activity (µBq/m3)Canberra Parameter: CAM_F_NLMDA

15 key_flag number key line indicatorCanberra Parameter: CAM_V_NLF_KEYLINE

16 nuclide_id number nuclide number associated with line numberCanberra Parameter: CAM_L_NLNUCL

TABLE 178: GARDS_NUCL_LINES_IDED_ORIG (CONTINUED)

Column Storage Type Description

503b e r 2 0 0 2

504

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ N U C L _ L I N E S _ L I B

The gards_nucl_lines_lib table contains library information used in particulate nuclide identification process.

Keys: Primary: name/energy Foreign: name (gards_nucl_lib)

TABLE 179: GARDS_NUCL_LINES_LIB

Column Storage Type Description

1 name varchar2(8) nuclide name

2 energy number line energy (keV)Canberra Parameter: CAM_F_NLENERGY

3 energy_err number uncertainty of line energyCanberra Parameter: CAM_F_NLENGERR

4 abundance number abundance of line (percent)Canberra Parameter: CAM_F_NLABUN

5 abundance_err number uncertainty of abundance (percent)Canberra Parameter: CAM_F_NLABUNERR

6 key_flag number key line indicatorCanberra Parameter: CAM_V_NLF_KEYLINE

7 nuclide_id number nuclide number associated with line numberCanberra Parameter: CAM_L_NLNUCL

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ P E A K S

The gards_peaks table contains information regarding peaks identified during interactive review.

TABLE 180: GARDS_PEAKS

Column Storage Type Description

1 sample_id number sample identifier

2 peak_id number peak identifier

3 centroid number peak centroid (channels)Canberra Parameter: CAM_F_PSCENTRD

4 centroid_err number uncertainty of peak centroidCanberra Parameter: CAM_F_PSDCENTRD

5 energy number energy at peak centroid (keV)Canberra Parameter: CAM_F_PSENERGY

6 energy_err number uncertainty of energy (keV)Canberra Parameter: CAM_F_PSDENERGY

7 left_chan number left channel of peakCanberra Parameter: CAM_L_PSLEFT

8 width number width of peak (channels)Canberra Parameter: CAM_L_PSWIDTH

9 back_count number continuum background countsCanberra Parameter: CAM_F_PSBACKGND

10 back_uncer number uncertainty in continuum background countsCanberra Parameter: CAM_F_PSBACK

11 fwhm number full width at half maximumCanberra Parameter: CAM_F_PSFWHM

12 fwhm_err number uncertainty of full width at half maximumCanberra Parameter: CAM_F_PSDFWHM

13 area number peak area (counts)Canberra Parameter: CAM_F_PSAREA

505b e r 2 0 0 2

506

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

14 area_err number uncertainty of peak area (counts)Canberra Parameter: CAM_F_PSDAREA

15 original_area number original peak area (counts)Canberra Parameter: CAM_F_PSORIGAREA

16 original_uncer number uncertainty of original peak area (counts)Canberra Parameter: CAM_F_PSORIGERR

17 count_sec number count rate (counts/second)Canberra Parameter: CAM_F_PSCTSS

18 count_sec_err number uncertainty of count rate (percent)Canberra Parameter: CAM_F_PSCERR

19 efficiency number efficiencyCanberra Parameter: CAM_F_PSEFF

20 eff_error number uncertainty of efficiencyCanberra Parameter: CAM_F_PSEFERR

21 back_channel number number of average background channelsCanberra Parameter: CAM_F_PSBKCHAN

22 ided number peak identification indicator; 1 = peak was associ-ated with a nuclide by the automated analysis, 0 = peak was not associated with a nuclide by the automated analysis (not updated by the ROI inter-face)Canberra Parameter: CAM_L_PSPKNOWN

23 fitted number peak fit indicatorCanberra Parameter: CAM_L_PSPPFIT

24 multiplet number multiplet peak indicatorCanberra Parameter: CAM_L_PSPMULT

25 lc number critical level for the peak (counts)

TABLE 180: GARDS_PEAKS (CONTINUED)

Column Storage Type Description

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

Keys: Primary: sample_id/peak_id Foreign: sample_id (gards_sample_data)

26 peak_sig number peak significance, peak area divided by Lc

27 peak_tol number per peak energy tolerance; approximates the energy tolerance at a given peak

28 pss number peak search significance parameter Canberra parameter: CAM_F_PSSIGNIF

TABLE 180: GARDS_PEAKS (CONTINUED)

Column Storage Type Description

507b e r 2 0 0 2

508

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ P E A K S _ O R I G

The gards_peaks_orig table contains information regarding peaks identified during auto-mated analysis.

TABLE 181: GARDS_PEAKS_ORIG

Column Storage Type Description

1 sample_id number sample identifier

2 peak_id number peak identifier

3 centroid number peak centroid (channels)Canberra Parameter: CAM_F_PSCENTRD

4 centroid_err number uncertainty of peak centroid (channels)Canberra Parameter: CAM_F_PSDCENTRD

5 energy number energy at peak centroid (keV)Canberra Parameter: CAM_F_PSENERGY

6 energy_err number uncertainty of energy (keV)Canberra Parameter: CAM_F_PSDENERGY

7 left_chan number left channel of peakCanberra Parameter: CAM_L_PSLEFT

8 width number width of peak (channels)Canberra Parameter: CAM_L_PSWIDTH

9 back_count number continuum background countsCanberra Parameter: CAM_F_PSBACKGND

10 back_uncer number uncertainty of continuum background countsCanberra Parameter: CAM_F_PSDBACK

11 fwhm number full width at half maximumCanberra Parameter: CAM_F_PSFWHM

12 fwhm_err number uncertainty of full width at half maximumCanberra Parameter: CAM_PSDFWHM

13 area number peak area (counts)Canberra Parameter: CAM_F_PSAREA

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

14 area_err number uncertainty of peak area (counts)Canberra Parameter: CAM_F_PSDAREA

15 original_area number original peak area (counts)Canberra Parameter: CAM_PSORIGAREA

16 original_uncer number uncertainty of original peak area (counts)Canberra Parameter: CAM_PSORIGERR

17 count_sec number count rate (counts/second)Canberra Parameter: CAM_F_PSCTSS

18 count_sec_err number uncertainty of count rate (percent)Canberra Parameter: CAM_PSCERR

19 efficiency number efficiencyCanberra Parameter: CAM_F_PSEFF

20 eff_error number uncertainty of efficiencyCanberra Parameter: CAM_F_PSEFERR

21 back_channel number number of average background channelsCanberra Parameter: CAM_L_PSBKCHAN

22 ided number peak identification indicator; 1 = peak was associated with a nuclide by the automated analysis, 0 = peak was not associated with a nuclide by the automated analysis (not updated by the ROI interface)Canberra Parameter: CAM_L_PSPKNOWN

23 fitted number peak fit indicatorCanberra Parameter: CAM_F_PSPPFIT

24 multiplet number multiplet peak indicatorCanberra Parameter: CAM_PSPMULT

25 lc number critical level for the peak (counts)

TABLE 181: GARDS_PEAKS_ORIG (CONTINUED)

Column Storage Type Description

509b e r 2 0 0 2

510

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

Keys: Primary: sample_id/peak_id Foreign: sample_id (gards_sample_data)

26 peak_sig number peak significance, peak area divided by Lc

27 peak_tol number per peak energy tolerance; approximates the energy tolerance at a given peak

28 pss number peak search significance parameter Canberra parameter: CAM_F_PSSIGNIF

TABLE 181: GARDS_PEAKS_ORIG (CONTINUED)

Column Storage Type Description

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ P E R M I S S I O N S

The gards_permissions table contains a list of permissions that can be manipulated by the MAR tool.

Keys: Primary: permission_id

TABLE 182: GARDS_PERMISSIONS

Column Storage Type Description

1 permission_id number unique permission identifier

2 permission_name varchar2(30) string name of a permission

3 db_name varchar2(35) name of corresponding role in the data-base

511b e r 2 0 0 2

512

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ P O C

The gards_poc table contains information for radionuclide monitoring system points of contact (POC).

Keys: Primary: pocid

TABLE 183: GARDS_POC

Column Storage Type Description

1 pocid number unique point of contact identifier

2 email_address varchar2(50) email address of point of contact

3 first_name varchar2(20) first name of point of contact

4 last_name varchar2(50) last name of point of contact

5 telephone varchar2(20) telephone number of point of contact

6 address varchar2(500) address of point of contact

7 additional_info varchar2(500) additional information for point of con-tact

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ P R O C _ P A R A M S _ T E M P L A T E

The gards_proc_params_template table is a template data record that contains parameters used by Automatic Analysis process software for peak search and nuclide identification. These parameters are used unless overridden at the command line.

TABLE 184: GARDS_PROC_PARAMS_TEMPLATE

Column Storage Type Description

1 station_id number station identifierCanberra Parameter: CAM_L_SSPI5

2 detector_id number detector identifier (relates to gards_detectors.detector_id)Canberra Parameter: CAM_L_SSPI6

3 sample_type varchar2(2) type of sampleCanberra Parameter: CAM_T_SSPRSTR1

4 data_type char(1) spectral data type

5 spectral_qualifier varchar2(5) indicator of full or preliminary sample

6 begin_date date initialization date of parameters

7 end_date date termination date of parameters

8 do_back number background subtraction indicatorCanberra Parameter: CAM_L_PRNOBACKCOR

9 back_data_type char(1) blank (B), or detector background (D) spectral type

10 nuclide_lib varchar2(96) nuclide library to be used during analysis

11 mda_level number MDA confidence factor (percent)Canberra Parameter: CAM_F_MDACONFID

12 nid_confid number NID confidence factor (percent)Canberra Parameter: CAM_F_CONFID

13 squant_err number error in sample quantityCanberra Parameter: CAM_F_SQUANTERR

513b e r 2 0 0 2

514

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

14 buildtype varchar2(8) flag for Canberra: activity (NONE), or concen-tration (BUILD), calculations

15 peak_sense number peak search sensitivityCanberra Parameter: CAM_F_SENSITIVITY

16 peak_start number peak search start (keV)Canberra Parameter: CAM_L_PEAKSTART

17 peak_end number peak search end (keV)Canberra Parameter: CAM_L_PEAKEND

18 fwhm_mult_width number number of FWHMs to search to determine mul-tipletsCanberra Parameter: CAM_F_PRFWHMPKMULT

19 left_fwhm_lim number left ROI FWHM limitCanberra Parameter: CAM_F_PRFWHMPKLEFT

20 right_fwhm_lim number right ROI FWHM limitCanberra Parameter: CAM_F_PRFWHMPKRIGHT

21 back_chan number number of continuous channelsCanberra Parameter: CAM_L_PRNBKCHN

22 back_type varchar2(6) background typeCanberra Parameter: CAM_T_ROIPSBTYP

23 fit_singlets number fit singlets flag, Canberra Parameter: CAM_L_PRFIT

24 crit_level number critical level test indicator, Canberra Parameter: CAM_L_CRITLEVEL

25 fix_fwhm number fixed FWHM during peak search flagCanberra Parameter: CAM_L_PRFIXFWHM

TABLE 184: GARDS_PROC_PARAMS_TEMPLATE (CONTINUED)

Column Storage Type Description

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

Keys: Primary: station_id/detector_id/data_typ/spectral_qualifier Foreign: station_id (gards_stations),

detector_id (gards_detectors)

26 area_reject number indicatior of whether or not to reject peaks with zero area indicatorCanberra Parameter: CAM_L_PRREJECTPEAKS

27 mdc_width number baseline width used for MDA calculationCanberra param: CAM_F_VPWIDTH

28 lc_abscissa number abscissas of the normal distribution correspond-ing to a confidence level; a value of 1.645 corre-sponds to a 95% confidence interval for the peak critical level

29 do_pd_calc number flag indicates if the parent/daughter calculations should be run; 1 = run calculations, 0 = do not run calculations

30 do_csc number flag to turn off cascade summing correction

TABLE 184: GARDS_PROC_PARAMS_TEMPLATE (CONTINUED)

Column Storage Type Description

515b e r 2 0 0 2

516

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ P R O C E S S I N G _ E R R O R S

The gards_processing_errors table contains sample information, if applicable, and mes-sage information for RMS messages that have failed processing.

Keys: Primary: none

TABLE 185: GARDS_PROCESSING_ERRORS

Column Storage Type Description

1 rms_id number sequence number of associated data type (e.g., RMSSOH, SAMPLEPHD, etc.). If SAMPLEPHD, the sequence refers to a sample_id; if RMSSOH, the RMS ID refers to an soh_id.

2 sample_ref_id varchar2(32) sample reference identification

3 msg_id number message identifier

4 filename varchar2(512) import message filename

5 station_code varchar2(5) station code parsed from import message

6 detector_code varchar2(9) detector code parsed from import message

7 data_type varchar2(12) data type parsed from message header (e.g., RMSSOH, MET, SAMPLEPHD, etc.)

8 error_text varchar2(2048) text associated with the error

9 entry_date date date and time of error entry

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ Q A T _ C O N F I G

The gards_qat_config table contains q_time and t_time used by rms_QAT_auto; there is only

one record in the database.

Keys: Primary: none

TABLE 186: GARDS_QAT_CONFIG

Column Storage Type Description

1 t_time number number of minutes after gards_sample_status.entry_date that rms_QAT_auto waits before releasing a sample

2 min_t_time number minimum allowable value for t_time

3 max_t_time number maximum allowable value for t_time

4 q_time number number of minutes after gards_sample_status.review_date that rms_QAT_auto waits before releasing a sample

5 poll_time number number of minutes rms_QAT sleeps between each database poll

6 moddate date date of last modification

517b e r 2 0 0 2

518

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ Q AT _ N O T I F Y

The gards_qat_notify table contains comments created by rms_QAT.

Keys: Primary: sample_id

TABLE 187: GARDS_QAT_NOTIFY

Column Storage Type Description

1 sample_id number foriegn key

2 comment_text varchar2(2048) text of the comment

3 comment_type number foriegn key to gards_comments_defs

4 nucl_name varchar2(8) nuclide name referenced by comment

5 energy number energy (keV) referenced by comment

6 dtg date date comment was entered

7 author varchar2(30) user name of Radionuclide Officer

8 recipient_list varchar2(128) comma-separated list of users to whom the notification was sent

9 moddate date date of last modification

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ Q A T _ Q U E R Y _ F I L T E R

The gards_qat_query_filter table contains each user’s default query in rms_QAT.

Keys: Primary: user_id Foreign: min_sample_id, max_sample_id

TABLE 188: GARDS_QAT_QUERY_FILTER

Column Storage Type Description

1 user_id number foreign key to gards_users

2 min_sample_id number foreign key

3 max_sample_id number foreign key

4 sample_status varchar2(128) comma-separated list of sample status values

5 station_list varchar2(1024) comma-separated list of stations

6 include_stations number flag to include or exclude stations

7 category_list varchar2(32) comma-separated list of categories

8 use_review_cat number flag for reviewed or auto categorization.

519b e r 2 0 0 2

520

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ Q C H I S T O R Y

The gards_qchistory table contains output messages from quality control tests for each sample.

Keys: Primary: sample_id/state Foreign: sample_id (gards_sample_data),

station_id (gards_stations), detector_id (gards_detectors)

TABLE 189: GARDS_QCHISTORY

Column Storage Type Description

1 station_id number station identifier

2 detector_id number detector identifier

3 sample_id number sample identifier

4 state varchar2(128) text results of quality control hypothesis tests

5 lddate date date of quality control processing

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ Q C P A R A M S

The gards_qcparams table contains parameters for quality control processes.

Keys: Primary: detector_id Foreign: detector_id (gards_detectors)

TABLE 190: GARDS_QCPARAMS

Column Storage Type Description

1 detector_id number detector identifier

2 gainchange number gain first difference tolerance

3 sdmult number location test standard deviation multi-plier

4 width_adj number peak width standard deviation inflation factor

5 area_adj number peak area standard deviation inflation factor

6 etol number energy tolerance used to match peaks with energies (keV)

521b e r 2 0 0 2

522

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ Q C T A R G E T S

The gards_qctargets table contains detector-specific target values for the quality control width and area tests.

Keys: Primary: name/detector_id/station_id/energy Foreign station_id (gards_stations)

detector_id (gards_detectors)

TABLE 191: GARDS_QCTARGETS

Column Storage Type Description

1 station_id number station identifier

2 detector_id number detector identifier

3 dtg date decay correction reference date

4 name varchar2(8) nuclide name

5 energy number nuclide line energy (keV)

6 muwidth number target width for each nuclide line energy (keV)

7 muarea number target area for each nuclide line energy (counts)

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ Q U E R Y _ R E S U L T S

The gards_query_results table contains output of a user-initiated query from the event screening tool. This table is purged at the end of the request.

Keys: Primary: rqst_id

TABLE 192: GARDS_QUERY_RESULTS

Column Storage Type Description

1 rqst_id number unique query identifier

2 rqst_string varchar2(100) output of the user query

523b e r 2 0 0 2

524

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ R E A D _ S A M P L E _ S T A T U S

In both the AUTO and MAN schemas, the gards_read_sample_status table is a synonym for the MAN schema table gards_sample_status. This synonym allows rms_categorize to read gards_sample_status regardless of how it was started.

Keys: Primary: sample_id Foreign: sample_id (gards_sample_data)

TABLE 193: GARDS_READ_SAMPLE_STATUS

Column Storage Type Description

1 sample_id number sample identifier

2 entry_date date date sample was entered into database

3 cnf_begin_date date date when last analysis began

4 cnf_end_date date date when last analysis ended

5 review_date date date sample was last reviewed

6 review_time number amount of time to review sample (min-utes)(no longer automatically updated)

7 analyst varchar2(30) name of analyst who reviewed sample

8 status char(1) current processing status of sample. Some possible values are: A- analyzed, P- processed, R- reviewed, U- unproc-essed, V- viewed

9 category number sample categorization level after interac-tive analysis

10 auto_category number sample categorization level after auto-mated analysis

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ R E C E I P T _ L O G

The gards_receipt_log table is used by the gards_receipts utility.

Keys: Primary: prodid Foreign: pocid (gards_poc)

TABLE 194: GARDS_RECEIPT_LOG

Column Storage Type Description

1 pocid number poc identifier

2 subid number not used

3 prodid number not used

4 type varchar2(5) type of data

5 dtg date date sent

6 kb_sent number size of data (KB)

525b e r 2 0 0 2

526

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ R E F L I N E _ M A S T E R

The gards_refline_master table contains resolution calibration pairs information associ-ated with spectral pulse height data (PHD).

