Transcript
Page 1: NO. 8/8 FLORIDA STATE SEMINOLES (22-4, 12-3 ACC) AT NC STATE WOLFPACK (17-9, 8-7 … · 2020-02-21 · no. 8/8 florida state seminoles (22-4, 12-3 acc) at . nc state wolfpack (17-9,

NO. 8/8 FLORIDA STATE SEMINOLES (22-4, 12-3 ACC)

AT NC STATE WOLFPACK (17-9, 8-7 ACC)

PNC ARENA (19,722) RALEIGH, NORTH CAROLINA

SATURDAY, FEBRUARY 22, 2020; 4:00 P.M. SEMINOLE IMG RADIO NETWORK (GENE DECKERHOFF, KEITH JONES) ACC NETWORK (WES DURHAM, JORDAN CORNETTE, KATIE GEORGE)

“The captain of the Seminoles is Trent Forrest – an outstanding guard who might be one of the best defensive players not only in the ACC but in college basketball.”

Wes Durham ACC Legend

NO. 8 SEMINOLES MAKE FINAL REGULAR SEASON TRIP TO TOBACCO ROAD TO FACE NC STATE Florida State, which has been ranked in the nation’s top-10 for a school-record seven consecutive weeks, travels to play at NC State on Saturday, February 22, 2020 at 4:00 p.m. and the PNC Arena in Raleigh, N.C. The Seminoles defeated Pittsburgh, 82-67, on Tuesday in Tallahassee and arrive to play the Wolfpack having won two straight, five of their last six and 15 of their last 17 games since defeating Clemson at home on December 8, 2019. Florida State has won 22 games – the school-record fourth consecutive season the team has won at least 22 games and the second time in the last four seasons they have earned at least 22 wins by February 20. Florida State won a school-record 29 games and finished the season in the Sweet 16 of the NCAA Tournament with a 29-8 record during the 2018-19 season and has won 100 games in the last four seasons for an average of 25 wins per season. The Seminoles have won 12 ACC games this season marking the second consecutive season they have won at least 12 conference games after winning a school-record 13 ACC games a year ago. Following Saturday’s game at NC State, the Seminoles play host to No. 11 Louisville on Monday, February 24 at 7:00 p.m.at the Donald L. Tucker Center. SEMINOLES’ HAMILTON AMONG TOP FIVE WININGEST COACHES IN ACC HISTORY Leonard Hamilton is now among the top five winningest coaches in ACC men’s basketball history in both ACC games won with 167, and in overall wins while in the ACC with 356. SEMINOLES’ FORREST HITS THE CENTURY MARK Senior Trent Forrest scored 10 points and led Florida State to an 82-67 win over Pittsburgh on Tuesday night in Tallahassee. The win was Forrest’s 100th of his career as a Seminole. He is the winningest player in school history and the first player to reach 100 victories during his career at Florida State. FLORIDA STATE IN THE LAST FOUR YEARS Florida State has an overall record of 100-33 and a winning percentage of .752 since the start of the 2016-17 season. SEMINOLES’ FORREST MOVES INTO TOP-25 IN THE ACC FOR CAREER STEALS Senior Trent Forrest totaled two steals in Florida State’s victory over Pittsburgh on Tuesday in Tallahassee and enters Saturday’s game against NC State ranked 25th in ACC history with 219 career steals. He surpassed Duke legend Grant Hill who totaled 218 steals during his illustrious career as one of the ACC’s greatest players (1991-94). As play begins against NC State on Saturday, he is chasing Wolfpack legend Sidney Lowe who totaled 220 career steals (1980-83) and Virginia legend Othell Wilson who totaled 222 career steals (1981-84). Forrest is chasing Seminole legend Charlie Ward for the title of Florida State’s Chief Thief. Ward earned a school-record 238 career steals (1991-94). NOTING FLORIDA STATE’S 20 WIN SEASONS Florida State enters Saturday’s game against NC State with a 22-4 record in its first 26 games of the 2019-20 season. The Seminoles’ 22 wins already this season marks the school-record fifth consecutive season the Seminoles have won at least 20 games. Head Coach Leonard Hamilton, who averages 19.8 wins per season at Florida State, has led the Seminoles to at least 20 wins in 12 of his 18 seasons leading the program. Prior to his arrival at Florida State, the Seminoles had won 20 or more games 11 times since the program’s first season (1947-48). He has led the Seminoles to at least 20 wins in 12 of the last 15 seasons. Hamilton guided the Seminoles to a single-season school record 29 wins during the 2018-19 season. LOOK FOR FLORIDA STATE TO… …Defeat NC State and win its 23rd game of the season. It would mark the school record fourth consecutive season the Seminoles would have won at least 23 games in a single season. Florida State won 26 games in 2016-17, 23 games in 217-18 and 29 games in 2018-19; …Defeat NC State and win is school record tying 13th ACC game of the season. The Seminoles won 13 ACC games during the 2018-19 season, finished with a 13-5 record and earned the No. 4 seed in the ACC Tournament; …Defeat NC State and win its fifth ACC road game of the season. The Seminoles have won on the road at Louisville, at Wake Forest, at Miami and at Virginia Tech and have three ACC road games remaining beginning with their game at NC State. Florida State won five ACC games on the road during the 2018-19 season.