Keys: Primary: rfpeak_energy/data_type/spectral_qualifier

TABLE 195: GARDS_REFLINE_MASTER

Column Storage Type Description

1 refpeak_energy number known reference energy for a nuclide

2 data_type char(1) indicator of the type of sample. An uncontaminated crushed filter (‘B’), cali-bration background (‘C’), detector back-ground (‘D’), quality control (‘Q’), or an actual sample (‘S’)

3 spectral_qualifier varchar2(5) time for which the sample was exposed, ‘FULL’ or ‘PREL’ (preliminary)

4 calibration_type varchar2(3) type of calibration, ‘CAL’, ‘MIX’, or ‘---’

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ R E L E V A N T _ N U C L I D E S

The gards_relevant_nuclides table contains the list of nuclides determined to be relevant during the identification of radionuclide events. This table includes the categorization list for particulate samples (CLPS) and the relevant radioxenon isotopes.

Keys: Primary: name/sample_type

TABLE 196: GARDS_RELEVANT_NUCLIDES

Column Storage Type Description

1 name varchar2(8) name of the nuclide

2 type varchar2(16) nuclide type (choices are: ACTIVATION, COSMIC, FISSION(G), FISSION(P), or NATURAL)

3 sample_type char(1) sample type (P, G, or B)

527b e r 2 0 0 2

528

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ R E S O L U T I O N _ C A L

The gards_resolution_cal table contains resolution calibration coefficients calculated dur-ing analysis.

Keys: Primary: sample_id Foreign: sample_id (gards_sample_data)

TABLE 197: GARDS_RESOLUTION_CAL

Column Storage Type Description

1 sample_id number sample identifier

2 coeff1 number first order calibration coefficient

3 coeff2 number second order calibration coefficient

4 coeff3 number third order calibration coefficient

5 coeff4 number fourth order calibration coefficient

6 coeff5 number fifth order calibration coefficient

7 coeff6 number sixth order calibration coefficient

8 coeff7 number seventh order calibration coefficient

9 coeff8 number eighth order calibration coefficient

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ R E S O L U T I O N _ C A L _ O R I G

The gards_resolution_cal_orig table contains the original resolution calibration coeffi-cients calculated during analysis.

Keys: Primary: sample_id Foreign: sample_id (gards_sample_data)

TABLE 198: GARDS_RESOLUTION_CAL_ORIG

Column Storage Type Description

1 sample_id number sample identifier

2 coeff1 number first order calibration coefficient

3 coeff2 number second order calibration coefficient

4 coeff3 number third order calibration coefficient

5 coeff4 number fourth order calibration coefficient

6 coeff5 number fifth order calibration coefficient

7 coeff6 number sixth order calibration coefficient

8 coeff7 number seventh order calibration coefficient

9 coeff8 number eighth order calibration coefficient

529b e r 2 0 0 2

530

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ R E S O L U T I O N _ P A I R S

The gards_resolution_pairs table contains resolution calibration pairs information associ-ated with spectral PHD.

Keys: Primary: sample_id/res_energy Foreign: sample_id (gards_sample_data)

TABLE 199: GARDS_RESOLUTION_PAIRS

Column Storage Type Description

1 sample_id number sample identifier

2 res_energy number resolution energy (keV)

3 resolution number resolution (keV)

4 res_error number error in resolution (keV)

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ R E S O L U T I O N _ P A I R S _ O R I G

The gards_resolution_pairs_orig table contains the original resolution calibration pairs information associated with spectral PHD.

Keys: Primary: sample_id/res_energy Foreign: sample_id (gards_sample_data)

TABLE 200: GARDS_RESOLUTION_PAIRS_ORIG

Column Storage Type Description

1 sample_id number sample identifier

2 res_energy number resolution energy (keV)

3 resolution number resolution (keV)

4 res_error number error in resolution (keV)

531b e r 2 0 0 2

532

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ R L R

The gards_rlr table contains all data related to a Radionuclide Laboratory Report (RLR) message.

Keys: Primary: rlr_id Foreign: rlr_id (gards_data_log.rmsid)

station_id (gards_stations) detector_id (gards_detectors)

TABLE 201: GARDS_RLR

Column Storage Type Description

1 rlr_id number unique RLR identifier

2 station_id number station identifier

3 detector_id number detector identifier

4 ref_id varchar2(32) sample reference identification

5 collect_start number sample collection start date

6 collect_stop date sample collection stop date

7 arrival_date date sample arrival date

8 test_date date test completion date at lab

9 transmit_date date transmit date

10 filename varchar2(256) name of file containing the RLR

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ R O I _ C H A N N E L S

The gards_roi_channels table contains the ROI boundaries in channel units that are cal-culated in rms_xanalyze.

Keys: Primary: sample_id/roi Foreign: sample_id (gards_sample_data)

roi (gards_roi_lib)

TABLE 202: GARDS_ROI_CHANNELS

Column Storage Type Description

1 sample_id number sample identifier

2 roi number ROI identifier

3 b_chan_start number beta boundary start channel

4 b_chan_stop number beta boundary stop channel

5 g_chan_start number gamma boundary start channel

6 g_chan_stop number gamma boundary stop channel

533b e r 2 0 0 2

534

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ R O I _ C O N C S

The gards_roi_concs table contains information regarding the concentration of each iden-tified nuclide that is calculated in rms_xanalyze.

Keys: Primary: sample_id/roi Foreign: sample_id (gards_sample_data)

roi (gards_roi_lib)

TABLE 203: GARDS_ROI_CONCS

Column Storage Type Description

1 sample_id number sample identifier

2 roi number ROI identifier

3 activity number activity per unit volume air (µBq/m3)

4 activ_err number uncertainty of activity (µBq/m3)

5 mda number minimum detectable activity (µBq/m3)

6 nid_flag number nuclide identification indicator (0 = nuclide was not identified by automated analysis; 1 = nuclide was identified by automated analysis; -1 = nuclide was identified initially by automated analysis but later rejected because the concentra-tion was <0.0; 2 = nuclide was identified by automated analysis but was removed by the analyst through the Inspectra)

7 report_mda number indicator of whether MDA is to be reported

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ R O I _ C O U N T S

The gards_roi_counts table contains information regarding the counts that are calculated in rms_xanalyze for each ROI.

Keys: Primary: sample_id/roi Foreign: sample_id (gards_sample_data)

roi (gards_roi_lib)

TABLE 204: GARDS_ROI_COUNTS

Column Storage Type Description

1 sample_id number sample identifier

2 roi number ROI identifier

3 gross number counts in ROI before processing

4 gross_err number uncertainty of gross (counts)

5 compton number compton continuum background counts

6 compton_err number uncertainty of compton (counts)

7 interference number counts from interference nuclides

8 interference_err number uncertainty of interference (counts)

9 memory number gas background counts

10 memory_err number uncertainty of memory (counts)

11 detector_back number detector background counts

12 detector_back_err number uncertainty of detector_back (counts)

13 net number counts in ROI after processing

14 net_err number uncertainty of net (counts)

15 lc number critical level (counts)

535b e r 2 0 0 2

536

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ R O I _ L I B

The gards_roi_lib table relates each ROI to a specific nuclide. The table also contains nuclide properties used in nuclide quantification.

Keys: Primary: roi Foreign: sample_id (gards_sample_data)

roi (gards_roi_lib)

TABLE 205: GARDS_ROI_LIB

Column Storage Type Description

1 roi number unique ROI identifier

2 name varchar2(8) nuclide associated with ROI

3 halflife varchar2(23) half-life of the nuclide

4 halflife_err varchar2(23) uncertainty of halflife

5 halflife_sec number numerical half-life in seconds

6 abundance number intensity of β-γ coincidence event

7 abundance_err number uncertainty of abundance

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ R O I _ L I M I T S

The gards_roi_limits table contains the ROI boundaries in energy units as specified in the PHD file.

Keys: Primary: sample_id/roi Foreign: sample_id (gards_sample_data)

roi (gards_roi_lib)

TABLE 206: GARDS_ROI_LIMITS

Column Storage Type Description

1 sample_id number sample identifier

2 roi number ROI identifier

3 b_energy_start number beta boundary start energy (keV)

4 b_energy_stop number beta boundary stop energy (keV)

5 g_energy_start number gamma boundary start energy (keV)

6 g_energy_stop number gamma boundary stop energy (keV)

537b e r 2 0 0 2

538

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ R O L E S

The gards_roles table contains the list of roles that can be manipulated by the MAR tools.

Keys: Primary: role_id

TABLE 207: GARDS_ROLES

Column Storage Type Description

1 role_id number unique role identifier

2 role_name varchar2(30) string name of a role

3 db_name varchar2(35) name of corresponding database role

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ R O L E S _ P E R M I S S I O N S

The gards_roles_permissions table contains a mapping of which permissions are assigned to which roles.

Keys: Primary: role_id/permission_id Foreign: role_id (gards_roles)

permission_id (gards_permissions)

TABLE 208: GARDS_ROLES_PERMISSIONS

Column Storage Type Description

1 role_id number role identifier

2 permission_id number permission identifier

539b e r 2 0 0 2

540

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ S A M P L E _ A U X

The gards_sample_aux table contains auxiliary information related to raw sample data.

Keys: Primary: sample_id Foreign: sample_id (gards_sample_data)

message_id (gards_data_log)

TABLE 209: GARDS_SAMPLE_AUX

Column Storage Type Description

1 sample_id number sample identifier

2 sample_ref_id varchar2(32) sample reference identification

3 measurement_id varchar2(31) unique detection identifier

4 bkgd_measurement_id varchar2(31) unique background identifier corre-sponding to detection identifier

5 sample_height number height of sample (cm)

6 calibration_dtg date date of most recent calibration at detec-tor site

7 msg_id number message identifier

8 archive_bottle_id char(2) unique identifier of the archive bottle in which the sample is stored

9 gas_bkgd_measurement_id varchar2(31) unique measurement id (MID) of the gas background acquisition associated with the sample

10 xe_collect_yield number Xe collection yield of the system (vol-ume of stable Xe on detector/volume of stable Xe collected on first trap)

11 xe_collect_yield_err number uncertainty of xe_collect_yield

12 xe_volume number volume of stable Xe in gas cell counter (cm3)

13 xe_volume_err number uncertainty of xe_volume in cm3

14 sample_diameter number diameter of gas chamber (cm)

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ S A M P L E _ C A T

The gards_sample_cat table contains the most recent categorization values from either automatic or manual processing.

Keys: Primary: sample_id, name Foreign: name (gards_nucl_lib)

TABLE 210: GARDS_SAMPLE_CAT

Column Storage Type Description

1 sample_id number sample identifier

2 name varchar2(8) nuclide name

3 method_id number method identifier

4 category number categorization level

5 upper_bound number upper limit of the amount of a nuclide that can be acceptably found

6 lower_bound number lower limit of the amount of a nuclide that can be acceptably found

7 central_value number current estimate of the level of the random pro-cess

8 delta number value of a variable used in bounds estimation (EWMA algorithm)

9 activity number relates to gards_nucl_ided.activ_key

10 hold number flag that hold categorization bounds fixed and does not update values (0 = proceed, 1 = wait)

541b e r 2 0 0 2

542

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ S A M P L E _ C E R T

The gards_sample_cert table contains overview information regarding certificate data found in pulse height data messages.

Keys: Primary: sample_id Foreign: sample_id (gards_sample_data)

TABLE 211: GARDS_SAMPLE_CERT

Column Storage Type Description

1 sample_id number sample identifier

2 quantity number quantity associated with certificate

3 assay_date date date sample was assayed

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ S A M P L E _ C E R T _ L I N E S

The gards_sample_cert_lines table contains nuclide information regarding certificate data found in pulse height data messages.

Keys: Primary: sample_id/nucl_name/energy Foreign: sample_id (gards_sample_data)

TABLE 212: GARDS_SAMPLE_CERT_LINES

Column Storage Type Description

1 sample_id number sample identifier (relates to gards_sample_data.sample_id)

2 nucl_name varchar2(8) nuclide name

3 halflife varchar2(23) half-life of nuclide

4 energy number energy of nuclide

5 activity number activity of nuclide at time of assay

6 error number percent error in activity

7 abundance number percent abundance

8 b_abundance number intensity of beta particle or conversion electron (particles/decay)

9 b_energy number energy of conversion electron or maxi-mum energy of beta particle (keV)

10 decay_mode char(1) type of decay; B = beta particle, C = con-version electron

543b e r 2 0 0 2

544

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ S A M P L E _ D A T A

The gards_sample_data table contains header data from PHD messages.

TABLE 213: GARDS_SAMPLE_DATA

Column Storage Type Description

1 site_det_code char(15) station code concatenated with detector code

2 sample_id number unique sample identifier

3 station_id number station identifier

4 detector_id number detector identifier

5 input_file_name varchar2(256) input data filename

6 sample_type char(1) sample type (P, G, or B)

7 data_type char(1) type of sample; an uncontaminated crushed blank filter (B), calibration background (C), detector background (D), quality control (Q), or an actual sample (S).

8 geometry varchar2(17) sample geometryCanberra param: CAM_T_GEOMETRY

9 spectral_qualifier varchar2(5) time for which the sample was exposed: FULL or PREL (preliminary)

10 transmit_dtg date transmit date time group

11 collect_start date collection start timeCanberra param: CAM_X_SDEPOSIT

12 collect_stop date collection stop timeCanberra param: CAM_X_STIME

13 acquisition_start date acquisition start time

14 acquisition_stop date acquisition stop time

15 acquisition_real_sec number difference between acquisition stop and acqui-sition start (seconds)

16 acquisition_live_sec number active detection time (seconds)

17 quantity number air volume sampled (m3)

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

Keys: Primary: sample_id Foreign: detector_id (gards_detectors)

station_id (gards_stations) sample_id (gards_data_log.rms_id)

545b e r 2 0 0 2

546

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ S A M P L E _ D E S C R I P T I O N

The gards_sample_description table contains description and comment text as specified in a PHD file.

Keys: Primary: sample_id Foreign: sample_id (gards_sample_data)

TABLE 214: GARDS_SAMPLE_DESCRIPTION

Column Storage Type Description

1 sample_id number sample identifier

2 description varchar2(512) comments

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ S A M P L E _ F L A G S

The gards_sample_flags table contains the results of the rms_DBflags analysis for each sample.

Keys: Primary: sample_id/flag_id Foreign: sample_id (gards_sample_data)

flag_id (gards_flags)

TABLE 215: GARDS_SAMPLE_FLAGS

Column Storage Type Description

1 sample_id number sample identifier

2 flag_id number flag identifier

3 result number indicator of whether or not the test passed

4 value number threshold value used for the test

547b e r 2 0 0 2

548

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ S A M P L E _ P R O C _ P A R A M S

The gards_sample_proc_params table contains specific processing parameters to be used for a particular spectral analysis; the table contains a combination of values from gards_proc_params_template and values entered at the command line.

TABLE 216: GARDS_SAMPLE_PROC_PARAMS

Column Storage Type Description

1 sample_id number sample identifier

2 do_back number background subtraction indicatorCanberra Parameter: CAM_L_PRNOBACKCOR

3 back_data_type char(1) data type used for background subtraction; blank (B), or detector background (D)

4 back_sample_id number sample identifier for sample used in background subtraction

5 nuclide_lib varchar2(96) nuclide library to be used during analysisCanberra Parameter: CAM_T_EXPLIB

6 energy_tol number tolerence for nuclide identificationCanberra Parameter: CAM_F_TOLERANCE

7 mda_level number MDA confidence factorCanberra Parameter: CAM_F_MDACONFID

8 nid_confid number NID confidence factorCanberra Parameter: CAM_F_CONFID

9 squant_err number uncertainty of sample quantity (m3)Canberra param: CAM_F_SQUANTERR(No longer used in processing)

10 buildtype varchar2(8) flag for Canberra: activity (NONE), or concen-tration (BUILD), calculations

11 peak_sense number peak search sensitivityCanberra param: CAM_F_SENSITIVITY

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

12 peak_start number peak search start (keV)Canberra param: CAM_L_PEAKSTART

13 peak_end number peak search end (keV)Canberra param: CAM_L_PEAKEND

14 fwhm_mult_width number number of FWHMs to search to determine mul-tipletsCanberra param: CAM_F_PRFWHMPKMULT

15 left_fwhm_lim number left ROI FWHM limitCanberra param: CAM_F_PRFWHMPKLEFT

16 right_fwhm_lim number right ROI FWHM limitCanberra param: CAM_F_PRFWHMPKRIGHT

17 back_chan number number of continuous channelsCanberra param: CAM_L_PRNBKCHN

18 back_type varchar2(6) background type: LINEAR or STEPCanberra param: CAM_T_ROIPSBTYP

19 fit_singlets number fit singlets flagCanberra param: CAM_L_PRFIT

20 crit_level number critical level test indicatorCanberra param: CAM_L_CRITLEVEL

21 fix_fwhm number fixed FWHM during peak search flagCanberra param: CAM_L_PRFIXFWHM

22 area_reject number reject peaks with zero area indicatorCanberra param: CAM_L_PRREJECTPEAKS

23 do_csc number flag indicating if cascade summing was turned on/off during analysis

TABLE 216: GARDS_SAMPLE_PROC_PARAMS (CONTINUED)

Column Storage Type Description

549b e r 2 0 0 2

550

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

Keys: Primary: sample_id Foreign: sample_id (gards_sample_data)

24 mdc_width number baseline width used for MDA calculationCanberra param: CAM_F_VPWIDTH

25 lc_abscissa number abscissas of the normal distribution correspond-ing to a confidence level; a value of 1.645 corre-sponds to a 95% confidence interval for the peak critical level

26 do_pd_calc number flag that indicates if the parent/daughter calcula-tions were run for a particular sample; 1 = cal-culations were run, 0 = calculations were not run

TABLE 216: GARDS_SAMPLE_PROC_PARAMS (CONTINUED)

Column Storage Type Description

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ S A M P L E _ R A T I O S

The gards_sample_ratios table contains the amount of overlap between each ROI as specified in the PHD file.