2019-20 Florida State Schedule/Results O22 1 Barry University W, 95-66 N1 1 Columbus State W, 84-54 N6 * at Pittsburgh L, 61-63 N10 at Florida W, 63-51 N15 Western Carolina W, 79-74 N20 2 Chattanooga W, 89-53 N23 Saint Francis (Pa.) W, 80-65 N25 2 Chicago State W, 113-56 N29 3 vs. Tennessee W, 60-57 N30 3 vs. Purdue W, 63-60 (ot) D3 at Indiana L, 64-80 D8 * Clemson W, 72-53 D17 North Florida W, 98-81 D21 USF W, 66-60 D28 North Alabama W, 88-71 D31 * Georgia Tech W, 70-58 J4 * at Louisville W, 78-65 J8 * at Wake Forest W, 78-68 J15 * Virginia W, 54-50 J18 * at Miami W, 83-79 (ot) J25 * Notre Dame W, 85-84 J28 * at Virginia L, 56-61 F1 * at Virginia Tech W, 74-63 F3 * North Carolina W, 65-59 F8 * Miami W, 99-81 F10 * at Duke L, 65-70 F15 * Syracuse W, 80-77 F18 * Pittsburgh W, 82-67 F22 * at NC State 4::00 p.m. F24 * Louisville 7:00 p.m. F29 * at Clemson 2:00 p.m. M4 * at Notre Dame 9:00 p.m. M7 * Boston College 4:30 p.m. M10-14 ACC Tournament TBA Greensboro, N.C. *ACC Game 1 Exhibition Game; 2 Emerald Coast Classic at Tallahassee, Fla.; 3 Emerald Coast Classic at Northwest Florida State College, Niceville, Fla.; 4 ACC/Big Ten Challenge at Bloomington, Ind.; 5 Metro by T-Mobile Orange Bowl Basketball Classic at BB&T Center, Sunrise, Fla.; 6 ACC Tournament at Greensboro Coliseum, Greensboro, N.C.

2019-20 ACC Standings

Team W L Pct. W L Pct. Louisville 13 3 .813 22 5 .815 Florida State 12 3 .800 22 4 .846 Duke 12 3 .800 22 4 .846 Virginia 10 5 .667 18 7 .720 NC State 8 7 .533 17 9 .654 Notre Dame 7 8 .467 16 10 .615 Syracuse 7 8 .467 14 12 .539 Clemson 7 8 .467 13 12 .520 Georgia Tech 7 8 .438 13 13 .480 Boston College 7 9 .438 13 14 .481 Virginia Tech 6 9 .400 15 11 .577 Pittsburgh 6 10 .400 15 12 .556 Miami 6 10 .375 14 12 .538 Wake Forest 4 12 .250 11 15 .423 N. Carolina 3 12 .200 10 16 .385

Leonard Hamilton’s Career Record W L Pct. Years Career 556 430 .564 1987-Pr. at Okla. State 56 63 .471 1987-90 at Miami 144 147 .495 1991-00 at Florida State 356 220 .618 2002-Pr.

Page 2: NO. 8/8 FLORIDA STATE SEMINOLES (22-4, 12-3 ACC) AT NC STATE WOLFPACK (17-9, 8-7 … · 2020-02-21 · no. 8/8 florida state seminoles (22-4, 12-3 acc) at . nc state wolfpack (17-9,