Keys: Primary: sample_id/ratio_id Foreign: sample_id (gards_sample_data)

TABLE 217: GARDS_SAMPLE_RATIOS

Column Storage Type Description

1 sample_id number sample identifier

2 ratio_id varchar2(15) ratio identifier

3 upper_roi_number number ROI number associated with the upper ROI

4 lower_roi_number number ROI number associated with the lower ROI

5 count_ratio number ratio of the upper ROI counts to lower ROI counts

6 count_ratio_err number uncertainty of count_ratio

551b e r 2 0 0 2

552

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ S A M P L E _ S T A T U S

The gards_sample_status table contains spectral processing historical data.

Keys: Primary: sample_id Foreign: sample_id (gards_sample_data)

TABLE 218: GARDS_SAMPLE_STATUS

Column Storage Type Description

1 sample_id number sample identifier

2 entry_date date date sample was entered into database

3 cnf_begin_date date date when last analysis began

4 cnf_end_date date date when last analysis ended

5 review_date date date sample was last reviewed

6 review_time number amount of time to review sample (min-utes)(no longer automatically updated)

7 analyst varchar2(30) name of analyst who reviewed sample

8 status char(1) current processing status of sample. Some possible values are: A- analyzed, P- processed, R- reviewed, U- unproc-essed, V- viewed

9 category number sample categorization level after interac-tive analysis

10 auto_category number sample categorization level after auto-mated analysis

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ S A M P L E _ U P D A T E _ P A R A M S

The gards_sample_update_params table holds the actual parameters used for energy cali-bration updating during analysis. This table may contain a combination of defaults from gards_update_params_template and values from the command line.

Keys: Primary: sample_id Foreign: sample_id (gards_sample_data)

mrp_sample_id (gards_sample_data)

TABLE 219: GARDS_SAMPLE_UPDATE_PARAMS

Column Storage Type Description

1 sample_id number sample identifier

2 mrp_used number indicator of whether or not the Most Recent Prior (MRP) sample should be used

3 mrp_sample_id number the sample_id of the MRP sample to be used

4 gainshift number gain change for matching, percent (typically 0.1)

5 zeroshift number zero change for matching, channels (typically 1)

6 area_lim number minimum peak area for inclusion in matching (counts)

7 use_weight number 0/1 flag for use of weights in ECR updating (typically 1)

8 use_mult number 0/1 flag for use of multiplets in ECR updating (typically 1)

9 f_linear number 0/1 flag for forcing ECR to be first-order (typically 0)

10 bootstrap number 0/1 flag for ignoring prior ECR/ resolution versus energy regression (RER) (typically 0)

11 min_lookup number minimum library lookup tolerance, keV (typically 0.2)

12 rer_intercept number default RER intercept (typically 1.2)

13 rer_slope number default RER coeff (typically 0.03)

14 ecr_slope number default ECR slope

15 do_reru number flag that indicates if a resolution update was performed

16 rer_mrp_used number indicates what RER was chosen during analysis

553b e r 2 0 0 2

554

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ S A M P L E _ X E _ P R O C _ P A R A M S

The gards_sample_xe_proc_params table contains specific processing parameters to be used for a particular spectral analysis.

Keys: Primary: sample_id/roi Foreign: sample_id (gards_sample_data),

roi (gards_roi_lib)

TABLE 220: GARDS_SAMPLE_XE_PROC_PARAMS

Column Storage Type Description

1 sample_id number sample identifier

2 roi number ROI identifier

3 lc_abscissa number abscissa of the normal distribution corre-sponding to a confidence level

4 beta_ecr_order number determines whether the beta ECR is lin-ear, quadratic, or manually defined

5 gamma_ecr_order number determines whether the gamma ECR is linear, quadratic, or manually defined

6 compton number number of compton channels

7 det_back_used number determines whether the detector back-ground is in use or not (1 = YES, 0 = NO)

8 gas_back_used number determines whether the gas background is in use or not (1 = YES, 0 = NO)

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ S O H _ C H A R _ D A T A

The gards_soh_char_data table contains all state of health (SOH) character data.

Keys: Primary: station_id/detector_id/param_code/dtg_begin/dtg_end

TABLE 221: GARDS_SOH_CHAR_DATA

Column Storage Type Description

1 station_id number station identifier

2 detector_id number detector identifier

3 param_code number parameter identifier

4 value varchar2(30) value of specified parameter

5 dtg_begin date begin date

6 dtg_end date end date

555b e r 2 0 0 2

556

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ S O H _ C O D E

The gards_soh_code table contains all state of health (SOH) parameter names and their codes.

Keys: Primary: param_code

TABLE 222: GARDS_SOH_CODE

Column Storage Type Description

1 param varchar2(30) SOH parameter name

2 param_code number SOH parameter code

3 param_display varchar2(30) text of the parameter to be displayed in Trendvue

4 param_display_flag number 1 or 0; if 1, then this parameter will appear in Trendvue’s menu; if 0, then it will not be displayed in Trendvue’s menu

5 display_station number 1 or 0; if 1, then the parameter is associ-ated with a station and Trendvue will allow users to query by station; if it is 0, then this parameter is detector only and no stations will appear in the Trendvue dialog box

6 display_detector number 1 or 0; if 1, then the parameter is associ-ated with a detector and Trendvue will allow users to query by detector; if it is 0, then this parameter is station only and no detectors will appear in the Trendvue dialog box

7 unit varchar2(32) unit that the parameter is stored in

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ S O H _ H E A D E R

The gards_soh_header table contains the header information for all SOH messages.

Keys: Primary: soh_id Foreign: soh_id (gards_data_log.rms_id)

TABLE 223: GARDS_SOH_HEADER

Column Storage Type Description

1 soh_id number state of health identifier

2 station_id number station identifier

3 detector_id number detector identifier

4 dtg_begin date period begin time

5 dtg_end date period end time

6 transmit_dtg date transmit date time group

557b e r 2 0 0 2

558

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ S O H _ N U M _ D A T A

The gards_soh_num_data table contains all state of health (SOH) numerical data

Keys: Primary: station_id/detector_id/param_code/dtg_begin/dtg_end

TABLE 224: GARDS_SOH_NUM_DATA

Column Storage Type Description

1 station_id number station identifier

2 detector_id number detector identifier

3 param varchar2(30) SOH parameter name

4 param_code number SOH parameter code

5 value number value of specified parameter

6 dtg_begin date begin date

7 dtg_end date end date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ S O H _ S E N S O R _ D A T A

The gards_soh_sensor_data table contains the data reported in the #ProcessSensors data block in noble gas RMSSOH messages.

Keys: Primary: station_id/detector_id/sensor_type

TABLE 225: GARDS_SOH_SENSOR_DATA

Column Storage Type Description

1 station_id number station identifier

2 detector_id number detector identifier

3 sensor_type varchar2(20) type of sensor (TEMP, PRESSURE, PROCESSFLOW, VOLTAGE, COUN-TRATES, DEWPOINT, CO2VOLUME)

4 sensor_name varchar2(20) unique sensor name to distinguish between sensors of the same type

5 value number sensor reading

6 dtg_begin date initial date of sensor reading

7 dtg_end date end date of sensor reading

559b e r 2 0 0 2

560

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ S P E C T R U M

The gards_spectrum table contains information regarding the spectral data information reported in the PHD file.

Keys: Primary: sample_id/sample_type Foreign: sample_id (gards_sample_data)

TABLE 226: GARDS_SPECTRUM

Column Storage Type Description

1 sample_id number sample identifier

2 sample_type char(1) sample type (P, G, or B)

3 filename varchar2(256) name of file containing spectrum data

4 channels number number of channels in spectrum

5 energy_span number total energy span of detector (keV)

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ S T A D E T

The gards_stadet table contains a complete list of all station/detector identifier code combinations. The entries in this table are generated via a trigger on the gards_sample_data table.

Keys: Primary: detector_id/station_id Foreign: detector_id (gards_detectors),

station_id (gards_stations)

TABLE 227: GARDS_STADET

Column Storage Type Description

1 station_id number station identifier

2 detector_id number detector identifier

561b e r 2 0 0 2

562

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ S T A T I O N _ A S S I G N M E N T S

The gards_station_assignments table contains a mapping of which stations are assigned to which users.

Keys: Primary: station_id Foreign: station_id (gards_stations),

user_id (gards_users)

TABLE 228: GARDS_STATION_ASSIGNMENTS

Column Storage Type Description

1 station_id number station identifier

2 user_id number user identifier

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ S T A T I O N S

The gards_stations table contains a station overview and station characteristics.

Keys: Primary: station_id Foreign: pocid (gards_poc)

TABLE 229: GARDS_STATIONS

Column Storage Type Description

1 station_id number unique station identifier

2 station_code varchar2(5) station code

3 country_code varchar2(2) country code of site

4 type varchar2(6) station type

5 description varchar2(40) description of station

6 lat number latitude (degrees)

7 lon number longitude (degrees)

8 elevation number elevation (m)

9 date_begin date station initialization date

10 date_end date station decommissioning date

11 status varchar2(2) status of station, if NULL then station is fully operational otherwise the status is I

12 pocid number point of contact identifier

563b e r 2 0 0 2

564

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ S T A T I O N S _ S C H E D U L E

The gards_stations_schedule table contains schedule descriptions for stations reporting to a data center.

Keys: Primary: station_id/end_date Foreign: station_id (gards_stations)

TABLE 230: GARDS_STATIONS_SCHEDULE

Column Storage Type Description

1 station_id number station identifier

2 begin_date date initial date of schedule

3 end_date date final date of schedule

4 code char(5) code symbol SCHEDULE as found in the gards_codes table. SF_GP for full sample grace period or SPHDF for full sample PHD

5 temporal_value number expected station schedule period

6 temporal_unit char(5) units for schedule period – currently only the value DAYS is supported

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ S T A T U S _ H I S T O R Y

The gards_status_history table contains a list of changes in gards_sample_stations.statusfor reviewed samples.

Keys: Foreign: sample_id

TABLE 231: GARDS_STATUS_HISTORY

Column Storage Type Description

1 sample_id number foriegn key

2 user varchar2(30) user of program making status change

3 old_status char(1) sample_status before change

4 new_status char(1) sample_status after change

5 dtg date date of change

6 moddate date date of last modification

565b e r 2 0 0 2

566

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ T O T A L _ E F F I C

The gards_total_effic table contains detector total efficiency data as specified in the PHD file.

Keys: Primary: sample_id/effic_energy Foreign: sample_id (gards_sample_data)

TABLE 232: GARDS_TOTAL_EFFIC

Column Storage Type Description

1 sample_id number sample identifier

2 effic_energy number efficiency energy (keV)

3 efficiency number efficiency

4 effic_error number uncertainty of efficiency

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ T R E N D V U E

The gards_trendvue table contains data produced by the Trendvue application and is purged at the end of each session.

Keys: Primary: session_id

TABLE 233: GARDS_TRENDVUE

Column Storage Type Description

1 session_id number unique session identifier

2 date_value date date of the Trendvue plot

3 num_value1 number first plot value

4 num_value2 number second plot value

5 num_value3 number third plot value

6 num_value4 number fourth plot value

567b e r 2 0 0 2

G A R D S _ U P D A T E _ P A R A M S _ T E M P L A T E

The gards_update_params_template table holds the default parameters used for energy calibration updating during analysis; these values can be overridden at the command line.

Keys: Primary: detector_id Foreign: detector_id (gards_detectors)

TABLE 234: GARDS_UPDATE_PARAMS_TEMPLATE

Column Storage Type Description

1 detector_id number detector identifier

2 gainshift number gain change for matching, percent (typi-cally 0.1)

3 zeroshift number zero change for matching, channels (typ-ically 1)

4 area_lim number minimum peak area for inclusion in matching (counts)

5 use_weight number 0/1 flag for use of weights in ECR updating (typically 1)

6 use_mult number 0/1 flag for use of multiplets in ECR updating (typically 1)

7 f_linear number 0/1 flag for forcing ECR to be first-order (typically 0)

8 bootstrap number 0/1 flag for ignoring prior ECR/RER (typically 0)

9 min_lookup number minimum library lookup tolerance, keV (typically 0.2)

10 rer_intercept number default RER intercept (typically 1.2)

11 rer_slope number default RER slope (typically 0.03)

12 do_reru number 0/1 flag that indicates whether or not a resolution update should be performed

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ U P D A T E _ R E F L I N E S

The gards_update_reflines table contains the energies of the reference lines used in the ECR/RER updating functions.

Keys: Primary: station_id/detector_id/refpeak_energy Foreign: station_id (gards_stations),

detector_id (gards_detectors)

TABLE 235: GARDS_UPDATE_REFLINES

Column Storage Type Description

1 station_id number station identifier

2 detector_id number detector identifier

3 refpeak_energy number known reference energy for a nuclide

4 data_type char(1) type of sample; an uncontaminated crushed blank filter (B), calibration background (C), detector background (D), quality control (Q), or an actual sample (S)

5 spectral_qualifier varchar2(5) time for which the sample was exposed: FULL or PREL (preliminary)

569b e r 2 0 0 2

570

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ U S E R _ C O M M E N T S

The gards_user_comments table contains text associated with user-defined comments.

Keys: Primary: comment_id Foreign: comment_id (gards_comments)

TABLE 236: GARDS_USER_COMMENTS

Column Storage Type Description

1 sample_id number sample identifier

2 comment_id number comment identifier

3 comment_text varchar2(512) free-form user comments

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ U S E R E N V

The gards_userenv table contains configurable environment variables used by the Auto-matic Processing software.

Keys: Primary: name

TABLE 237: GARDS_USERENV

Column Storage Type Description

1 name varchar2(40) variable name

2 value varchar2(256) variable value

571b e r 2 0 0 2

572

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ U S E R S

The gards_users table contains a list of login names for radionuclide related personnel.

Keys: Primary: user_id

TABLE 238: GARDS_USERS

Column Storage Type Description

1 user_id number unique user identifier

2 user_name varchar2(30) string name for a user database login name

3 assignable number 1 = user can be assigned stations for review or 0 = user not to be assigned sta-tions

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ U S E R S _ R O L E S

The gards_users_roles table contains a mapping of which roles are assigned to which user.

Keys: Primary: user_id/role_id Foreign: user_id (gards_users)

role_id (gards_roles)

TABLE 239: GARDS_USERS_ROLES

Column Storage Type Description

1 user_id number user identifier

2 role_id number role identifier

3 default_role number integer representation of the default role name to be assigned to the user

573b e r 2 0 0 2

574

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ X E _ N U C L _ L I B

The gards_xe_nucl_lib table contains nuclide library information used by the Inspectrawhen displaying nuclide data for gamma spectroscopy noble gas stations.

Keys: Primary: name

TABLE 240: GARDS_XE_NUCL_LIB

Column Storage Type Description

1 nuclide_id number nuclide identifier

2 name varchar2(8) nuclide name

3 type varchar2(16) nuclide type; choices are: ACTIVATION, COSMIC, FISSION(G), FISSION(P), or NATURAL

4 halflife_sec number half-life in seconds

5 halflife varchar2(23) half-life in seconds (S), hours (H), days (D), or years (Y)

6 halflife_err varchar2(23) uncertainty of halflife

7 num_lines number number of nuclide lines in library

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

G A R D S _ X E _ N U C L _ L I N E S _ L I B

The gards_xe_nucl_lines_lib table contains nuclide library information for specific lines of a nuclide and is used by the Inspectra when displaying nuclide data for gamma spec-troscopy noble gas stations.

Keys: Primary: name/energy Foreign: name (gards_xe_nucl_lib)

TABLE 241: GARDS_XE_NUCL_LINES_LIB

Column Storage Type Description

1 name varchar2(8) nuclide name

2 energy number line energy (keV)Canberra parameter: CAM_F_NLENERGY

3 energy_err number uncertainty of line energyCanberra parameter: CAM_F_NLENGERR

4 abundance number abundance of line (percent)Canberra parameter: CAM_F_NLABUN

5 abundance_err number uncertainty of abundance (percent)Canberra parameter: CAM_F_NLABUNERR

6 key_flag number key line indicatorCanberra parameter: CAM_L_NLFKEYLINE

7 nuclide_id number nuclide identifierCanberra parameter: CAM_L_NLNUCL

575b e r 2 0 0 2

576

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

G A R D S _ X E _ P R O C _ P A R A M S _ T E M P L A T E

The gards_xe_proc_params_template table contains the information used for nuclide identification.

Keys: Primary: detector_id/roi Foreign: detector_id (gards_detectors)

roi (gards_roi_lib)

TABLE 242: GARDS_XE_PROC_PARAMS_TEMPLATE

Column Storage Type Description

1 detector_id number detector identifier

2 roi number ROI identifier

3 lc_abscissa number abscissa of the normal distribution corre-sponding to a confidence level

4 beta_ecr_order number determines whether the beta ECR is lin-ear, quadratic, or manually defined

5 gamma_ecr_order number determines whether the gamma ECR is linear, quadratic or manually defined

6 compton number number of compton channels

7 det_back_used number determines whether the detector back-ground is in use or not (1 = YES, 0 = NO)

8 gas_back_used number determines whether the gas background is in use or not (1 = YES, 0 = NO)

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 6 :

R a d io nuc l i de Tab le Desc r ip t ions

577b e r 2 0 0 2

578

Chap te r 6 :

R a d ion uc l id e Tab l e Desc r i p t i ons

U s e r G u i d e sI D C D O C U M E N T A T I O N

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Chapter 7: R a d i o n u c l i d e C o l u m n D e s c r i p t i o n s

This chapter describes the columns in the radionuclide tables used at the IDC.

b e r 2 0 0 2 579

U s e r G u i d e sI D C D O C U M E N T A T I O N

580

Chapter 7: R a d i o n u c l i d e C o l u m n D e s c r i p t i o n s

Name: abscissa Table: Gards_cat_template Description: Acceptable number of standard deviations away from the central_value where

the amount of a nuclide may be found (RDC algorithm).Format: number

Name: abundance Table: Gards_nucl_lines_ided, Gards_nucl_lines_ided_orig, Gards_nucl_lines_lib,

Gards_sample_cert_lines, Gards_xe_nucl_lines_lib Description: Abundance of line.Format: numberUnits: percent

Name: abundance Table: Gards_roi_lib Description: Intensity of β-γ coincidence event.Format: number

Name: abundance_act Table: Gards_aux_lines_lib Description: Intensity of nuclear transition.Format: number

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 7 :

R ad ion uc l id e C o l um n Desc r ip t ions

Name: abundance_act_err Table: Gards_aux_lines_lib Description: Uncertainty of abundance_act.Format: number

Name: abundance_err Table: Gards_nucl_lines_ided, Gards_nucl_lines_ided_orig, Gards_nucl_lines_lib,

Gards_roi_lib, Gards_xe_nucl_lines_lib

Description: Uncertainty in abundance.Format: number

Name: acquisition_live_sec Table: Gards_sample_data Description: Total time a detector’s input gate is open for processing pulses.Format: number Units: seconds

Name: acquisition_real_sec Table: Gards_sample_data Description: Time difference between acquisition_stop and acquisition_start.Format: number Units: seconds

Name: acquisition_start Table: Gards_sample_data Description: Date of detector count commencement.Format: date

581b e r 2 0 0 2

582

Chap te r 7 :

R a d ion uc l id e C o l um n Desc r ip t ion s

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: acquisition_stop Table: Gards_sample_data Description: Date of detector count termination.Format: date

Name: activ_decay Table: Gards_nucl_ided, Gards_nucl_ided_orig Description: Activity decay factor.Format: number

Name: activ_decay_err Table: Gards_nucl_ided, Gards_nucl_ided_orig Description: Uncertainty in activity decay factor.Format: number

Name: activ_err Table: Gards_nucl_lines_ided, Gards_nucl_lines_ided_orig Description: Uncertainty in activity.

Format: number Units: percent

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 7 :

R ad ion uc l id e C o l um n Desc r ip t ions

Name: active_flagTable: gards_cat_criteria_tests

Description: 0 if test is inactiveFormat: number

Name: activ_key Table: Gards_nucl_ided, Gards_nucl_ided_orig Description: Activity concentration of a radionuclide determined through the analysis of

the key gamma photopeak.Format: number Units: µBq/m3

Name: activ_key_err Table: Gards_nucl_ided, Gards_nucl_ided_orig Description: Uncertainty of activ_key.Format: number (22) Units: µBq/m3

Name: activity Table: Gards_auto_sample_cat, Gards_nucl_lines_ided, Gards_nucl_lines_ided_orig,

Gards_sample_cat, Gards_sample_cert_lines Description: Line activity.Format: number Units: µBq/m3

583b e r 2 0 0 2

584

Chap te r 7 :

R a d ion uc l id e C o l um n Desc r ip t ion s

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: activity Table: Gards_roi_concs Description: Activity per unit volume air.Format: numberUnits: µBq/m3

Name: additional_info Table: Gards_poc Description: Additional information for a contact. This column includes information such

as full name, title, company or university name, country, and so on.Format: varchar2(500)

Name: address Table: Gards_poc Description: Postal address of point of contact.Format: varchar2(500)

Name: alert_text Table: Gards_alerts Description: Alert message text.Format: varchar2(512)

Name: alert_type Table: Gards_alerts Description: Category of alert. Format: varchar2(20)Range: alert_type ∈ {ALERT_FLOW, ALERT_SYSTEM, ALERT_TEMP,

ALERT_UPS}

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 7 :

R ad ion uc l id e C o l um n Desc r ip t ions

Name: alpha Table: Gards_cat_template Description: Gain of first-order recursive filter for process level.Format: number Range: alpha ≥ 0

Name: analyst Table: Gards_cat_template, Gards_comments, Gards_sample_status

Description: Name of IDC analyst.Format: varchar2(30)

Name: ape Table: Gards_energy_cal, Gards_energy_cal_orig Description: Average prediction error, a measure of the average confidence interval for the

calculated energy versus channel regression (ECR) over the range of 100 keV.Format: number

Name: archive_bottle_id Table: Gards_sample_aux Description: Unique two-character identifier of the archive bottle in which the sample is

stored.Format: char(2)

Name: area Table: Gards_peaks, Gards_peaks_orig Description: Peak area.Format: number Units: countsRange: 0 ≤ area

585b e r 2 0 0 2

586

Chap te r 7 :

R a d ion uc l id e C o l um n Desc r ip t ion s

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: area_adj Table: Gards_qcparams Description: Peak area standard deviation inflation factor.Format: number Range: 0 ≤ area_adj

Name: area_err Table: Gards_peaks, Gards_peaks_orig Description: Uncertainty of area.Format: number Units: countsRange: 0 ≤ area_err

Name: area_lim Table: Gards_sample_update_params, Gards_update_params_template Description: Minimum allowable peak size.Format: number Units: countsRange: 0 ≤ area_lim

Name: area_reject Table: Gards_proc_params_template, Gards_sample_proc_params Description: If enabled with a value of 1, this flag causes a test to be performed on peak

areas. Peak areas must be positive in order to be accepted as legitimate photo-peaks. A 0 value disables the test.

Format: number Range: area_reject ∈ {0,1}

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 7 :

R ad ion uc l id e C o l um n Desc r ip t ions

Name: arrival_date Table: Gards_rlr Description: Sample arrival date.Format: date

Name: assay_date Table: Gards_sample_cert Description: Date of assay for a radioactive certificate source.Format: date

Name: assignable Table: Gards_users Description: Assignability flag; 1 = user can be assigned stations for review, 0 = user not to

be assigned stations.Format: number

Name: auth Table: Gards_data_log Description: Authentication status of associated message; 1 = authenticated, 0 = not

authenticated.Format: number

587b e r 2 0 0 2

588

Chap te r 7 :

R a d ion uc l id e C o l um n Desc r ip t ion s

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: author

Table: gards_qat_notify

Description: User name of radionuclide officerFormat: varchar2(30)

Name: auto_category Table: Gards_sample_status Description: Sample categorization level after automated analysis.Format: numberRange: 0 ≤ auto_category ≤ 5

Name: ave_activ Table: Gards_nucl_ided, Gards_nucl_ided_orig Description: Sample activity concentration of a specific radionuclide calculated by averag-

ing all activity values.Format: number Units: µBq/m3

Name: ave_activ_err Table: Gards_nucl_ided, Gards_nucl_ided_orig Description: Uncertainty of ave_activ.Format: number Units: µBq/m3

Range: 0 ≤ ave_activ_err

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 7 :

R ad ion uc l id e C o l um n Desc r ip t ions

Name: ave_humidity Table: Gards_met_data Description: Average humidity.Format: number Units: percent

Name: ave_out_temp Table: Gards_met_data Description: Average outside temperature.Format: number Units: degrees C

Name: ave_pressure Table: Gards_met_data Description: Average atmospheric pressure.Format: number Units: millibarsRange: 0.0 ≤ ave_pressure

Name: ave_wind_dir Table: Gards_met_data Description: Average wind direction, degrees from true North.Format: number Units: degreesRange: 0.0 ≤ ave_wind_dir ≤ 360.0

589b e r 2 0 0 2

590

Chap te r 7 :

R a d ion uc l id e C o l um n Desc r ip t ion s

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: ave_wind_speed Table: Gards_met_data Description: Average wind speed.Format: number Units: km/hour

Name: b_abundance Table: Gards_sample_cert_lines Description: Intensity of beta particle or conversion electron.Format: numberUnits: particles/decay

Name: b_chan_start Table: Gards_roi_channels Description: Beta boundary start channel.Format: number

Name: b_chan_stop Table: Gards_roi_channels Description: Beta boundary stop channel.Format: number

Name: b_channels Table: Gards_histogram Description: Number of beta channels in histogram.Format: number

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 7 :

R ad ion uc l id e C o l um n Desc r ip t ions

Name: b_energy Table: Gards_sample_cert_lines Description: Energy of conversion electron or maximum energy of beta particle.Format: numberUnits: keV

Name: b_energy_span Table: Gards_histogram Description: Beta energy span of detector calibration.Format: numberUnits: keV

Name: b_energy_start Table: Gards_roi_limits Description: Beta boundary start energy.Format: numberUnits: keV

Name: b_energy_stop Table: Gards_roi_limits Description: Beta boundary stop energy.Format: numberUnits: keV

591b e r 2 0 0 2

592

Chap te r 7 :

R a d ion uc l id e C o l um n Desc r ip t ion s

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: back_chan Table: Gards_proc_params_template, Gards_sample_proc_params Description: Number of channels to be used on either side of a ROI in calculating the con-

tinuum (or baseline) during automatic analysis.Format: number Range: 0.0 ≤ back_chan

Name: back_channel Table: Gards_peaks, Gards_peaks_orig Description: Average number of background channels.Format: number Range: 0.0 ≤ back_channel

Name: back_count Table: Gards_peaks, Gards_peaks_orig Description: Continuum background counts.Format: number Range: 0.0 ≤ back_count

Name: back_data_type Table: Gards_proc_params_template, Gards_sample_proc_params Description: Parameter that designates the PHD type to be used for a background subtrac-

tion (controlled by the do_back column): B indicates BLANKPHD and D indi-cates DETBKPHD.

Format: char(1) Range: back_data_type ∈ {B, D}

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 7 :

R ad ion uc l id e C o l um n Desc r ip t ions

Name: back_sample_id Table: Gards_sample_proc_params Description: sample_id of the most recent background count. This count is used for back-

ground subtraction when the background subtraction function is ON.Format: number Range: 0 ≤ back_sample_id

Name: back_type Table: Gards_proc_params_template, Gards_sample_proc_params Description: Type of baseline available, LINEAR or STEP.Format: varchar(6) Range: back_type ∈ {LINEAR, STEP}

Name: back_uncer Table: Gards_peaks, Gards_peaks_orig Description: Uncertainty in back_count.Format: number Units: countsRange: 0.0 ≤ back_uncer

Name: begin_date Table: Gards_cat_template, Gards_proc_params_template, Gards_stations_schedule Description: Indicator of either the date when the data record became active and was used

for processing data, or the initial date of a station’s schedule.Format: date

593b e r 2 0 0 2

594

Chap te r 7 :

R a d ion uc l id e C o l um n Desc r ip t ion s

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: beta_coeff1 Table: Gards_bg_energy_cal Description: Zero shift of the beta ECR equation.Format: number

Name: beta_coeff2 Table: Gards_bg_energy_cal Table: Linear coefficient of the beta ECR equation.Format: number

Name: beta_coeff3 Table: Gards_bg_energy_cal Description: Quadratic coefficient of the beta ECR equation.Format: number

Name: beta_ecr_order Table: Gards_sample_xe_proc_params, Gards_xe_proc_params_template Description: Determines whether or not the beta ecr is linear, quadratic, or manually

defined; 1 = linear, 2 = quadratic, 3 = manual (ecr is set on the command line).Format: number

Name: bg_effic_error Table: Gards_bg_efficiency_pairs Description: Uncertainty of bg_efficiency.Format: number

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 7 :

R ad ion uc l id e C o l um n Desc r ip t ions

Name: bg_efficiency Table: Gards_bg_efficiency_pairs Description: Detection efficiency of β-γ coincidence event.Format: number

Name: bkgd_measurement_id Table: Gards_sample_aux Description: Unique background identifier corresponding to the detection identifier.Format: varchar2(31)

Name: bootstrap Table: Gards_sample_update_params, Gards_update_params_template Description: Flag for ignoring prior ECR/RER. A value of 0 indicates not ignore, 1 indi-

cates ignore.Format: number Range: bootstrap ∈ {0, 1}

Name: branch_ratio Table: Gards_aux_lib Description: Percentage of decays to given decay path.Format: number

595b e r 2 0 0 2

596

Chap te r 7 :

R a d ion uc l id e C o l um n Desc r ip t ion s

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: buildtype Table: Gards_sample_update_params, Gards_update_params_template Description: Indicator of the units of the spectral analysis results. "BUILD" is used for nor-

mal sample analysis and returns air activity concentrations, µBq/m3. “NONE” is used for BLANKPHDs, CALIBPHDs, DETBKPHDs, and QCPHDs and returns analysis results as activity values, µBq.

Format: varchar2(8) Range: buildtype ∈ {BUILD, NONE}

Name: cal_energy Table: Gards_b_energy_pairs, Gards_b_energy_pairs_orig, Gards_energy_pairs,

Gards_energy_pairs_orig Description: Calibration energy.Format: number Units: keV

Name: cal_error Table: Gards_b_energy_pairs, Gards_b_energy_pairs_orig, Gards_energy_pairs,

Gards_energy_pairs_orig Description: Uncertainty of channel.Format: number Units: keV

Name: calibration_dtg Table: Gards_sample_aux Description: Date of most recent calibration at a detector site.Format: date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 7 :

R ad ion uc l id e C o l um n Desc r ip t ions

Name: calibration_type Table: Gards_refline_master Description: Calibration type indicator. MIX indicates a mixed source, CAL indicates a sin-

gle radionuclide source, and no entry indicates the calibration_type is an actual air sample.

Format: varchar2(3)Range: calibration_type ∈ {MIX, CAL}

Name: category Table: Gards_auto_sample_cat, Gards_sample_cat, Gards_sample_status Description: Categorization level.Format: number Range: 0 ≤ category ≤ 5

Name: category_list

Table: Gards_qat_query_filter

Description: comma-separated list of categoriesFormat: varchar2(32)

Name: central_value Table: Gards_auto_sample_cat, Gards_cat_template, Gards_sample_cat Description: Estimate of the level of the random process.Format: number

597b e r 2 0 0 2

598

Chap te r 7 :

R a d ion uc l id e C o l um n Desc r ip t ion s

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: centroid Table: Gards_peaks, Gards_peaks_orig Description: Peak centroid energy.Format: number Units: KeVRange: 0.0 ≤ centroid

Name: centroid_err Table: Gards_peaks, Gards_peaks_orig Description: Uncertainty of centriod.Format: number Units: channelsRange: 0.0 ≤ centroid_err

Name: chain_id Table: Gards_aux_lib Description: Decay chain index.Format: number

Name: chain_pos Table: Gards_aux_lib Description: Position in decay chain.Format: number

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 7 :

R ad ion uc l id e C o l um n Desc r ip t ions

Name: channel Table: Gards_b_energy_pairs, Gards_b_energy_pairs_orig, Gards_energy_pairs,

Gards_energy_pairs_orig Description: Peak centroid channel.Format: number

Name: channels Table: Gards_detectors, Gards_spectrum Description: Number of channels.Format: number Range: channels > 0

Name: class Table: Gards_interval Description: Station name.Format: varchar2(16)

Name: cnf_begin_date Table: Gards_sample_status Description: Date when last analysis began.Format: date

Name: cnf_end_date Table: Gards_sample_status Description: Date when last analysis ended.Format: date

599b e r 2 0 0 2

600

Chap te r 7 :

R a d ion uc l id e C o l um n Desc r ip t ion s

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: cnv_factor Table: Gards_energy_cal, Gards_energy_cal_orig Description: Conversion factor from MeV to keV.Format: number Units: keV/MeV

Name: code Table: Gards_codes Description: Code symbol.Format: char(5)

Name: code Table: Gards_stations_schedule Description: Code symbol SCHEDULE as found in the gards_codes table. SF_GP for full

sample grace period or SPHDF for full sample PHD. Format: char(5) Range: code ∈ {SF_GP, SPHDF}

Name: coeff1 Table: Gards_efficiency_cal, Gards_energy_cal, Gards_energy_cal_orig,

Gards_resolution_cal, Gards_resolution_cal_orig Description: First order calibration coefficient.Format: number

Name: coeff2 Table: Gards_efficiency_cal, Gards_energy_cal, Gards_energy_cal_orig,

Gards_resolution_cal, Gards_resolution_cal_orig Description: Second order calibration coefficient.Format: number

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 7 :

R ad ion uc l id e C o l um n Desc r ip t ions

Name: coeff3 Table: Gards_efficiency_cal, Gards_energy_cal, Gards_energy_cal_orig,

Gards_resolution_cal, Gards_resolution_cal_orig Description: Third order calibration coefficient.Format: number

Name: coeff4 Table: Gards_efficiency_cal, Gards_energy_cal, Gards_energy_cal_orig,

Gards_resolution_cal, Gards_resolution_cal_orig Description: Fourth order calibration coefficient.Format: number

Name: coeff5 Table: Gards_efficiency_cal, Gards_energy_cal, Gards_energy_cal_orig,

Gards_resolution_cal, Gards_resolution_cal_orig Description: Fifth order calibration coefficient.Format: number

Name: coeff6 Table: Gards_efficiency_cal, Gards_energy_cal, Gards_energy_cal_orig,

Gards_resolution_cal, Gards_resolution_cal_orig Description: Sixth order calibration coefficient.Format: number

Name: coeff7 Table: Gards_efficiency_cal, Gards_energy_cal, Gards_energy_cal_orig,

Gards_resolution_cal, Gards_resolution_cal_orig Description: Seventh order calibration coefficient.Format: number

601b e r 2 0 0 2

602

Chap te r 7 :

R a d ion uc l id e C o l um n Desc r ip t ion s

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: coeff8 Table: Gards_efficiency_cal, Gards_energy_cal, Gards_energy_cal_orig,

Gards_resolution_cal, Gards_resolution_cal_orig Description: Eighth order calibration coefficient.Format: number

Name: collect_start Table: Gards_rlr, Gards_sample_data Description: Date of sample collection commencement.Format: date

Name: collect_stop Table: Gards_rlr, Gards_sample_data Description: Date of sample collection termination.Format: date

Name: comment_id Table: Gards_comments, Gards_user_comments Description: Unique comment identifier.Format: number

Name: comment_text Table: Gards_cat_template, Gards_comments_defs, Gards_qat_notify,

Gards_user_comments Description: Text of analyst comments.Format: varchar2(256) for gards_comments_defs, gards_cat_template,

varchar2(512) for gards_user_comments, varchar2(2048) for gards_qat_notify.

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 7 :

R ad ion uc l id e C o l um n Desc r ip t ions

Name: comment_type Table: Gards_comments, Gards_comments_defs, Gards_qat_notify

Description: Predefined comment code.Format: number

Name: comp_confid Table: Gards_nucl_ided, Gards_nucl_ided_orig Description: Computed confidence index.Format: number

Name: compton Table: Gards_roi_counts, Gards_sample_xe_proc_params,

Gards_xe_proc_params_template Description: Compton continuum background counts.Format: number Units: counts

Name: compton_err Table: Gards_roi_counts Description: Uncertainty of compton.Format: number Units: counts

Name: count_ratio Table: Gards_sample_ratios Description: Ratio of upper ROI counts to lower ROI counts.Format: number

603b e r 2 0 0 2

604

Chap te r 7 :

R a d ion uc l id e C o l um n Desc r ip t ion s

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: count_ratio_err Table: Gards_sample_ratios Description: Uncertainty of count_ratio.Format: number

Name: country_code Table: Gards_stations Description: Unique two-digit identifier for the country in which the station is located.Format: varchar2(2)

Name: count_sec Table: Gards_peaks, Gards_peaks_orig Description: Count rate.Format: number Units: counts/second

Name: count_sec_err Table: Gards_peaks, Gards_peaks_orig Description: Uncertainty of count rate.Format: number Units: percent

Name: crit_level Table: Gards_proc_params_template, Gards_sample_proc_params Description: If set to 1, the estimated net areas are subjected to a simple "Critical Level

Test" to see if they are above a multiple of the ROI baseline-area’s estimated variability. This column is a form of "signal-to-noise" test. The indicated area

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 7 :

R ad ion uc l id e C o l um n Desc r ip t ions

must be at least 1.645 (hardcoded) times the estimated standard deviation of the baseline area for the peak to be accepted. If the area fails the test, it is deleted from the peak search results.