HAMILTON AMONG ALL-TIME GREATEST COACHES IN ACC Florida State Head Coach Leonard Hamilton enters Saturday’s game at NC State as the fifth winningest coach in ACC history. Hamilton became only the sixth coach in the illustrious history of the nation’s best basketball conference to win 350 career games with the Seminoles’ victory over Miami on January 18 in Coral Gables. Hamilton In ACC History Rank Coach, School Career Wins 1. Mike Krzyzewski, Duke 1,080 2. Dean Smith, North Carolina 879 3. Roy Williams, North Carolina 464 4. Gary Williams, Maryland 461 5. Leonard Hamilton, Florida State 356 HAMILTON RANKED IN THE TOP FIVE IN ACC HISTORY With 167 career ACC victories (regular season and ACC Tournament), Seminole Head Coach Leonard Hamilton is the fifth winningest coach in league history in ACC games only. Including the Seminoles’ 12 ACC victories this season, Hamilton has led the Seminoles to 167 ACC wins during his career. Hamilton in ACC Games Only History Rank Coach School Career ACC Wins 1. Mike Krzyzewski, Duke 502 2. Dean Smith, North Carolina 422 3. Roy Williams, North Carolina 231 4. Gary Williams, Maryland 210 5. Leonard Hamilton, Florida State 167 FLORIDA STATE GETS SCORING FROM ITS BENCH Florida State’s bench bunch is averaging 37.2 points scored per game in its last five games and have outscored the Seminoles’ starters in the last two games. The Seminoles’ reserved outscored the starters, 41-39, in their win over Syracuse and outscored the first five by a 53-29 margin in their win over Pittsburgh in Tuesday in Tallahassee. Florida State’s bench scored a season-high 64 points in their 113-56 win over Chicago State on November 25, 2019 at the Donald. Tucker Center in the first round of the Emerald Coast Classic. The Seminoles’ bench has outscored the starters in seven games including four ACC games (Pittsburgh 1, Miami 2, Syracuse, Pittsburgh 2) Breaking Down Florida State’s Bench Scoring In The Last Five Game Opponent Points Margin Notes North Carolina 25 25-17 Patrick Williams leads the Seminoles’ bench with 14 points Miami 54 54-11 Patrick Williams leads the Seminoles’ bench with 14 points at Duke 13 13-21 Patrick Williams leads Seminoles’ bench with 7 points Syracuse 41 41-13 Patrick Williams leads Seminoles’ bench with 17 points Pittsburgh 53 53-15 Patrick Williams leads Seminoles’ bench with 16 points Totals 186 186-77 Patrick Williams is averaging 13.6 points in last five games FLORIDA STATE IN THE GIVING MOOD AGAINST PITTSBURGH Led by a season-high four assists by M.J. Walker, Florida State totaled 20 assists on 32 baskets to mark the fifth game this season the Seminoles have totaled at least 20 baskets in a game. Florida State totaled a season-high 21 assists in victories over Chicago State (21 assists on 38 baskets) and against Miami on January 18 (21 assists on 29 baskets). The Seminoles enters Saturday’s game at NC State ranked sixth in the ACC with a 13.7 assists per game average (in ACC games only). SEMINOLES GOING TO THE OFFENSIVE GLASS Florida State totaled 17 offensive rebounds in its 82-67 win over Pittsburgh on Tuesday night in Tallahassee marking the fourth consecutive game during which they have pulled down 16 or more offensive rebounds. Breaking Down Florida State’s Offensive Rebounding In The Last Four Games Opponent OR Second Chance Points Notes Miami 16 22 Florida State wins, 99-81 at Duke 17 17 Duke wins, 70-65 Syracuse 20 12 Florida State wins, 80-77 Pittsburgh 17 23 Florida State wins, 82-67 Totals 70/17.5 74/18.5 Florida State wits a 31-1 record SEMINOLES SHOOT 50 PERCENT FROM THE FIELD IN WIN OVER PITTSBURGH Florida State shot 50 percent as a team (32 of 64) and scored 82 points in its victory over Pittsburgh on Tuesday night in Tallahassee. It marked the seventh time this this season the Seminoles shot 50 percent or better from the field in a single game this season – they are 7-0 in those seven games. Florida State has shot 50 percent or better in three ACC games (at Louisville, against Miami at home and against Pittsburgh at home) and have won all three of those conference games. FLORIDA STATE FROM THE 3-POINT LINE IN THE LAST TWO GAMES Florida State is shooting .426 from the 3-point line in the last two games (20 of 47) and is averaging 10.0 3-point field goals made in those two victories over Syracuse and Pittsburgh. The Seminoles enter Saturday’s game at NC State ranked second in the ACC with a .396 3-point field goal shooting percentage and averaging 7.8 3-point field goals made per game. Breaking Down the Seminoles From The Bonusphere In The Last 2 Games Opponent 3FGM 3FGA Pct. Notes Syracuse 11 25 .440 M.J. Walker leads Florida State with 5 3FGM Pittsburgh 9 22 .409 Trent Forrest and Anthony Polite with 2 3FGM Totals 20 47 .426 M.J. Walker shooting .426 from 3FGM (six of 13) in last 2 games

Florida State Basketball / National Polls ASSOCIATED PRESS POLL

Rk. Team 19-20 Rec. 1. Baylor (48) 23-1 2. Gonzaga (14) 26-1 3. Kansas (1) 22-3 4. San Diego State 26-0 5. Dayton 23-2 6. Duke 22-3 7. Maryland 21-4 8. FLORIDA STATE 21-4 9. Penn State 20-5 10. Kentucky 20-5 11. Louisville 21-5 12. Villanova 19-6 13. Auburn 22-3 14. Oregon 20-6 15. Creighton 20-6 16. Seton Hall 18-7 17. West Virginia 18-7 18. Colorado 20-6 19. Marquette 17-7 20. Iowa 18-8 21. Butler 19-7 22. Houston 20-6 23. BYU 21-7 24. Arizona 18-7 25. Ohio State 17-8

USA TODAY POLL Rk. Team Points 1. Baylor (21) 788 2. Gonzaga (11) 772 3. Kansas 723 4. San Diego State 717 5. Dayton 659 6. Duke 652 7. Maryland 601 8. FLORIDA STATE 524 9. Penn State 503 10. Kentucky 488 11. Louisville 466 12. Auburn 398 13. Villanova 383 14. Seton Hall 355 15. Creighton 340 16. Oregon 311 17. Colorado 287 18. West Virginia 279 19. Marquette 171 20. Iowa 168 21. Arizona 132 22. Houston 131 23. Butler 124 24. Ohio State 79 25. Michigan State 76

Florida State’s 2019-20 Poll History Week AP Coaches Week 5 17 19 Week 6 21 21 Week 7 19 19 Week 8 17 17 Week 9 18 20 Week 10 10 10 Week 11 9 9 Week 12 5 6 Week 13 5 6 Week 14 8 8 Week 15 8 8 Week 16 8 8

ACC Operation Basketball (Oct. 8, 2019) 1. Duke (51) 1564 2. North Carolina (19) 1493 3. Louisville (29) 1448 4. Virginia (12) 1405 5. Florida State 1157

Page 3: NO. 8/8 FLORIDA STATE SEMINOLES (22-4, 12-3 ACC) AT NC STATE WOLFPACK (17-9, 8-7 … · 2020-02-21 · no. 8/8 florida state seminoles (22-4, 12-3 acc) at . nc state wolfpack (17-9,