Format: number Range: crit_level ∈ {0, 1}

Name: csc_mod_flagTable: gards_nucl_ided, gards_nucl_lines_ided

Description: flag that indicates if cascade summing modified a nuclide: 1 = nuclide was modified, 0 = nuclide was not modified.

Format: number

Name: csc_ratioTable: gards_nucl_ided, gards_nucl_lines_ided

Description: multiplier used by analysis to update activ_key and mda.Format: number

Name: csc_ratio_errTable: gards_nucl_ided, gards_nucl_lines_ided

Description: uncertainty in csc_ratio.Format: number

Name: data_type Table: Gards_proc_params_template, Gards_refline_master, Gards_sample_data,

Gards_update_reflines Description: Type of sample; an uncontaminated crushed blank filter (B), calibration back-

ground (C), detector background (D), quality control (Q), or an actual sample (S).

Format: char(1)Range: data_type ∈ {B, C, D, Q, S}

605b e r 2 0 0 2

606

Chap te r 7 :

R a d ion uc l id e C o l um n Desc r ip t ion s

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: data_type Table: Gards_data_log , Gards_processing_errorsDescription: Type of data message. Format: varchar2(10); varchar2(12)Range: data_type ∈ {ALERT, MET, SOH, SPHD-B, SPHD-C, SPHD-D, SPHD-F,

SPHD-P, SPHD-Q, SPHD-G.}

Name: date_begin Table: Gards_detectors, Gards_stations Description: Station/Detector initialization date.Format: date

Name: date_end Table: Gards_detectors, Gards_stations Description: Station/Detector decommissioning date.Format: date

Name: date_received Table: Gards_data_log Description: Date message arrival date.Format: date

Name: date_value Table: Gards_trendvue Description: Date of Trendvue plot.Format: date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 7 :

R ad ion uc l id e C o l um n Desc r ip t ions

Name: db_name Table: Gards_permissions, Gards_roles Description: Name of corresponding database role.Format: varchar2(35)

Name: decay_mode Table: Gards_b_energy_pairs, Gards_b_energy_pairs_orig, Gards_sample_cert_lines Description: Type of decay; B = beta particle, C = conversion electron.Format: char(1)Range: decay_mode ∈ {B, C}

Name: default_role Table: Gards_users_roles Description: Number that corresponds to the default role id for a user.Format: number

Name: degree Table: Gards_efficiency_cal Description: Degree of efficiency equation.Format: number

Name: delta Table: Gards_auto_sample_cat, Gards_cat_template, Gards_sample_cat Description: Value of a variable used in bounds estimation (EWMA algorithm).Format: number

607b e r 2 0 0 2

608

Chap te r 7 :

R a d ion uc l id e C o l um n Desc r ip t ion s

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: description Table: Gards_notify Description: Reason a notification message is transmitted.Format: varchar2(80)

Name: description Table: Gards_codes, Gards_detectors, Gards_stations Description: Description of the code, detector, or station.Format: varchar2(40)

varchar2(80) for gards_detectors

Name: description Table: Gards_sample_description Description: Description sent from the station in a Comment block of a PHD message.Format: varchar2(512)

Name: det Table: Gards_energy_cal, Gards_energy_cal_orig Description: The determinant of the weighted design matrix, a measure of the spread of fit-

ted data points and the error in the fitted points.Format: number

Name: det_back_used Table: Gards_sample_xe_proc_params, Gards_xe_proc_params_template Description: Determines whether the detector background is in use or not (1 = YES, 0 =

NO).Format: number

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 7 :

R ad ion uc l id e C o l um n Desc r ip t ions

Name: detector_back Table: Gards_roi_counts Description: Detector background counts.Format: number

Name: detector_back_err Table: Gards_roi_counts Description: Uncertainty of detector_back.Format: numberUnits: counts

Name: detector_code Table: Gards_detectors, Gards_processing_errorsDescription: Detector identification code.Format: varchar2(9)

Name: detector_id Table: Gards_cat_template, Gards_detectors, Gards_nucl_ided, Gards_nucl_ided_orig,

Gards_nucl_lines_ided, Gards_nucl_lines_ided_orig, Gards_proc_params_template, Gards_qchistory, Gards_qcparams, Gards_qctargets, Gards_rlr, Gards_sample_data, Gards_soh_char_data, Gards_soh_header, Gards_soh_num_data, Gards_soh_sensor_data, Gards_stadet, Gards_update_params_template, Gards_update_reflines, Gards_xe_proc_params_template

Description: Unique detector identifier.Format: number

609b e r 2 0 0 2

610

Chap te r 7 :

R a d ion uc l id e C o l um n Desc r ip t ion s

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: display_detector Table: Gards_soh_code Description: Flag indicating if the SOH parameter is associated with a detector; 1 = the

parameter is associated with a detector and Trendvue should allow users to query by detector, 0 = the parameter is station only and no detectors will appear in the Trendvue dialog box.

Format: number

Name: display_station Table: Gards_soh_code Description: Flag indicating if the SOH parameter is associated with a station; 1 = the

parameter is associated with a station and Trendvue should allow users to query by station, 0 = the parameter is detector only and no stations will appear in the Trendvue dialog box.

Format: number

Name: dlid Table: Gards_data_log Description: Data log identifier.Format: number

Name: do_back Table: Gards_proc_params_template, Gards_sample_proc_params Description: Flag that indicates whether or not background subtraction should be per-

formed: 1 = yes, 0 = no.Format: number Range: do_back ∈ {0,1}

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 7 :

R ad ion uc l id e C o l um n Desc r ip t ions

Name: do_csc

Table: gards_proc_params_template, gards_sample_proc_params

Description: flag that indicates how cascade summing should default: 0 = defaul to off, 1 = default to on.

Format: number

Name: do_pd_calc Table: Gards_proc_params_template, Gards_sample_proc_params Description: Flag that indicates if the parent/daughter calculations were run for a particular

sample; 1 = calculations were run, 2 = calculations were not run.Format: number

Name: do_reru Table: Gards_update_params_template, Gards_sample_update_params Description: Flag that indicates if the software is to perform a resolution update.Format: number Range: do_reru ∈ {0,1}

Name: dtg Table: Gards_alerts, Gards_comments, Gards_data_log, Gards_fpe, Gards_qat_notify,

Gards_qctargets, Gards_receipt_log, Gards_status_history.

Description: Date of the event, comment, message, or change.Format: date

611b e r 2 0 0 2

612

Chap te r 7 :

R a d ion uc l id e C o l um n Desc r ip t ion s

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: dtg_begin Table: Gards_mdas2report, Gards_notify, Gards_nucl2quantify,

Gards_soh_char_data, Gards_soh_header, Gards_soh_num_data, Gards_soh_sensor_data

Description: Start date of applicability, notification initialization date, or the reporting period.

Format: date

Name: dtg_end Table: Gards_mdas2report, Gards_notify, Gards_nucl2quantify,

Gards_soh_char_data, Gards_soh_header, Gards_soh_num_data, Gards_soh_sensor_data

Description: End date of applicability, notification termination date, or the reporting period.

Format: date

Name: ecal_range_max Table: Gards_detectors Description: Maximum detector calibration energy for which the detector is calibrated. Format: number Units: keV

Name: ecr_slope Table: Gards_sample_update_params Description: Default ECR slope.Format: number

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 7 :

R ad ion uc l id e C o l um n Desc r ip t ions

Name: eff_error Table: Gards_peaks, Gards_peaks_orig Description: Uncertainty of efficiency.Format: number

Name: effic Table: Gards_nucl_lines_ided, Gards_nucl_lines_ided_orig Description: Efficiency at energy.Format: number

Name: effic_energy Table: Gards_efficiency_pairs, Gards_total_effic Description: Efficiency energy.Format: number Units: keV

Name: effic_err Table: Gards_nucl_lines_ided, Gards_nucl_lines_ided_orig Description: Uncertainty of effic.Format: number

Name: effic_error Table: Gards_efficiency_pairs, Gards_total_effic Description: Uncertainty of efficiency.Format: number

613b e r 2 0 0 2

614

Chap te r 7 :

R a d ion uc l id e C o l um n Desc r ip t ion s

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: efficiency Table: Gards_efficiency_pairs, Gards_peaks, Gards_peaks_orig, Gards_total_effic Description: Peak efficiency.Format: number

Name: efftype Table: Gards_efficiency_cal Description: Efficiency type.Format: char(8)

Name: elevation Table: Gards_stations Description: Elevation of the station location above sea level.Format: number Units: metersRange: 0 ≥ elevation

Name: email_addr Table: Gards_notify Description: Recipient email address. Format: varchar2(80)

Name: email_address Table: Gards_poc Description: Email address of the point-of-contact. Format: varchar2(50)

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 7 :

R ad ion uc l id e C o l um n Desc r ip t ions

Name: end_date Table: Gards_cat_template, Gards_proc_params_template, Gards_stations_schedule Description: In gards_proc_params_template, this column indicates when a data record

became inactive. If the value of the date is NULL, then the record is still active. In gards_stations_schedule, this column contains the date of station ter-mination.

Format: date

Name: end_env_time Table: Gards_environment Description: End date of environmental data.Format: date

Name: end_env_time_sec Table: Gards_environment Description: End date of environmental data.Format: number Units: seconds

Name: end_time Table: Gards_met_data Description: End time of measurement.Format: date

Name: end_time Table: Gards_interval Description: End time of interval in epoch time.Format: float(22)

615b e r 2 0 0 2

616

Chap te r 7 :

R a d ion uc l id e C o l um n Desc r ip t ion s

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: energy Table: Gards_aux_lines_lib, Gards_nucl_lines_ided, Gards_nucl_lines_ided_orig,

Gards_nucl_lines_lib, Gards_peaks, Gards_peaks_orig, Gards_qat_notify, Gards_qctargets, Gards_sample_cert_lines, Gards_xe_nucl_lines_lib

Description: Line energy.Format: number Units: keVRange: 0 ≤ energy

Name: energy_err Table: Gards_nucl_lines_ided, Gards_nucl_lines_ided_orig, Gards_nucl_lines_lib,

Gards_peaks, Gards_peaks_orig, Gards_xe_nucl_lines_lib Description: Uncertainty of energy.Format: number Units: keVRange: 0.0 ≤ energy_err

Name: energy_span Table: Gards_spectrum Description: Total energy span of detector.Format: number Units: keV

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 7 :

R ad ion uc l id e C o l um n Desc r ip t ions

Name: energy_tol Table: Gards_sample_proc_params Description: Column used during nuclide identification. Nuclides with photopeaks within

energy_tol (keV) of the given centroid energy will be tentatively associated with the peak.

Format: number Units: keVRange: 0.0 ≤ energy_tol

Name: energy_units Table: Gards_energy_cal, Gards_energy_cal_orig Description: Energy units.Format: char(3) Range: energy_units ∈ {MeV, keV}

Name: entry_date Table: Gards_sample_status, Gards_processing_errors

Description: Date sample was entered into database; date and time of error entryFormat: date

Name: error Table: Gards_sample_cert_lines Description: Uncertainty of activity. Format: number Units: percentRange: 0.0 ≤ error

617b e r 2 0 0 2

618

Chap te r 7 :

R a d ion uc l id e C o l um n Desc r ip t ion s

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: error_text

Table: Gards_processing_errors

Description: Text associated with the errorFormat: varchar2(2048)

Name: etol Table: Gards_qcparams Description: Energy tolerance used to match peaks with energies.Format: number Range: 0.0 ≤ etol

Name: event Table: Gards_notify Description: Type of occurrence.Format: varchar2(10) Range: event ∈ {ALERT, FIS_FOUND, NIC_SIG34, NIC_SIG5, QC_ERROR,

QC_WARNING, RADOPSCAL, RMS_ADMIN}

Name: f_linear Table: Gards_sample_update_params, Gards_update_params_template Description: Flag for forcing ECR to be first ordered. A value of 0 indicates not to force, 1

indicates to force the ECR. Format: number Range: f_linear ∈ {0,1}

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 7 :

R ad ion uc l id e C o l um n Desc r ip t ions

Name: file_size Table: Gards_data_log Description: Data message size. Format: number Units: kilobytes

Name: filename Table: Gards_histogram, Gards_rlr, Gards_spectrum, Gards_processing_errors

Description: Name of file containing associated data; import message filenameFormat: varchar2(256); varchar2(512)

Name: first_name Table: Gards_poc Description: Point of contact’s first name.Format: varchar2(20)

Name: fit_singlets Table: Gards_proc_params_template, Gards_sample_proc_params Description: Flag that indicates the type of processing performed when searching for sin-

glets. 0 indicates a simple arithmetic summation of the ROI channel data is used to estimate the centroid, width, and area of a peak. 1 indicates a non-lin-ear Gaussian fit is used to estimate the peak centroid, width, and area.

Format: number Range: fit_singlets ∈ {0,1}

619b e r 2 0 0 2

620

Chap te r 7 :

R a d ion uc l id e C o l um n Desc r ip t ion s

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: fitted Table: Gards_peaks, Gards_peaks_orig Description: Peak fit indicator. 0 indicates the peak fit function is OFF. 1 indicates the peak

fit function is ON.Format: number Range: fitted ∈ {0,1}

Name: fix_fwhm Table: Gards_proc_params_template, Gards_sample_proc_params Description: If the value for this variable is 1, the width of a peak will be "fixed" at the

value predicted by the RER at the energy of interest. A 0 indicates that the peak width is a free parameter and will be estimated.

Format: numberRange: fix_fwhm ∈ {0,1}

Name: flag_id Table: Gards_flags, Gards_sample_flags Description: Unique identifier for an event screening test.Format: number Range: 0 ≤ flag_id

Name: flow_rate Table: Gards_environment Description: Flow rate through filter.Format: number Units: m3/hRange: 0.0 ≤ flow_rate

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 7 :

R ad ion uc l id e C o l um n Desc r ip t ions

Name: fpid Table: Gards_fpe Description: Unique fission product identifier.Format: number Range: 0 ≤ gards_fpe

Name: fwhm Table: Gards_peaks, Gards_peaks_orig Description: Peak width at half the maximum peak height.Format: number Units: keVRange: 0.0 ≤ fwhm

Name: fwhm_err Table: Gards_peaks, Gards_peaks_orig Description: Uncertainty in fwhm.Format: number Units: KeVRange: 0.0 ≤ fwhm_err

Name: fwhm_mult_width Table: Gards_proc_params_template, Gards_sample_proc_params Description: Number of full-width-at-half-maximums to search to determine multiplets

during peak searches (a user configurable value).Format: number Range: 0 ≤ fwhm_mult_width

621b e r 2 0 0 2

622

Chap te r 7 :

R a d ion uc l id e C o l um n Desc r ip t ion s

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: g_chan_start Table: Gards_roi_channels Description: Gamma boundary start channel.Format: number

Name: g_chan_stop Table: Gards_roi_channels Description: Gamma boundary stop channel.Format: number

Name: g_channels Table: Gards_histogram Description: Number of gamma channels in histogram.Format: number

Name: g_energy_span Table: Gards_histogram Description: Gamma energy span of detector.Format: numberUnits: keV

Name: g_energy_start Table: Gards_roi_limits Description: Gamma boundary start energy.Format: numberUnits: keV

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 7 :

R ad ion uc l id e C o l um n Desc r ip t ions

Name: g_energy_stop Table: Gards_roi_limits Description: Gamma boundary stop energy.Format: numberUnits: keV

Name: gainchange Table: Gards_qcparams Description: Acceptable change in gain for a quality control (QC) test.Format: number

Name: gainshift Table: Gards_update_params_template, Gards_sample_update_params Description: Gainshift observed between one spectrum and the spectrum that follows.

Used during matching peaks.Format: numberUnits: percentRange: 0.0 ≤ gainshift

Name: gamma Table: Gards_cat_template

Description: Gain of first-order recursive filter for process variance.Format: number Range: 0.0 ≤ gamma

623b e r 2 0 0 2

624

Chap te r 7 :

R a d ion uc l id e C o l um n Desc r ip t ion s

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: gamma_coeff1 Table: Gards_bg_energy_cal Description: Gain of the gamma ECR equation.Format: number

Name: gamma_coeff2 Table: Gards_bg_energy_cal Description: Linear coefficient of the gamma ECR equation.Format: number

Name: gamma_coeff3 Table: Gards_bg_energy_cal Description: Quadratic coefficient of the gamma ECR equation.Format: number

Name: gamma_ecr_order Table: Gards_sample_xe_proc_params, Gards_xe_proc_params_template Description: Determines whether the gamma ecr is linear, quadratic, or manually defined; 1

= linear, 2 = quadratic, 3 = manual (ecr is set on command line).Format: number

Name: gas_back_used Table: Gards_sample_xe_proc_params, Gards_xe_proc_params_template Description: Determines whether or not the gas background is in use (1 = YES, 0 = NO).Format: number

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 7 :

R ad ion uc l id e C o l um n Desc r ip t ions

Name: gas_bkgd_measurement_id Table: Gards_sample_aux Description: Unique measurement of the gas background acquisition associated with the

sample.Format: varchar2(31)

Name: geometry Table: Gards_sample_data Description: Sample geometry.Format: varchar2(17)

Name: gross Table: Gards_roi_counts Description: Counts in ROI before processing.Format: numberUnits: counts

Name: gross_err Table: Gards_roi_counts Description: Uncertainty of gross.Format: numberUnits: counts

625b e r 2 0 0 2

626

Chap te r 7 :

R a d ion uc l id e C o l um n Desc r ip t ion s

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: halflife Table: Gards_nucl_ided, Gards_nucl_ided_orig, Gards_nucl_lib, Gards_roi_lib,

Gards_sample_cert_lines, Gards_xe_nucl_lib Description: Half-life of a radionuclide given as a number (integer, decimal, or exponen-

tial) followed by a time unit such as S for seconds, H for hours, D for days, or Y for years.

Format: varchar2(23)

Name: halflife_act Table: Gards_aux_lib Description: Actual half-life.Format: varchar2(23)

Name: halflife_act_err Table: Gards_aux_lib Description: Uncertainty of halflife_act.Format: varchar2(23)

Name: halflife_err Table: Gards_nucl_lib, Gards_roi_lib, Gards_xe_nucl_lib Description: Uncertainty of halflife.Format: varchar2(23)

Name: halflife_sec Table: Gards_nucl_lib, Gards_roi_lib, Gards_xe_nucl_lib Description: Half-life in seconds.Format: number Units: seconds

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 7 :

R ad ion uc l id e C o l um n Desc r ip t ions

Name: hold Table: Gards_auto_sample_cat, Gards_sample_cat Description: Flag that holds categorization bounds fixed and does not update values. A

value of 1 means to proceed as usual, 0 means to wait.Format: numberRange: hold ∈ {0,1}

Name: ided Table: Gards_peaks, Gards_peaks_orig Description: Peak identification indicator. 1 = peak was associated with a nuclide by the

automated analysis. 0 = peak was not associated with a nuclide by the auto-mated analysis. This field is not updated by the ROI interface.

Format: number Range: ided ∈ {0,1}

Name: include_stations

Table: Gards_qat_query_filter

Description: flag to include or exclude stationsFormat: number

Name: init_begin_date Table: Gards_cat_template Description: Start date for initialization data.Format: date

Name: init_end_date Table: Gards_cat_template Description: End date for initialization data.Format: date

627b e r 2 0 0 2

628

Chap te r 7 :

R a d ion uc l id e C o l um n Desc r ip t ion s

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: input_file_name Table: Gards_sample_data Description: Name of data file to be input.Format: varchar2(256)

Name: interference Table: Gards_roi_counts Description: Counts from interference nuclides.Format: number Units: counts

Name: interference_err Table: Gards_roi_counts Description: Uncertainty of interference.Format: number Units: counts

Name: kb_sent Table: Gards_receipt_log Description: Size of data sent.Format: number Units: kilobytesRange: kb_sent > 0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 7 :

R ad ion uc l id e C o l um n Desc r ip t ions

Name: key_flag Table: Gards_nucl_lines_ided, Gards_nucl_lines_ided_orig, Gards_nucl_lines_lib,

Gards_xe_nucl_lines_lib Description: Flag that indicates whether the photopeak is a key line (1) or not (0).Format: number Range: key_flag ∈ {0,1}

Name: last_name Table: Gards_poc Description: Last name of the point of contact.Format: varchar2(50)

Name: lat Table: Gards_detectors, Gards_stations Description: Geographic latitude of the detector or station.Format: number Units: degreesRange: 90.0 > lat > –90.0

Name: lc Table: Gards_peaks, Gards_peaks_orig, Gards_roi_counts Description: Critical level for the peak.Format: numberUnits: counts

629b e r 2 0 0 2

630

Chap te r 7 :

R a d ion uc l id e C o l um n Desc r ip t ion s

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: lc_abscissa Table: Gards_proc_params_template, Gards_sample_proc_params,

Gards_sample_xe_proc_params, Gards_xe_proc_params_template Description: Abscissas of the normal distribution corresponding to a confidence level; a

value of 1.645 corresponds to a 95% confidence interval for the peak critical level.

Format: number

Name: lddate Table: Gards_interval, Gards_qchistory Description: Load date of record.Format: date

Name: left_chan Table: Gards_peaks, Gards_peaks_orig Description: Left channel of peak I.Format: number Range: left_chan > 0

Name: left_fwhm_lim Table: Gards_proc_params_template, Gards_sample_proc_params Description: One of two user-configurable limits on the peak size. This column indicates

the maximum possible peak width to the left of the peak centroid, expressed in multiples of the FWHM.

Format: number Range: left_fwhm_lim > 0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 7 :

R ad ion uc l id e C o l um n Desc r ip t ions

Name: line_comment Table: Gards_aux_lines_lib Description: Description of line properties.Format: varchar2(500)

Name: line_type Table: Gards_aux_lines_lib Description: Type of radiation causing the line.Format: varchar2(8)

Name: lon Table: Gards_detectors, Gards_stations Description: Geographic longitude of the detector or station.Format: number Units: degreesRange: –180.0 > lon > 180.0

Name: lower_bound Table: Gards_auto_sample_cat, Gards_cat_template, Gards_sample_cat Description: Lower limit of the amount of a nuclide that can be acceptably found.Format: number

631b e r 2 0 0 2

632

Chap te r 7 :

R a d ion uc l id e C o l um n Desc r ip t ion s

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: lower_limit

Table: Gards_cat_criteria_tests

Description: lower limit bound of the testFormat: number

Name: lower_roi_number Table: Gards_sample_ratios Description: ROI number associated with the lower ROI.Format: number

Name: max_sample_id

Table: Gards_qat_query_filter

Description: foriegn keyFormat: number

Name: max_t_time

Table: Gards_qat_config

Description: maximum allowable value for t_time

Format: number

Name: mda Table: Gards_nucl_ided, Gards_nucl_ided_orig, Gards_nucl_lines_ided,

Gards_nucl_lines_ided_orig, Gards_roi_concs Description: Minimum detectable activity.Format: number Units: µBq/m3

mBq/m3 for gards_roi_concs

Range: mda ≥ 0.0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 7 :

R ad ion uc l id e C o l um n Desc r ip t ions

Name: mda_err Table: Gards_nucl_ided, Gards_nucl_ided_orig Description: Uncertainty of mda.Format: number Units: µBq/m3

Range: mda_err ≥ 0

Name: mda_level Table: Gards_proc_params_template, Gards_sample_proc_params Description: Confidence level at which the minimum detectable concentration is calcu-

lated. The value represents a value to be subtracted from 100%, resulting in a confidence level of 1–100%.

Format: number Range: 1.0 ≤ mda_level ≤ 100.0

Name: mda_max Table: Gards_mdas2report Description: Maximum bound for the MDC range.Format: number Units: µBq/m3

Range: 5 ≤ mda_max ≤ 22000

Name: mda_min Table: Gards_mdas2report Description: Minimum bound for the minimum detectable activity (MDA) range.Format: number Units: µBq/m3

Range: 3 ≤ mda_min ≤ 22000

633b e r 2 0 0 2

634

Chap te r 7 :

R a d ion uc l id e C o l um n Desc r ip t ion s

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: mdc_width Table: Gards_proc_params_template, Gards_sample_proc_params Description: Baseline width used for MDA calculation.Format: number

Name: measurement_id Table: Gards_sample_aux Description: Unique alphanumeric identifier assigned to each detector acquisition.Format: varchar2(31)

Name: memory Table: Gards_roi_counts Description: Gas background (that is, “memory effect”) counts.Format: numberUnits: counts

Name: memory_err Table: Gards_roi_counts Description: Uncertainty of memory.Format: numberUnits: counts

Name: method_id Table: Gards_auto_sample_cat, Gards_cat_template, Gards_sample_cat Description: Method identifier.Format: number

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 7 :

R ad ion uc l id e C o l um n Desc r ip t ions

Name: method_type Table: Gards_cat_template Description: Type of categorization analysis to use.Format: number

Name: min_lookup Table: Gards_sample_update_params, Gards_update_params_template Description: Minimum value possible for the nuclide library lookup energy tolerance,

energy_tol. The energy_tol cannot be less than min_lookup and result in a match.

Format: number

Name: min_sample_id

Table: Gards_qat_query_filter

Description: foreign keyFormat: number

Name: min_t_time

Table: gards_qat_config

Description: minimum allowable value for t_time

Format: number

Name: moddate Table: Gards_cat_criteria_tests, Gards_interval, Gards_qat_config, Gards_qat_notify,

Gards_status_history

Description: Modification date.Format: date

635b e r 2 0 0 2

636

Chap te r 7 :

R a d ion uc l id e C o l um n Desc r ip t ion s

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: mrp_sample_id Table: Gards_sample_update_params Description: Column that lists the sample_id of the MRP sample in the event that the

mrp_used flag has been set to 1.Format: number Range: mrp_sample_id ≥ 0

Name: mrp_used Table: Gards_sample_update_params Description: Flag that indicates when the most recent prior sample should be taken into

account during sample processing. 1 = should be used. 0 = should not be used.

Format: number Range: mrp_used ∈ {0,1}

Name: mse Table: Gards_energy_cal, Gards_energy_cal_orig Description: The mean-squared error of the fit; a measure of how large the residual is.Format: number

Name: msg_id Table: Gards_data_log, Gards_sample_aux , Gards_processing_errorsDescription: Message identifier sent in the email header of the message.Format: number Range: msg_id ≥ 0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 7 :

R ad ion uc l id e C o l um n Desc r ip t ions

Name: muarea Table: Gards_qctargets Description: Target area for each nuclide line energy.Format: numberUnits: countsRange: muarea > 0

Name: multiplet Table: Gards_peaks, Gards_peaks_orig Description: Multiplet peak indicator.Format: number Range: multiplet ∈ {0,1}

Name: muwidth Table: Gards_qctargets Description: Target width for each nuclide line indicator.Format: number Units: keVRange: muwidth > 0.0

Name: name Table: Gards_auto_sample_cat, Gards_aux_lib, Gards_aux_lines_lib,

Gards_cat_template, Gards_mdas2report, Gards_nucl2quantify, Gards_nucl_ided, Gards_nucl_ided_orig, Gards_nucl_lib, Gards_nucl_lines_ided, Gards_nucl_lines_ided_orig, Gards_nucl_lines_lib, Gards_qctargets, Gards_relevant_nuclides, Gards_roi_lib, Gards_sample_cat, Gards_xe_nucl_lib, Gards_xe_nucl_lines_lib

Description: Nuclide name.Format: varchar2(8)

637b e r 2 0 0 2

638

Chap te r 7 :

R a d ion uc l id e C o l um n Desc r ip t ion s

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: name Table: Gards_flags Description: Test name. Format: varchar2(32)

Name: name Table: Gards_interval Description: Detector or system name.Format: varchar2(16)

Name: name Table: Gards_userenv Description: Variable name.Format: varchar2(40)

Name: net Table: Gards_roi_counts Description: Counts in ROI after processing.Format: numberUnits: counts

Name: net_err Table: Gards_roi_counts Description: Uncertainty of net.Format: numberUnits: counts

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 7 :

R ad ion uc l id e C o l um n Desc r ip t ions

Name: new_statusTable: Gards_sample_status

Description: sample_status after changeFormat: char(1)

Name: nid_confid Table: Gards_proc_params_template, Gards_sample_proc_params Description: User-configurable nuclide identifier confidence threshold. This threshold

must be exceeded by the confidence level generated during analysis, or the nuclide is not considered identified.

Format: number Range: nid_confid > 0.0

Name: nid_flag Table: Gards_nucl_ided, Gards_nucl_ided_orig, Gards_roi_concs Description: Flag, nuclide identification indicator.Format: number Range: nid_flag ∈ {–1, 0, 1, 2}

Name: nuclide_id Table: Gards_nucl_ided, Gards_nucl_ided_orig, Gards_nucl_lib,

Gards_nucl_lines_ided, Gards_nucl_lines_ided_orig, Gards_nucl_lines_lib, Gards_xe_nucl_lib, Gards_xe_nucl_lines_lib

Description: Nuclide identifier.Format: numberRange: nuclide_id > 0

639b e r 2 0 0 2

640

Chap te r 7 :

R a d ion uc l id e C o l um n Desc r ip t ion s

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: nuclide_lib Table: Gards_proc_params_template, Gards_sample_proc_params Description: Indicator of which nuclide library data file is to be used when processing sam-

ple data. The actual data in this column is a UNIX path name to a nuclide library data file.

Format: varchar2(96)

Name: nucl_name Table: Gards_comments, Gards_sample_cert_lines, Gards_qat_notify

Description: Nuclide name.Format: varchar2(8)

Name: num_lines Table: Gards_nucl_lib, Gards_xe_nucl_lib Description: Total number of nuclide lines in library.Format: number

Name: num_samples Table: Gards_cat_template Description: Number of samples used to collect the average and define the standard devia-

tion (RDC algorithm).Format: number

Name: num_value1 Table: Gards_trendvue Description: First plot value.Format: number

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 7 :

R ad ion uc l id e C o l um n Desc r ip t ions

Name: num_value2 Table: Gards_trendvue Description: Second plot value.Format: number

Name: num_value3 Table: Gards_trendvue Description: Third plot value.Format: number

Name: num_value4 Table: Gards_trendvue Description: Fourth plot value.Format: number

Name: old_statusTable: Gards_status_history

Description: sample_status before changeFormat: char(1)

Name: original_area Table: Gards_peaks, Gards_peaks_orig Description: Original peak area.Format: number Units: countsRange: original_area > 0

641b e r 2 0 0 2

642

Chap te r 7 :

R a d ion uc l id e C o l um n Desc r ip t ion s

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: original_uncer Table: Gards_peaks, Gards_peaks_orig Description: Uncertainty of original peak area.Format: numberUnits: counts

Name: owner Table: Gards_dbrole_owner Description: Name of database user who owns the database roles for the MAR tool.Format: varchar(12)

Name: param Table: Gards_soh_code Description: SOH parameter name.Format: varchar2(30)

Name: param_code Table: Gards_soh_char_data, Gards_soh_code, Gards_soh_num_data Description: SOH parameter code.Format: number

Name: param_display Table: Gards_soh_code Description: Text of the SOH parameter to be displayed in Trendvue.Format: varchar2(30)

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 7 :

R ad ion uc l id e C o l um n Desc r ip t ions

Name: param_display_flag Table: Gards_soh_code Description: Flag that indicates if the SOH parameter should appear in Trendvue’s menu; 1

= the parameter will appear in Trendvue’s menu, 0 = the parameter will not appear in Trendvue’s menu.

Format: number

Name: pd_mod_flag Table: Gards_nucl_ided, Gards_nucl_ided_orig Description: Flag that indicates if a nuclide’s activity was modified by the parent/daughter

calculation; 1 = the activity was modified, 0 = no modification.Format: number

Name: peak Table: Gards_nucl_lines_ided, Gards_nucl_lines_ided_orig Description: Peak identifier associated with line.Format: number Range: peak > 0

Name: peak_end Table: Gards_proc_params_template, Gards_sample_proc_params Description: Spectrum energy at which the peak search terminates.Format: number Units: keVRange: peak_end > 0.0

643b e r 2 0 0 2

644

Chap te r 7 :

R a d ion uc l id e C o l um n Desc r ip t ion s

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: peak_id Table: Gards_comments, Gards_peaks, Gards_peaks_orig Description: Unique peak identifier.Format: number Range: peak_id > 0

Name: peak_sense Table: Gards_proc_params_template, Gards_sample_proc_params Description: User-configurable threshold that aids in peak identification. This column is a

multiplier of the digital filter. The smaller the peak_sense, the more likely a peak will be accepted.

Format: number Range: peak_sense > 0.0

Name: peak_sig Table: Gards_peaks, Gards_peaks_orig Description: Peak significance; the peak area divided by lc.Format: number

Name: peak_start Table: Gards_proc_params_template, Gards_sample_proc_params Description: Spectrum energy at which the peak search begins.Format: number Units: keVRange: peak_start > 0.0

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 7 :

R ad ion uc l id e C o l um n Desc r ip t ions

Name: peak_tol Table: Gards_peaks, Gards_peaks_orig Description: Per peak energy tolerance; this approximates the energy tolerance at a given

peak.Format: number

Name: permission_id Table: Gards_permissions, Gards_roles_permissions Description: Permission identifier.Format: number

Name: permission_name Table: Gards_permissions Description: String name of a permission.Format: varchar2(30)

Name: pocid Table: Gards_poc, Gards_receipt_log, Gards_stations Description: Unique point of contact identifier.Format: number Range: pocid > 0

645b e r 2 0 0 2

646

Chap te r 7 :

R a d ion uc l id e C o l um n Desc r ip t ion s

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: poll_time

Table: Gards_qat_config

Description: number of minutes rms_QAT sleeps between each database poll.Format: number

Name: pressure Table: Gards_environment Description: Outside air pressure.Format: number Units: millibarsRange: pressure > 0.0

Name: pss Table: Gards_peaks, Gards_peaks_orig Description: Peak search significance.Format: number

Name: q_time

Table: Gards_qat_config

Description: number of minutes after gards_sample_status.review_date that rms_QAT_autowaits before releasing a sample

Format: number

Name: quantity Table: Gards_sample_data Description: Air volume sampled.Format: number Units: m3

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 7 :

R ad ion uc l id e C o l um n Desc r ip t ions

Name: quantity Table: Gards_sample_cert Description: Total source activity.Format: number Units: Bq

Name: rated_efficiency Table: Gards_detectors Description: Efficiency of the detector relative to a standard 3 in. x 3 in. (7.62 cm x 7.62

cm) cylindrical NaI(Tl) detector at 1332 keV. The rated efficiency is usually supplied by the detector manufacturer.