POSSIBLE STARTING LINEUP FOR FLORIDA STATE… F #10 Malik Osborne (6.0 ppg and 3.8 rpg; First career game against NC State) F #1 RaiQuan Gray (6.1 ppg and 3.8 rpg; 1 pt and 2 rebs vs, NC State, March 2, 2019) G #3 Trent Forrest (11.6 ppg and 4.3 apg; 16 pts and 7 asts vs. NC State, Feb. 25, 2018) G #23 M.J. Walker (10.5 ppg and 1.8 rpg; 15 pts and 1 reb vs. NC State, March 2, 2019) G #24 Devin Vassell (13.0 ppg and 5.3 rpg; 2 pts and 1 reb vs. NC State, March 2, 2019) …AND TOP RESERVES G #2 Anthony Polite (6.2 ppg and 1.2 apg; First career game against NC State) G #31 Wyatt Wilkes (4.0 ppg and 1.0 rpg; First career game against NC State) F #4 Patrick Williams (9.2 ppg and 3.7 rpg; First career game against NC State) C #15 Dominik Olejniczak (3.7 ppg and 2.3 rpg; First career game against NC State) G #11 Nathanael Jack (3.5 ppg and 0.9 rpg; First career game against NC State) G #0 RayQuan Evans (3.4 ppg and 1.4 apg; First career game against NC State) C #5 Balsa Koprivica (5.1 ppg, 2.7 rpg; First career game against NC State) POSSIBLE STARTING LINEUP FOR NC STATE F #00 DJ Funderburk (12.6 ppg, 6.0 rpg; 18 pts and 9 rebs vs. Florida State, March 2, 2019) F #15 Manny Bates (5.3 ppg, 2.9 bpg; First career game against Florida State) G #11 Markell Johnson (13.2 pog, 6.4 apg; 14 pts and 2 asts vs. Florida State, March 2, 2019) G #13 C.J. Bryce (13.7 ppg, 6.3 rpg; 7 pts and 2 stls vs. Florida State, March 2, 2019) G #24 Devon Daniels (12.6 ppg, 5.2 rpg; 2 ps and 1 stl vs. Florida State, March 2, 2019) FLORIDA STATE VS. NC STATE -- A SERIES HISTORY The Series: NC State leads, 31-26 First Game: December 1, 1955; at NC State 88, Florida State 63 Last Game: March 2, 2019; at Florida State 78, NC State 73 Last Florida State Win: March 2, 2019; at Florida State 78, NC State 73 Last N.C. State Win: February 25, 2018; at NC State 92, Florida State 72 Last Florida State Win in Raleigh: January 13, 2016; Florida State 85, at NC State 78 Last N.C. State Win in Raleigh: February 25, 2018; at NC State 92, Florida State 72 Current Streak: Florida State has won 1 Current Streak in Raleigh: NC State has won 1 Leonard Hamilton vs. NC State: 11-14 (all at Florida State) FLORIDA STATE VS. NC STATE – THE LAST FOUR GAMES March 2, 2019 Feb. 25, 2018 Feb. 8, 2017 Feb. 1, 2016 at Florida State 78 Florida State 72 at Florida State 95 at Florida State 77 NC State 73 at NC State 92 NC State 71 NC State 73 FLORIDA STATE VS. NC STATE – THE LAST GAME Mfiondu Kabengele scored 16 points, Trent Forrest added 11 of his 13 points in the second half and the No. 18 Seminoles defeated NC State 78-73 on March 2, 2019 at the Donald L. Tucker Center in Tallahassee. Forrest was quiet early but drove to the basket with ease in the second half, helping Florida State gain its 23rd win. He shot 5 of 10 from the floor with a team-leading six rebounds, three assists and two steals. While Florida State never trailed, NC State kept clawing back and had a chance to win in the final minute. Devon Daniels blocked Kabengele and Torin Dorn grabbed it with 24 seconds left and the Seminoles leading 76-73. After a timeout, Braxton Beverly dribbled the ball beyond the 3-point arc but was fouled. He missed the front end of a 1-and-1, and Kabengele rebounded. He was quickly fouled, making two free-throw attempts to seal it. M.J. Walker scored 11 of his 15 points in the first half, putting him in double figures for the first time since Feb. 9. Kabengele shot 7 of 8 from the free-throw line while adding five rebounds and four of the Seminoles’ season-high nine blocks. TODAY’S OFFICIALS Today’s referee is Roger Ayers and the umpires are Lee Cassell and Jerry Heater 2019-20 FLORIDA STATE ROSTER No. Name Pos. Ht. Wt. Yr. Hometown 0 RayQuan Evans G 6-4 210 Jr. Billings, Mont./North Idaho College 1 RaiQuan Gray F 6-8 260 RSo. Ft. Lauderdale, Fla./Dillard 2 Anthony Polite G 6-6 215 RSo. Lugano, Switzerland/St. Andrews Christian School (Fla.) 3 Trent Forrest G 6-4 210 Gr. Chipley, Fla./Chipley 4 Patrick Williams F 6-8 225 Fr. Charlotte, N.C./West Charlotte 5 Balsa Koprivica C 7-1 260 Fr. Belgrade, Serbia/Montverde Academy 10 Malik Osborne F 6-9 225 So. Matteson. Ill./Bosco Institute/Rice 11 Nathanael Jack G 6-5 195 Jr. Mississauga, Ontario, Canada/Eastern Florida State 12 Justin Lindner G 6-1 180 RJr. Memphis, Tenn./Christian Brothers 15 Dominik Olejniczak C 7-0 260 Gr. Tourn, Poland/Ole Miss/Drake 20 Travis Light G 6-5 180 RJr. Vienna, Va./IMG Academy 23 M.J. Walker G/F 6-5 213 Jr. Riverdale, Ga./Jonesboro 24 Devin Vassell G 6-7 194 So. Suwanee, Ga./Peachtree Ridge 30 Harrison Prieto F 6-8 230 RJr. Mandeville, La./St. Paul’s School 31 Wyatt Wilkes F 6-8 220 RSo. Orlando, Fla./Winter Park 33 Will Miles G 6-6 220 RJr. Orlando, Fla./Trinity Prep 42 Cleveland Yates G 6-2 214 Fr. Memphis, Tenn./Briarcrest Christian School 44 Ty Hands G 6-5 180 RFr. West Palm Beach, Fla./Palm Beach Lakes PRONUNCIATION GUIDE: RayQuan Evans (RAY-Qwan); RaiQuan Gray (RAY-Qwan); Balsa Koprivica (Ball-Sha Ko-Pra-Vizza); Dominik Olejniczak (DOM-a-nick O-Lynn-A-Chuck); Devin Vassell (Dev-in Vuh-SELL - like Sam Cassell with a V).