Format: number Range: 0 < rated_efficiency < 130

Name: rated_resolution Table: Gards_detectors Description: Rated resolution of the detector, supplied by the manufacturer, at 1332 keV.Format: number Range: 0.0 < rated_resolution < 3.0

Name: ratio_id Table: Gards_sample_ratios Description: Ratio identifier.Format: varchar2(15)Range: 1 ≤ ratio_id ≤ 6

647b e r 2 0 0 2

648

Chap te r 7 :

R a d ion uc l id e C o l um n Desc r ip t ion s

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: recipient_list

Table: gards_qat_notify

Description: comma-separated list of users to whom notification was sentFormat: varchar2(128)

Name: ref_id Table: Gards_rlr Description: Sample reference identification.Format: varchar2(32)

Name: reference Table: Gards_aux_lines_lib Description: Reference for line properties.Format: varchar2(8)

Name: refpeak_energy Table: Gards_refline_master, Gards_update_reflines Description: Refline energy for a particular nuclide.Format: number Range: 0.0 < refpeak_energy

Name: report_mda Table: Gards_nucl_ided, Gards_nucl_ided_orig Description: Flag that indicates whether or not MDA is to be reported.Format: number Range: report_mda ∈ {–1, 0, 1}

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 7 :

R ad ion uc l id e C o l um n Desc r ip t ions

Name: rer_intercept Table: Gards_sample_update_params, Gards_update_params_template Description: Default RER intercept to be used during calculations.Format: number

Name: rer_slope Table: Gards_sample_update_params, Gards_update_params_template Description: Default RER slope to be used during calculations.Format: number

Name: res_energy Table: Gards_b_resolution_pairs, Gards_b_resolution_pairs_orig,

Gards_resolution_pairs, Gards_resolution_pairs_orig Description: Resolution energy.Format: number Units: keVRange: 0.0 < res_energy

Name: res_error Table: Gards_b_resolution_pairs, Gards_b_resolution_pairs_orig,

Gards_resolution_pairs, Gards_resolution_pairs_orig Description: Uncertainty of resolution.Format: number Units: keVRange: 0.0 < res_error

649b e r 2 0 0 2

650

Chap te r 7 :

R a d ion uc l id e C o l um n Desc r ip t ion s

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: resolution Table: Gards_b_resolution_pairs, Gards_b_resolution_pairs_orig,

Gards_resolution_pairs, Gards_resolution_pairs_orig Description: Detector resolution.Format: number Units: keV

Name: result Table: Gards_sample_flags Description: Indicator for the database flag tests. 0 indicates failure, 1 indicates a pass.Format: number

Name: revid Table: Gards_fpe Description: Revision number of the FPEB.Format: number Range: revid ≥ 1

Name: review_date Table: Gards_sample_status Description: Date sample was last reviewed.Format: date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 7 :

R ad ion uc l id e C o l um n Desc r ip t ions

Name: review_time Table: Gards_sample_status Description: Time duration of sample review. No longer automatically updated in Release

3.Format: number Units: minutesRange: review_time > 0

Name: right_fwhm_lim Table: Gards_proc_params_template, Gards_sample_proc_params Description: One of two user-configurable limits on the peak size. This column indicates

the maximum possible peak width to the right of the peak centroid, expressed in multiples of the FWHM.

Format: number Range: right_fwhm_lim > 0.0

Name: rlr_id Table: Gards_rlr Description: Unique radionuclide lab report identifier.Format: number

Name: rms_id Table: Gards_data_log, Gards_processing_errors

Description: Internal identifier for message; either the sample_id for PHDs, the rlr_id for RLRs, or the soh_id for SOHs.

Format: number

651b e r 2 0 0 2

652

Chap te r 7 :

R a d ion uc l id e C o l um n Desc r ip t ion s

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: roi Table: Gards_bg_efficiency_pairs, Gards_roi_channels, Gards_roi_concs,

Gards_roi_counts, Gards_roi_lib, Gards_roi_limits, Gards_sample_xe_proc_params, Gards_xe_proc_params_template

Description: Unique ROI identifier.Format: number

Name: role_id Table: Gards_dist_sample_queue, Gards_roles, Gards_roles_permissions,

Gards_users_roles Description: Role identifier.Format: number

Name: role_name Table: Gards_roles Description: String name of a role.Format: varchar2(30)

Name: rqst_id Table: Gards_query_results Description: Unique query identifier.Format: number Range: rqst_id > 0

Name: rqst_string Table: Gards_query_results Description: Data requested by a client using the IDC Event Screening Tool. Format: varchar2(100)

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 7 :

R ad ion uc l id e C o l um n Desc r ip t ions

Name: sample_diameter Table: Gards_sample_aux Description: Diameter of gas chamber.Format: number Units: cm

Name: sample_height Table: Gards_sample_aux Description: Height of the sample.Format: number Units: cmRange: sample_height > 0.0

Name: sample_id Table: Gards_auto_sample_cat, Gards_bg_efficiency_pairs, Gards_bg_energy_cal,

Gards_b_energy_pairs, Gards_b_energy_pairs_orig, Gards_b_resolution_pairs, Gards_b_resolution_pairs_orig, Gards_comments, Gards_dist_sample_queue, Gards_efficiency_cal, Gards_efficiency_pairs, Gards_energy_cal, Gards_energy_cal_orig, Gards_energy_pairs, Gards_energy_pairs_orig, Gards_environment, Gards_fpe, Gards_histogram, Gards_nucl_ided, Gards_nucl_ided_orig, Gards_nucl_lines_ided, Gards_nucl_lines_ided_orig, Gards_peaks, Gards_peaks_orig, Gards_qat_notify, Gards_qchistory, Gards_resolution_cal, Gards_resolution_cal_orig, Gards_resolution_pairs, Gards_resolution_pairs_orig, Gards_roi_channels, Gards_roi_concs, Gards_roi_counts, Gards_roi_limits, Gards_sample_aux, Gards_sample_cat, Gards_sample_cert, Gards_sample_cert_lines, Gards_sample_data, Gards_sample_description, Gards_sample_flags, Gards_sample_proc_params, Gards_sample_ratios, Gards_sample_status, Gards_sample_update_params, Gards_sample_xe_proc_params, Gards_spectrum, Gards_status_history, Gards_total_effic, Gards_user_comments

Description: Sample identifier.Format: number Range: sample_id > 0

653b e r 2 0 0 2

654

Chap te r 7 :

R a d ion uc l id e C o l um n Desc r ip t ion s

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: sample_ref_id Table: Gards_sample_aux, Gards_processing_errors

Description: Sample reference identifier (SRID).Format: varchar2(32)

Name: sample_status

Table: Gards_qat_query_filter

Description: comma-separated list of sample status valuesFormat: varchar2(128)

Name: sample_type Table: Gards_mdas2report, Gards_proc_params_template, Gards_relevant_nuclides,

Gards_sample_data, Gards_spectrum Description: Sample type indicator: P for particulate, G for gamma spectroscopy gas, B for

beta-gamma coincidence gas.Format: char(1)

varchar2(2) for gards_mdas2report Range: sample_type ∈ {B, G, P}

Name: score Table: Gards_energy_cal, Gards_energy_cal_orig Description: The score used when comparing this ECR to other ECRs; a measure of both

the ape and the determinant. Format: number

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 7 :

R ad ion uc l id e C o l um n Desc r ip t ions

Name: sdmult Table: Gards_qcparams Description: Standard deviation multiplier for the K-40 location test. This column value is

usually equal to 3 standard deviations.Format: number NA Value: –999.0 Range: sdmult = 3

Name: sensor_name Table: Gards_soh_sensor_data Description: Unique sensor name to distinguish between sensors of the same type.Format: varchar2(20)

Name: sensor_type Table: Gards_soh_sensor_data Description: Type of sensor (TEMP, PRESSURE, PROCESSFLOW, VOLTAGE, COUN-

TRATES, DEWPOINT, CO2VOLUME).Format: varchar2(20)

Name: session_id Table: Gards_trendvue Description: Unique identifier assigned to a Trendvue session.Format: number Range: 0 < session_id

Name: site_det_code Table: Gards_sample_data Description: Station code concatenated with detector code.Format: char(15)

655b e r 2 0 0 2

656

Chap te r 7 :

R a d ion uc l id e C o l um n Desc r ip t ion s

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: soh_id Table: Gards_soh_header Description: SOH identifier.Format: number

Name: spectral_qualifier Table: Gards_proc_params_template, Gards_refline_master, Gards_sample_data,

Gards_update_reflines Description: Time for which sample was exposed: FULL or PREL (preliminary).Format: varchar2(5)

Name: squant_err Table: Gards_proc_params_template, Gards_sample_proc_params Description: Uncertainty in the air volume of a sample. This value is used to determine the

uncertainty in the activity concentration. (No longer used in Release 3 pro-cessing.)

Format: number Units: m3

Range: squant_err > 0

Name: start_time Table: Gards_interval, Gards_met_data Description: Date of data sampling commencement.Format: date

float for gards_interval

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 7 :

R ad ion uc l id e C o l um n Desc r ip t ions

Name: state Table: Gards_qchistory, Gards_interval Description: Text results of quality control hypothesis test (gards_qchistory). Specific

activity of detector or system (gards_interval).Format: varchar2(128)

varchar2(16) for gards_interval

Name: station_code Table: Gards_alerts, Gards_processing_errors, Gards_stations Description: Station code.Format: varchar2(5)

char(5) for gards_alerts

Name: station_id Table: Gards_alerts, Gards_cat_template, Gards_data_log, Gards_met_data,

Gards_nucl_ided, Gards_nucl_ided_orig, Gards_nucl_lines_ided, Gards_nucl_lines_ided_orig, Gards_proc_params_template, Gards_qchistory, Gards_qctargets, Gards_rlr, Gards_sample_data, Gards_soh_char_data, Gards_soh_header, Gards_soh_num_data, Gards_soh_sensor_data, Gards_stadet, Gards_stations, Gards_stations_schedule, Gards_station_assignments, Gards_update_reflines

Description: Unique station identifier.Format: number Range: station_id > 0

657b e r 2 0 0 2

658

Chap te r 7 :

R a d ion uc l id e C o l um n Desc r ip t ion s

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: station_list

Table: Gards_qat_query_filter

Description: comma-separated list of stationsFormat: varchar2(1024)

Name: status Table: Gards_data_log Description: Status of data msg_id processing; P - processed or U - unprocessed.Format: char(1) Range: status ∈ {P, U}

Name: status Table: Gards_detectors Description: Status of detector: if Y, then data from this detector are automatically pro-

cessed; if N, then they are not processed automatically.Format: varchar2(2) Range: status ∈ {N, Y}

Name: status Table: Gards_stations Description: Status of station: if NULL, then station is fully operational, otherwise status is

I.Format: varchar2(2) Range: status ∈ {I}

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 7 :

R ad ion uc l id e C o l um n Desc r ip t ions

Name: status Table: Gards_sample_status Description: Current processing status of sample. Some possible values are: A - analyzed, P

- processed, R - reviewed, U - unprocessed, V - viewed. Format: char(1) Range: status ∈ {A, P, R, U, V}

Name: t_time

Table: gards_qat_config

Description: number of minutes after gards_sample_status.entry_date that rms_QAT_autowaits before releasing a sample.

Format: number

Name: telephone Table: Gards_poc Description: Telephone number of the point of contact.Format: varchar2(20)

Name: temperature Table: Gards_environment Description: Outside temperature.Format: number Units: degrees C

Name: temporal_unit Table: Gards_stations_schedule Description: Units for schedule period - currently only the value DAYS is supported.Format: char(5)

659b e r 2 0 0 2

660

Chap te r 7 :

R a d ion uc l id e C o l um n Desc r ip t ion s

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: temporal_value Table: Gards_stations_schedule Description: Expected station schedule period.Format: number

Name: test Table: Gards_flags Description: Calculated result of the test; this value is compared to the threshold value.

(examples are <, =, >, >=).Format: varchar2(8)

Name: test_code

Table: Gards_cat_criteria_tests

Description: unique test code identifier stringFormat: varchar2(24)

Name: test_date Table: Gards_rlr Description: Test completion date at lab.Format: date

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 7 :

R ad ion uc l id e C o l um n Desc r ip t ions

Name: test_id

Table: Gards_cat_criteria_tests

Description: unique identifierFormat: number

Name: test_name

Table: Gards_cat_criteria_tests

Description: test name label for displayFormat: varchar2(48)

Name: threshold Table: Gards_flags Description: Threshold against which the results in the test column are compared.Format: number

Name: total_rainfall Table: Gards_met_data Description: Total rainfall.Format: number Units: millimetersRange: 0.0 ≤ total_rainfall

Name: transmit_date Table: Gards_rlr Description: Transmit date.Format: date

661b e r 2 0 0 2

Name: transmit_dtg Table: Gards_sample_data, Gards_soh_header Description: Date of sample data message transmittal.Format: date

Name: tstat Table: Gards_cat_template, Gards_energy_cal, Gards_energy_cal_orig Description: T-statistic confidence level (gards_energy_cal, gards_energy_cal_orig).

Multiplier applied to variance estimate for defining prediction interval (gards_nic_init).

Format: number Range: tstat > 0.0

Name: type Table: Gards_codes Description: Category of code.Format: varchar2(15)

Name: type Table: Gards_detectors, Gards_stations Description: Brief description of detector or station.Format: varchar2(6) Range: ASCII characters

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 7 :

R ad ion uc l id e C o l um n Desc r ip t ions

Name: type Table: Gards_mdas2report, Gards_nucl_ided, Gards_nucl_ided_orig, Gards_nucl_lib,

Gards_relevant_nuclides, Gards_xe_nucl_lib Description: Nuclide type. Choices are: ACTIVATION, COSMIC, FISSION(G), FIS-

SION(P), or NATURAL.Format: varchar2(16) Range: type ∈ {ACTIVATION, COSMIC, FISSION(G), FISSION(P), NATURAL}

Name: type Table: Gards_receipt_log Description: Data type of message.Format: varchar2(5)

Name: unit Table: Gards_soh_code Description: Unit in which the SOH parameter is stored.Format: varchar2(32)

Name: units Table: Gards_cat_criteria_tests, Gards_flags,Description: Unit values for the test bounds; Units of the event screening test. Format: varchar2(16)

Name: upper_bound Table: Gards_auto_sample_cat, Gards_cat_template, Gards_sample_cat Description: Upper limit of the amount of a nuclide that can be acceptably found.Format: number

663b e r 2 0 0 2

664

Chap te r 7 :

R a d ion uc l id e C o l um n Desc r ip t ion s

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: upper_limitTable: Gards_cat_criteria_tests

Description: upper limit bound of the testFormat: number

Name: upper_roi_number Table: Gards_sample_ratios Description: ROI number associated with the upper ROI.Format: numberRange: 1 ≤ upper_roi_number ≤ 6

Name: use_mult Table: Gards_sample_update_params, Gards_update_params_template Description: Flag for using multiplets in determining matches. A value of 0 indicates not to

use multiplets; 1 indicates the use of multiplets.Format: number Range: use_mult ∈ {0,1}

Name: use_review_cat

Table: Gards_qat_query_filter

Description: flag for reviewed or auto categorizationFormat: number

Name: use_weight Table: Gards_sample_update_params, Gards_update_params_template Description: Flag for controlling of weights in ECR updating. A value of 0 indicates not to

use weights; 1 indicates the use of weights.Format: number Range: 0 ≤ use_weight ≤ 1

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 7 :

R ad ion uc l id e C o l um n Desc r ip t ions

Name: user

Table: Gards_status_history

Description: user making status changeFormat: varchar2(30)

Name: user_id Table: Gards_dist_sample_queue, Gards_qat_query_filter, Gards_station_assignments,

Gards_users, Gards_users_roles Description: User identifier.Format: number

Name: user_name Table: Gards_users Description: String name for a user database login name.Format: varchar2(30)

Name: value Table: Gards_sample_flags Description: Threshold value for the test.Format: number

Name: value Table: Gards_soh_char_data, Gards_soh_num_data, Gards_soh_sensor_data

Description: Value of the specified SOH parameter.Format: number

665b e r 2 0 0 2

666

Chap te r 7 :

R a d ion uc l id e C o l um n Desc r ip t ion s

U s e r G u i d e sI D C D O C U M E N T A T I O N

Name: value Table: Gards_userenv Description: Variable name.Format: varchar2(256)

Name: width Table: Gards_peaks, Gards_peaks_orig Description: Width of peaks (channels).Format: number Range: width > 0

Name: width_adj Table: Gards_qcparams Description: Peak width standard deviation inflation factor.Format: number

Name: xe_collect_yield Table: Gards_sample_aux Description: Xe collection yield of the system; volume of stable Xe on detector/volume of

stable Xe collected on first trap.Format: number

Name: xe_collect_yield_err Table: Gards_sample_aux Description: Uncertainty of xe_collect_yield.Format: number

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

Cha p te r 7 :

R ad ion uc l id e C o l um n Desc r ip t ions

Name: xe_volume Table: Gards_sample_aux Description: Volume of stable Xe in gas cell counter.Format: numberUnits: cm3

Name: xe_volume_err Table: Gards_sample_aux Description: Uncertainty of xe_volume.Format: numberUnits: cm3

Name: xform Table: Gards_cat_template

Description: Code for transform function applied to measurement data (1 = log, 2 = square root, 3 = none).

Format: number Range: xform ≥ 0.0

Name: zeroshift Table: Gards_sample_update_params, Gards_update_params_template Description: Change in channel number at 0 keV between one spectrum and the previous

spectrum.Format: number Range: zeroshift ≥ 0.0

667b e r 2 0 0 2

668

Chap te r 7 :

R a d ion uc l id e C o l um n Desc r ip t ion s

U s e r G u i d e sI D C D O C U M E N T A T I O N

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

R e f e r e n c e s

The following sources supplement or are referenced in document:

[And90a] Anderson, J., Farrell, W., Garcia, K., Given, J., and Swanger, H., CSS Version 3 Database: Schema Reference Manual, Science Applications International Corporation, 1990.

[Car97] Carter, J., and Bowman, J. R., IDC Database Schema, CMR-97/28, 1997.

[Fli74] Flinn, E. A., Engdhal, E. R., and Hill, A. R., “Seismic and Geographical Regionalization,” Bulletin of the Seismological Society of America, Volume 64, No. 3, Part ii, pp. 771-992, 1974.

[Gan79] Gane, C., and Sarson, T., Structured Systems Analysis: Tools and Techniques, Prentice-Hall, Inc., Englewood Cliffs, NJ, 1979.

[IDC5.1.1] Science Applications International Corporation, Pacific-Sierra Research, Inc., Database Schema (Part 1 and Part 2), SAIC-98/3009, PSR-98/TN1127, 1998.

[IDC5.1.1Rev1] Science Applications International Corporation, Pacific-Sierra Research Corporation, Database Schema (Parts 1, 2, and 3), Revision 1, SAIC-99/3009, PSR-99/TN1142, 1999.

[IDC5.1.1Rev5] Science Applications International Corporation, Veridian Systems, Database Schema, (Part 1, Part 2, and Part 3), Revision 5, TN2924, October 2002.

[IDC5.1.2] Science Applications International Corporation, Pacific-Sierra Research Corporation, Database Tutorial, SAIC-99/3022, PSR-99/TN1145, 1999.

b e r 2 0 0 2 R669

R670

▼ R e fe r e nc es

U s e r G u i d e sI D C D O C U M E N T A T I O N

[IDC5.1.3Rev0.1] Science Applications International Corporation, Veridian Pacific-Sierra Research, Configuration of PIDC Databases, Revision 0.1, SAIC-01/3022, PSR-99/TN1114, 2001.