Florida State Basketball Upcoming Milestones

Leonard Hamilton

Victories as an ACC Coach 356 (Career at Florida State)

+107 (Needs) 463

To Become the 4th Winningest Coach in ACC History (all victories) (surpassing Gary

Williams of Maryland)

Leonard Hamilton ACC Victories at Florida State (Regular Season + ACC Tourn.)

167 (career at Florida State) +44 (Needs)

211 To Become the 5th Winningest Coach in ACC

History (ACC games) – surpassing Gary Williams of Maryland

Leonard Hamilton

Wins vs. AP No. 1 In Career 4 (career at Florida State)

+4 (Needs) To move into a tie for first place college

basketball history with Roy Williams for all-time wins vs. the nation’s No. 1 ranked

team

Trent Forrest Career Steals

219 (career at Florida State) +7 (Needs)

226 To move into 2nd place for career steals in school history passing Delvon Arrington

(1999-02)

Trent Forrest Career Assists

442 (career at Florida State) +10 (Needs)

452 To move into 5th place in school history for career assists passing Xavier Rathan-Mayes

(2015-17)

Trent Forrest ACC Career Steals

219 (career at Florida State) +2 (Needs)

221 To move into 24th place in ACC history for career steals passing Sidney Lowe of NC

State (1980-83)

Trent Forrest Career Points

1,085 (career at Florida State) +24 (needs)

1,109 To move into 37th place in scoring in school history surpassing Larry Warren (1974-76)

M.J. Walker

Career 3-Point Field Goals Made 122 (career at Florida State)

+2 (needs) 124

To move into 15th place in school in school history with 124 career 3-point field goals

made passing LaMarr Greer (1995-98)

Page 4: NO. 8/8 FLORIDA STATE SEMINOLES (22-4, 12-3 ACC) AT NC STATE WOLFPACK (17-9, 8-7 … · 2020-02-21 · no. 8/8 florida state seminoles (22-4, 12-3 acc) at . nc state wolfpack (17-9,