[IDC7.1.1] Science Applications International Corporation, Detection and Feature Extraction (DFX)–Scheme Files, SAIC-01/3000, 2001.

[IDC7.1.3] Science Applications International Corporation, Surface Wave Identification and Measurement, SAIC-01/3008, 2001.

[IDC7.1.4] Science Applications International Corporation, Global Association (GA) Subsystem, SAIC-01/3009, 2001.

[IDC7.1.5] Science Applications International Corporation, Event Location Software, SAIC-01/3010, 2001.

[IDC7.1.6] Science Applications International Corporation, Event Magnitude Software, SAIC-01/3011, 2001.

[IDC7.1.10Rev3] Veridian Systems, Radionuclide Software Design, Revision 3, TN2927, October 2002.

[IDC7.1.11] Science Applications International Corporation, WaveExpert, SAIC-00/3029, 2000.

[IDC7.1.12] Science Applications International Corporation, Station Processing (StaPro), SAIC-00/3013, 2000.

[IDC7.3.1] Science Applications International Corporation, Distributed Application Control System (DACS), SAIC-01/3001, 2001.

[IDC7.4.1] Science Applications International Corporation, Continuous Data Subsystem CD–1.1, SAIC-01/3012, 2001.

[IDC7.4.2] Science Applications International Corporation, Pacific-Sierra Research Corporation, Message Subsystem, SAIC-98/3003, 1998.

[IDC7.4.3] Science Applications International Corporation, Retrieve Subsystem, SAIC-01/3024, 2001.

[IDC7.4.4] Science Applications International Corporation, Subscription Subsystem, SAIC-98/3001, 1998.

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

U s e r G u i d e sI D C D O C U M E N T A T I O N

▼References

[IDC7.5.1] Science Applications International Corporation, Archiving Subsystem, SAIC-01/3013, 2001.

[Swa91] Swanger, H., Given, J., and Anderson, J., IMS Extensions to the Center Version 3 Database, Science Applications International Corporation, SAIC-91/1138, 1991.

[Swa93] Swanger, H., Anderson, J., Sereno, T., Given, J., and Williams, D., Extensions to the Center Version 3 Database, Revision 1, Science Applications International Corporation, SAIC-93/1123, 1993.

R671b e r 2 0 0 2

U s e r G u i d e sI D C D O C U M E N T A T I O N

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

G l o s s a r y

Selected definitions in this glossary include prefixes of either “R: ” or “S/H/I: .” Definitions applicable only to the radionuclide technology include the “R: ” prefix; definitions applicable only to seis-mic, hydroacoustic, or infrasonic technolo-gies include the “S/H/I: ” prefix.

Symbols

2-DTwo-dimensional.

3-CThree-component.

β

R: Beta particle.

γ

R: Gamma particle.

µBqR: MicroBecquerels.

µPaMicroPascals.

A

abundanceR: Fraction of a decay event that results in the radiation(s) or interest (for example, a gamma line at a specific energy or a beta-gamma coincidence pair). Intensity is sometimes used to mean abundance.

activation productsR: Nuclides produced from the absorption of a neutron by a nucleus.

activityR: Decay rate of a radionuclide; usually expressed in Becquerels (disintegrations per second), Bq.

ampAmplitude.

amplitudeS/H/I: Zero-to-peak height of a waveform in nanometers.

arrayS/H/I: Collection of sensors distributed over a finite area (usually in a cross or con-centric pattern) and referred to as a single station.

arrivalS/H/I: Signal that has been associated to an event. First, the Global Association (GA) software associates the signal to an event.

G673b e r 2 0 0 2

▼ Gloss a ry

U s e r G u i d e sI D C D O C U M E N T A T I O N

G674

Later during interactive processing, many arrivals are confirmed and improved by visual inspection.

ASCIIAmerican Standard Code for Information Interchange. Standard, unformatted 256-character set of letters and numbers.

attribute(1) A database column. S/H/I: (2) Charac-teristic of an item; specifically, a quantita-tive measure of a S/H/I arrival such as azimuth, slowness, period, and amplitude.

authentication signatureSeries of bytes that are unique to a set of data and that are used to verify the authen-ticity of the data.

B

backgroundR: Contribution to a spectrum from natu-rally occurring radionuclides as well as interactions between radiation and materi-als in the vicinity of the detector.

baselineR: Contribution to a spectrum from the par-tial energy deposition of a gamma-ray in a detector.

beta-gamma coincidence eventR: Nuclear decay that produces both a gamma ray and a beta particle within a very short time scale. May also refer to other photon-electron coincidence events such as an X-ray with a conversion electron.

beta particleR: Electron that is produced from a nuclear decay. May also refer to other electron radi-ations, for example, a conversion electron.

blank subtractionR: Process of removing counts from a sam-ple spectrum or a region of interest within a sample spectrum originating from the air filter.

BLANKPHDR: Blank Pulse Height Data; ASCII data message containing the pulse height data of an unexposed air filter, as well as other information, in an IDC-approved format.

C

CALIBPHDR: Calibration Pulse Height Data; ASCII data message containing the pulse height data of a certified standard source, as well as other information, in an IDC-approved format. The data in a CALIBPHD are used to determine the ECR, EER, and RER.

calibration coefficientsR: Numbers that define the energy, resolu-tion, and efficiency equations.

centroidR: Energy (in keV) or channel number at the center of a fitted peak.

channelR: Energy window (in keV) representing a differential increment of pulse height.S/H/I: Component of motion or distinct stream of data.

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

U s e r G u i d e sI D C D O C U M E N T A T I O N

▼Glos sa ry

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

cmCentimeter.

coherentS/H/I: Quality of having a fixed phase rela-tionship; as signals from a wavefront detected on numerous seismic or infrasonic array station elements.

concentrationR: Activity per unit volume of air.

cosmogenic nuclidesR: Nuclides produced by the interaction of cosmic-rays with matter.

counts R: Number of pulses observed within a spectrum channel.S/H/I: Units of digital waveform data.

critical level/limitR: Minimum net counts that must be con-tained in an ROI for nuclide identification (Lc).

CSCIComputer Software Configuration Item.

CTBTComprehensive Nuclear Test-Ban Treaty (the Treaty).

D

DBDatabase.

dBDecibel.

definingS/H/I: Arrival attribute, such as arrival time, azimuth, or slowness, which is used in calculating the event’s location or magni-tude.

defining phaseS/H/I: Associated phase for which features are used in the estimation of the location and origin time of an S/H/I event.

DETBKPHDR: Detector Background Pulse Height Data; ASCII data message containing the pulse height data from a background count, as well as other information, in an IDC-approved format.

detection limitR: The smallest amount of activity that can be reliably detected and quantified in a spectrum. This quantity is used to deter-mine the MDC.

E

ECRR: Energy versus Channel Regression; an equation providing the initial detector-spe-cific relationship between channel number and energy. The equation contains calibra-tion coefficients and is estimated from a transmitted calibration dataset.

G675b e r 2 0 0 2

▼ Gloss a ry

U s e r G u i d e sI D C D O C U M E N T A T I O N

G676

ECRUR: Energy versus Channel Regression Update; an equation providing the final detector-specific relationship between channel number and energy.

EERR: Efficiency versus Energy Regression; an equation providing the detector-specific relationship between efficiency and energy.

energyR: Usually refers to the measured kinetic energy of radiation quanta deposited in a detector. The unit most appropriate for such measurements is keV.S/H/I: Occurrence that displays characteris-tics indicative of a possible nuclear weap-ons test.

epoch timeNumber of seconds after January 1, 1970 00:00:00.0.

eventR: Occurrence that displays characteristics indicative of a possible nuclear weapons test.S/H/I: Unique source of seismic, hydroa-coustic, or infrasonic wave energy that is limited in both time and space.

EWMAR: Exponentially Weighted Moving Aver-age; statistical filter that recursively gener-ates a prediction interval using past observations weighted in an exponential fashion. This filter is useful for determining anomalous radionuclide concentrations for categorization purposes.

F

FFTFast Fourier Transform.

fission (P)R: Particulates created in a fission event.

fission (G)R: Gases created in a fission event.

f-kS/H/I: Frequency versus wavenumber (k) analysis that maps phase power from an array as a function of azimuth and slow-ness.

FPIDR: Fission Product Identification.

FTPFile Transfer Protocol; protocol for trans-ferring files between computers.

FULL SPHDR: Full Sample Pulse Height Data; ASCII data message containing the pulse height data of a sample acquired for a complete collection interval, as well as other infor-mation, in an IDC-approved format.

FWHMR: Full Width at Half-Maximum; metric of detector resolution and equivalent to the width of a photopeak (in keV) taken at the peak height equal to half the maximum peak counts.

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

U s e r G u i d e sI D C D O C U M E N T A T I O N

▼Glos sa ry

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

G

gGram.

GAS/H/I: Global Association application. GA associates S/H/I phases to events.

gammaR: Gamma-ray.

gamma rayR: Photon that is produced from a nuclear transition; may also imply other photon radiations, for example, an X-ray.

GARDSR: Global Atmospheric Radionuclide Detection System; the network of radionu-clide monitoring stations that meet CTBT requirements and transmit radionuclide data to the IDC with coordination by the IDC.

GASBKPHDR: Gas Background Pulse Height Data. Data type sent by noble gas monitoring sys-tems that observe a memory effect during sample acquisition due to atoms from the previous sample adsorbed onto the walls of the gas cell. The counts from the memory effect must be subtracted from the sample counts for accurate activity quantification.

GMTGreenwich Mean Time.

GSETT-3S/H/I: Group of Scientific Experts Third Technical Test.

H

hydroacousticS/H/I: Pertaining to sound in the ocean.

I

IDCInternational Data Centre.

IEEEInstitute for Electrical and Electronic Engi-neers.

IIRInfinite Impulse Response (filters also referred to as recursive filters).

IMSInternational Monitoring System.

infrasonicS/H/I: Pertaining to low-frequency (sub-audible) sound in the atmosphere.

InternetWorld-wide network of computers linked by means of the IP protocol.

IPInternet protocol.

K

KBKilobyte. 1,024 bytes.

G677b e r 2 0 0 2

▼ Gloss a ry

U s e r G u i d e sI D C D O C U M E N T A T I O N

G678

keVR: Kiloelectron Volts; a metric of kinetic energy.

keylineR: Photon with the highest detection proba-bility.

L

Lc

R: Critical level.

localS/H/I: (1) (distance) Source to seismometer separations of a few degrees or less. (2) (event) Recorded at distances where the first P and S waves from shallow events have trav-eled along direct paths within the crust.

M

m(1) Meter(s). (2) Megabyte(s); 1,024 kilo-bytes. (3) Month(s). (4) Minute(s).

mb

S/H/I: Magnitude of a seismic body wave.

mbarMillibar.

mbmleS/H/I: Magnitude of an event based on maximum likelihood estimation using seis-mic body waves.

mBqR: MilliBecquerel.

MDAR: Minimum Detectable Activity.

MDCR: Minimum Detectable Concentration.

minimum detectable concentrationR: Activity concentration of a given radio-nuclide that is indistinguishable from the measurement process noise level.

ML

S/H/I: Magnitude based on waves mea-sured near the source.

mmMillimeter.

monitoring systemSee IMS and RMS.

Ms

S/H/I: Magnitude of seismic surface waves.

msmleS/H/I: Magnitude of an event based on maximum likelihood estimation using sur-face waves.

multipletR: Spectral region of interest comprised of more than one photopeak.

N

NANot Applicable.

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

U s e r G u i d e sI D C D O C U M E N T A T I O N

▼Glos sa ry

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

NDCNational Data Center.

NIDNuclide Identification.

nmNanometer.

nondefiningS/H/I: Arrival attribute, such as arrival time, azimuth, or slowness, which is associ-ated, but not used in calculating the event’s location or magnitude.

nondefining phaseS/H/I: Associated phase for which features are not used in the estimating the location and origin time of an S/H/I event.

NSENoise Spectrum Equalization.

nuclideR: One of many combinations of nucleons that may comprise an atomic nucleus. Because all nuclides of interest with respect to CTBT compliance verification are radio-active, this term is often used to refer spe-cifically to radionuclides.

O

Operations ManualsTreaty-specified, formal documents that describe how to provide data, receive IDC products, access the IDC database, and evaluate the performance of the IDC.

ORACLEVendor of PIDC and IDC database manage-ment system.

originS/H/I: Hypothesized time and location of a seismic, hydroacoustic, or infrasonic event. Any event may have many origins. Charac-teristics such as magnitudes and error esti-mates may be associated with an origin.

P

parameter (par) fileASCII file containing values for parameters of a program. Par files are used to replace command line arguments. The files are for-matted as a list of [token = value] strings.

peakR: Statistically significant increase in counts above a spectrum baseline at an energy associated with a gamma line of a particular radionuclide or other phenome-non.

PHDR: Pulse Height Data; a format for spectral data messages. Possible PHD data message types include BLANKPHD, CALIBPHD, DETBKPHD, GASBKPHD, QCPHD, and SAMPLEPHD.

PIDCPrototype International Data Centre.

G679b e r 2 0 0 2

▼ Gloss a ry

U s e r G u i d e sI D C D O C U M E N T A T I O N

G680

polarizationS/H/I: Form of three-component analysis used to derive azimuth and slowness infor-mation from non-array stations.

PREL SPHDR: Preliminary Sample Pulse Height Data; ASCII data message containing the pulse height data of a sample acquired for less than a complete collection interval, as well as other information.

primary seismicS/H/I: IMS seismic station(s) or data that is (are) part of the detection network.

PSR: Peak Search.

Q

QCQuality Control.

QCPHDR: Quality Control Pulse Height Data; ASCII data message containing the pulse height data of a certified source as well as other information. Information in the QCPHD, along with other data, is used to check a detector’s state of health.

quefrencyS/H/I: Time-delay axis with units of sec-onds for a cepstrum.

R

RR: Radionuclide.

radioactivityR: See activity.

radionuclideR: Nuclide that has an unstable nucleus, that is, a radioactive nuclide.

REBS/H/I: Reviewed Event Bulletin; the bulle-tin formed of all S/H/I events that have passed analyst inspection and quality assur-ance review.

region of interestR: Region of a radionuclide spectrum or histogram that corresponds to a particular radionuclide.

regionalS/H/I: (1) (distance) Source to seismometer separations between a few degrees and 20 degrees. (2) (event) Recorded at distances where the first P and S waves from shallow events have traveled along paths through the uppermost mantle.

RERR: Resolution (versus) Energy Regression; an equation providing the initial detector-specific relationship between resolution and energy. This equation contains calibra-tion coefficients and is interpolated from a transmitted calibration spectrum.

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

U s e r G u i d e sI D C D O C U M E N T A T I O N

▼Glos sa ry

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

residualS/H/I: Difference in time, azimuth, or slow-ness between a calculated attribute and its corresponding theoretical value.

RLRR: Radionuclide Lab Report; report con-taining sample analysis results from a certi-fied radionuclide laboratory.

RMSR: Radionuclide Monitoring System; the part of the IMS that monitors the atmo-sphere for radionuclides.

RNPSR: Radionuclide Network Product Sum-mary; daily report containing a summary of the Radionuclide Network for a three-day period, including the data received, their products, and any relevant nuclides.

ROIR: Region of interest.

RRRR: Reviewed Radionuclide Report. Elec-tronic file containing the final results of the interactive review of the automated radio-nuclide processing. It contains sections on sample information, measurement categori-zation, measured radionuclide quantities, MDCs, radionuclide identification, analyst editing, processing parameters, data quality flags, event screening flags, calibration equations, and field of regard.

S

SAICScience Applications International Corpo-ration.

sampleAny physical entity counted on a detector.

SAMPLEPHDR: Sample Pulse Height Data; ASCII data message containing pulse height data acquired by counting a gas or particulate sample with a detector system.

S/H/IS/H/I: Seismic, hydroacoustic, and infra-sonic.

SIDR: Sample ID; unique alphanumeric string assigned to a sample during the automated processing for identification and account-ing purposes.

singletR: Spectrum photopeak consisting of counts from one mono-energetic gamma-ray; photopeak containing counts from multiple photons, but fit as if it is com-prised of counts from only one because contributions from the individual radiations cannot be separated, as in a multiplet.

SLSDS/H/I: Standard List of Signal Detections.

SOHState of Health; indicator of a system’s operability.

G681b e r 2 0 0 2

▼ Gloss a ry

U s e r G u i d e sI D C D O C U M E N T A T I O N

G682

spectrumR: Plot of the differential number of pulses (in counts) per differential pulse height (in channels or keV).S/H/I: Plot of the energy contained in waveforms as a function of frequency.

SPHDR: Sample Pulse Height Data; ASCII data message type containing the pulse height data of a sample, as well as other informa-tion. The two types of SPHDs are full and preliminary. See FULL SPHD and PREL SPHD.

SQLStructured Query Language; a language for manipulating data in a relational database.

SSREBR: Standard Screened Radionuclide Event Bulletin; bulletin generated by the IDC when fission or activation products are detected at a radionuclide station above normal limits. A SSREB contains informa-tion on the possible event, source location, fission products, activation products detected, any isotopic ratios calculated, and any certified laboratory results. New event information can be added to the SSREB as it arrives, therefore, multiple revisions of an SSREB are possible.

STA/LTAS/H/I: Short-term average/long-term aver-age ratio.

Sum/NaturalR: Artificial entries in the nuclide library that enable the automated processing to identify commonly observed sum peaks in a spectrum.

T

taxonomySystematic arrangement; classification.

TCP/IPTransmission Control Protocol/Internet Protocol.

teleseismicS/H/I: (1) (distance) Source to seismometer separations of 20 degrees or more. (2) (event) Recorded at distances where the first P and S waves from shallow events have trav-eled paths through the mantle/core.

time seriesS/H/I: Time ordered sequence of data sam-ples. Typically a waveform or derived from waveforms, such as a beam.

TreatyComprehensive Nuclear Test-Ban Treaty (CTBT).

Type I ErrorR: Spectral region of interest falsely identi-fied as a peak by the automated processing.

Type II ErrorR: Peak undetected by the automated pro-cessing.

O c t o b e r 2 0 0 2 I D C - 5 . 1 . 1 R e v 5

D a t a b a s e S c h e m a

U s e r G u i d e sI D C D O C U M E N T A T I O N

▼Glos sa ry

D a t a b a s e S c h e m a

I D C - 5 . 1 . 1 R e v 5 O c t o

G683b e r 2 0 0 2

Top Related