TRENT FORREST IN HIS LAST FIVE GAMES …Has scored in double figures in for the first time in his career including 18 points at Duke on February 10; …He has scored 65 points and is averaging 13.0 points scored per game; …He has totaled 15 steals and is averaging 3.0 steals per game. He totaled a career-high eight steals in his final collegiate visit to Cameron Indoor Stadium to play Duke on February 10; …He is shooting .789 from the free throw line (15 of 19) and was a perfect six of six from the line against Duke; …His is shooting .489 from the field (23 of 4& and made five field goals in scoring 14 points in Florida State’s victory over North Carolina on February 3 in Tallahassee. FORREST CHASING CHARLIE WARD FOR FLORIDA STATE STEALS SUPREMACY Senior Trent Forrest, who earned a career-high eight steals against Duke on February 10 at Duke, enters Saturday’s game at NC State with 219 career steals. He needs 20 steals to surpass the great Charlie Ward as the Seminoles’ all-time leader in steals with 239 career thefts. Breaking Down The Seminoles’ All-Time Steals Leaders Rank Player, Years Steals Career-High 1. Charlie Ward, 1991-94 238 8 vs. Wake Forest, January 11, 1992 2. Delvon Arrington, 1999-02 225 6 vs. Georgia Tech, January 27, 2001 3. Trent Forrest, 2017-Pr. 219 8 vs. Duke, February 10, 2020 FORREST ON THE ACC’S CAREER STEALS CHART Senior Trent Forrest enters Saturday’s game at NC State with 219 career steals -- he needs just one steal to move into a tie for 24th with NC State’s Sidney Lowe the ACC’s all-time career steals list. Breaking Down The ACC’s All-Time Steals Leaders Rank Player, Years School Steals 1. Johnny Rhodes, 1994-97 Maryland 344 22. Jamon Gordon, 2005-07 Virginia Tech 224 23. Othell Wilson, 1981-84 Virginia 222 24. Sidney Lowe, 1980-83 NC State 220 25. Trent Forrest, 1917-Pr. Florida State 219 WHERE TRENT FORREST RANKS IN FLORIDA STATE’S RECORD BOOK Career Steals — 3rd — 219 Career Assists — 6th — 442 Career Free Throws Made — T11th — 326 Career Free Throws Attempted — 14th — 437 Games Played — 9th — 132 EVANS’ INCREASED MINUTES AND PRODUCTION Junior RayQuan Evans has seen an increase in his minutes played per game along with his increased production in recent games. He is averaging 4.0 points and 3.5 assists while playing 31 minutes in his last two games. Evans totaled six points and four assists (in 17 minutes of playing time) in Florida State’s victory over Syracuse as he made multiple 3-point field goals in a single game for the first time in his career on February 15 in Tallahassee. He then totaled two points and 3 assists (in 14 minutes of playing time) in Florida State’s victory over Pittsburgh on Tuesday night in Tallahassee. RAYQUAN GRAY BY THE NUMBERS… …He has scored a career-high 145 points and is averaging a career-high 6.0 points scored per game entering Saturday’s game at NC State. He scored 80 points and averaged 2.7 points per game last season as a redshirt freshman; …He has pulled down a career-high 90 rebounds and is averaging a career-high 3.8 rebounds per game entering Saturday’s game at NC State. He totaled 49 rebounds and a 1.3 rebounds per game average as a redshirt freshman; …He has blocked a career-high 16 shots and is averaging a career-high 0.7 blocks per game entering Saturday’s game at NC State. He totaled 1 block in 30 games as a redshirt freshman; …He has been credited with a career-high 33 assists and is averaging a career-high 1.4 assists per game entering Saturday’s game at NC State. He totaled 20 assists and averaged 0.7 assists per game as a redshirt freshman; …He has made a single-season career-high 35 free throws entering Saturday’s game at NC State. He made 17 free throws as a redshirt freshman. PATRICK WILLIAMS WITH 20-20-20 VISION Freshman Patrick Williams has earned 26 assists, 26 blocked shots and 22 steals in the first 24 games of his Florida State career. WILLIAMS HEATING UP FROM THE 3-POINT LINE Freshman Patrick Williams, who has made six of his last nine 3-point field goals in the last five games, is one of the Seminoles’ hottest shooters. He made two 3-point field goals in Florida State’s victories over North Carolina (February 3) and Miami (February 8) and enters Saturday’s game at NC State shooting .349 from the bonusphere for the season. Breaking Down Williams From The 3-Point Line Games 3FGM 3FGA Pct. Notes Last 5 6 9 .667 Averaging 1.2 3FGM/Game First 19 9 34 .265 Averaged 0.8 3FGM/Game Improvement +.402 Career-high 2 3FGM in five different games PATRICK WILLIAMS BY THE NUMBERS Freshman Patrick Williams is averaging 13.6 points (68 points), 5.6 rebounds (28 rebounds), 1.2 steals (six steals), 1.0 blocked shots (six blocks) while shooting .500 from the field (24 of 48) and .875 from the line (14 of 16) in the last five games.

Florida State Basketball By The Numbers

.285 Florida State is limiting its last six opponents to a .285 shooting mark from the 3-point line (13 of 39). The Seminoles limited Pitt to four 3-point field goals made – the lowest total by an ACC team since Florida State held Virginia to three 3-point field goals made in a 54-50 win over the Cavaliers on January 15, 2020 in Tallahassee. .407 Junior M.J. Walker is shooting .407 from the free throw line (24 of 59) since a five of seven performance from long range in Florida State’s victory at Louisville on January 4. .462 Junior M.J. Walker is shooting .462 from the 3-point line (six of 13) in the last two games. He tied his season-high with five 3-point field goals made in Florida State’s victory over Syracuse on February 15. .600 Senior Trent Forrest is shooting .600 from the 3-point line (three of five) in Florida State’s last three games. .923 Freshman Patrick Williams is shooting .923 from the free throw line (24 of 26) since the second half of Florida State’s victory over Clemson on December 8 in Tallahassee. 1 One Seminole – Trent Forrest -- has started all 26 games for Florida State this season. 2 Senior Trent Forrest made two 3-point field goals and scored 10 points in Florida State’s victory over Pittsburgh on Tuesday night in Tallahassee. It marked the first time in his career that he made multiple 3-point shots in a single game. 2 In only two additional games, redshirt sophomore Wyatt Wilkes has made 18 more 3-point field goals this season than he did in the first two seasons of his career (22-4) 2 Redshirt sophomore Anthony Polite has scored twice as many points this season (160) than he did in 30 games as a redshirt freshman (80). He enters Saturday’s game at NC State averaging a career-high 6.2 points scored per game. 3 Freshman Balsa Koprivica earned a career-high three assists (two in the second half) in Florida State’s victory over Pittsburgh on Tuesday in Tallahassee. 5 Redshirt sophomore Malik Osborne has made five consecutive free throws and enters Saturday’s game at NC State shooting a career-high .750 from the free throw line. 7 Sophomore Devin Vassell’s seven 3-point shots made in the Seminoles’ victory at Virginia Tech on February 1 are tied for second in school history for 3-point shots made in an ACC game with five other Florida State standouts. Deividas Dulkys, who played on the Seminoles’ 2012 ACC Championship team, made eight in a 90-57 win over North Carolina on January 14, 2012 at the Donald L. Tucker Center.

Page 5: NO. 8/8 FLORIDA STATE SEMINOLES (22-4, 12-3 ACC) AT NC STATE WOLFPACK (17-9, 8-7 … · 2020-02-21 · no. 8/8 florida state seminoles (22-4, 12-3 acc) at . nc state wolfpack (17-9,

POLITE TOTALS 10 POINTS IN VICTORY OVER PITTSBURGH Redshirt sophomore Anthony Polite scored 10 points in Florida State’s victory over Pittsburgh on Tuesday night in Tallahassee – the career-high sixth time he has scored in double figures this season. He scored his season-high of nine points in two games during the 2018-19 season – including in Florida State’s victory over Murray State in the NCAA Tournament. Breaking Down Polite’s Scoring Total Season Games Points PPG Notes 2019-20 26 160 6.2 Career and ACC career-high of 14 points in win over Virginia 2018-19 30 80 2.7 Season-high 9 points in wins over Canisius and Murray State Improvement +80 +3.5 Double figure scoring in career-high six games POLITE’S MARKED IMPROVEMENT FROM THE 3-POINT LINE Redshirt sophomore Anthony Polite has made a career-high 29 3-point field goals and enters Saturday’s game at NC State shooting a career-high .341 from the 3-point line. He made two of four shots from the bonusphere in the Seminoles’ 82-67 win over Pittsburgh on Tuesday in Tallahassee. Polite was a perfect four of four from the 3-point line in scoring his career-high of 14 points in Florida State’s victory over Virginia on February 15. Breaking Down Polite From The 3-Point Line Season Games 3FGM 3FGA Pct. Notes 2019-20 26 29 85 .341 Averaging 1.1 3FGM/Game 2018-19 30 11 46 .239 Averaged 0.4 3FGM/Game Improvement -4 +18 +39 +.102 Averaging career-high 6.2 point scored per game KOPRIVICA AGAINST PITTSBURGH Freshman Balsa Koprivica totaled seven points, a career high tying seven rebounds and a career high three assists in Florida State’s victory over Pittsburgh in Tallahassee on Tuesday night. His three assists against the Panthers nearly matched his assists total (four) from the first 21 games of his career as a Seminole. OSBORNE HAS BEEN A STARTER HIS ENTIRE CAREER – AT RICE AND FLORIDA STATE Redshirt sophomore Malik Osborne, who transferred to Florida State from Rice prior to the 2018-19 season, has played in 57 career games as an Owl and as a Seminole. He has been a starter in 51 of those games and has started 14 consecutive games entering Saturday’s game at NC State. JACK PERFECT FROM THE FIELD Junior Nathanael Jack was a perfect two-of-two from the field (including making his only 3-point shot attempt of the game) and scored his ACC career-high of five points in Florida State’s victory over Pittsburgh on Tuesday night. OLEJNICZACK IN THE LAST FOUR GAMES Graduate student Dominik Olejniczak is averaging 6.0 points (24 total points) and 3.0 rebounds (12 total rebounds) while shooting .1000 from the free throw line (four of four) and .714 from the field in the last four games. He totaled eight points in victories over both Miami (February 8) and Pittsburgh (February 18) in games played at the Donald L. Tucker Center in Tallahassee. WHERE M.J. WALKER RANKS IN FLORIDA STATE’S RECORD BOOK Career 3-Point Field Goals Attempted -- 15th — 355 Career 3-Point Field Goals Made – 16th – 122 Career Free Throw Percentage – T18th – 781 M.J. WALKER FROM THE 3-POINT LINE BY THE NUMBERS Junior M.J. Walker, who has made 122 career 3-point field goals as a Seminole, is one of the hottest long range shooters in the ACC entering the final five games of the season. He made five 3-point field goals and scored his season-high of 23 points in Florida State’s victory at Louisville on January 4, 2020 and made five 3-point field goals and scored 16 points in Florida State’s victory over Syracuse last Saturday. Breaking Down Walker From The Bonusphere Season Games 3FGM 3FGA Pct. Notes 2017-18 35 41 119 .345 Averaged 1.2 3FGM/Game 2018-19 35 44 134 .328 Averaged 1.3 3FM/Game 2019-20 21 37 102 .363 Averaging career-high 1.83FGM/Game Totals 91 122 355 .343 Ranked 16th in school history for career 3FGM THE SEASON OF AWARD WATCH LISTS FOR VASSELL Sophomore Devin Vassell has been named as one of 10 finalists for this year’s Julius Erving Award and to the Naismith Defensive Player of the Year Midseason Watch List. The Julius Erving Award recognizes the top small forward in men’s college basketball. VASSELL LEADS THE SEMINOLES IN SCORING Sophomore Devin Vassell enters Saturday’s game at NC State averaging a career-high a team-leading 13.5 points per game – he has improved his scoring average by 8.5 points per game this season as compared to his freshman season as a Seminole. Breaking Down Vassell’s Scoring Total Season Games Points PPG Notes 2019-20 25 325 13.0 Career-high 27 points in Seminole win at Virginia Tech 2018-19 33 149 4.5 Season-high 16 points in Seminole win over SE Missouri St. Improvement -8 +176 +8.5 Double figure scoring in 25 of 58 career games

Florida State Basketball By The Numbers

8 Redshirt sophomore RayQuan Gray has made eight consecutive free throws in the last six games. He was a perfect two of two from the line against North Carolina (Feb. 3), at Duke (February 10), Syracuse (February 15) and Pittsburgh (February 18). 12 Florida State has won each of its last 12 games when it has made at least 10 3-point field goals in a game dating to its victory over Virginia Tech in the quarterfinals of the 2019 ACC Tournament. The Seminoles, who made 11 3-point field goals in their win over Syracuse, are 9-0 this season when they have made double digit 3-point field goals in a game with wins over Chattanooga, Chicago State, Clemson, at Louisville, at Miami, Notre Dame, Virginia Tech, Miami at home and Syracuse. 13 Senior Trent Forrest has earned at least one steal in 13 consecutive games with his career-high of eight coming in Florida State’s game at Duke on February 10. He has 36 steals in those 13 games (2.8 spg) since earning one steal in Florida State’s victory over Georgia Tech on December 31, 2019. 14 Freshman Patrick Williams has blocked at least one shot in 14 of the last 16 games – 22 total blocked shots for a 1.4 blocked shots per game average since December 3 against Indiana. 19 Redshirt sophomore Malik Osborne has earned a career-high tying 19 steals – including three in the last two games – entering Saturday’s game at NC State. 19 Florida State is 19-1 when leading at the half of a game this season entering Saturday’s game at NC State. 19 Redshirt sophomore Wyatt Wilkes scored 19 points in less than 19 minutes of playing time (18:39) in Florida State’s victory over Notre Dame on January 18. 22 Florida State is undefeated, 22-0, when outscoring its opponent. 25 Florida State has forced 25 of its 26 opponents into double figure turnovers and leads the ACC in turnovers forced with a 17.2 average per game. The only team to commit less than 10 turnovers in a single game was North Carolina (nine) in the Seminoles’ 65-59 win over the Tar Heels on February 3 in Tallahassee. 46 Redshirt sophomore Malik Osborne is Florida State’s leader with 46 offensive rebounds – an average of 1.8 orpg. 100 Senior Trent Forrest enters Saturday’s game at NC State as the winningest player in school history with 100 wins during his career. He surpassed Terance Mann (2016-19), who won 98 games as a Seminole, for career games won with the Seminoles’ 80-77 win over Syracuse.

Page 6: NO. 8/8 FLORIDA STATE SEMINOLES (22-4, 12-3 ACC) AT NC STATE WOLFPACK (17-9, 8-7 … · 2020-02-21 · no. 8/8 florida state seminoles (22-4, 12-3 acc) at . nc state wolfpack (17-9,

2019-20 Florida St. Men's BasketballCombined Team Statistics

All games

Page 1/1as of Feb 19, 2020

Game RecordsRecord Overall Home Away NeutralALL GAMES 22-4 14-0 5-4 3-0CONFERENCE 12-3 8-0 4-3 0-0NON-CONFERENCE 10-1 6-0 1-1 3-0

Score by PeriodsTeam 1st 2nd OT TOTFlorida St. 948 998 19 1965Opponents 817 877 12 1706

Team Box Score

No. PlayerTotal 3-Point F-Throw Rebounds

GP-GS MIN AVG FG-FGA FG% 3FG-FGA 3FG% FT-FTA FT% OFF DEF TOT AVG PF DQ A TO BLK STL PTS AVG24 VASSELL, Devin 25-25 707:51 28.3 121-247 .490 38-91 .418 45-61 .738 32 100 132 5.3 46 0 43 20 27 35 325 13.003 FORREST, Trent 26-26 821:17 31.6 107-236 .453 14-47 .298 73-89 .820 30 85 115 4.4 37 0 111 79 18 54 301 11.623 WALKER, M.J. 21-19 529:17 25.2 68-191 .356 37-102 .363 47-58 .810 5 32 37 1.8 46 1 30 34 6 12 220 10.54 WILLIAMS, Patrick 24-0 524:16 21.8 82-175 .469 15-43 .349 42-48 .875 30 59 89 3.7 42 0 26 40 26 22 221 9.22 POLITE, Anthony 26-8 543:55 20.9 56-138 .406 29-85 .341 19-28 .679 21 58 79 3.0 40 0 31 32 7 35 160 6.2

01 GRAY, RaiQuan 24-19 478:50 20.0 51-127 .402 8-35 .229 35-49 .714 24 66 90 3.8 55 2 33 45 16 26 145 6.010 OSBORNE, Malik 26-24 509:08 19.6 60-130 .462 18-48 .375 18-24 .750 46 71 117 4.5 47 1 12 14 20 19 156 6.05 KOPRIVICA, Balsa 22-0 250:25 11.4 45-66 .682 0-0 .000 22-33 .667 27 33 60 2.7 41 1 7 17 7 9 112 5.1

31 WILKES, Wyatt 23-1 229:30 10.0 32-74 .432 22-57 .386 5-5 1.000 9 15 24 1.0 22 0 15 12 2 6 91 4.015 OLEJNICZAK, Dominik 24-8 252:10 10.5 39-69 .565 0-0 .000 10-14 .714 30 26 56 2.3 40 1 3 25 14 8 88 3.711 JACK, Nathanael 11-0 65:08 5.9 13-29 .448 10-26 .385 2-2 1.000 1 9 10 0.9 12 0 5 5 0 1 38 3.50 EVANS, RayQuan 24-0 263:51 11.0 26-53 .491 7-14 .500 21-29 .724 5 20 25 1.0 17 0 35 20 2 8 80 3.3

20 LIGHT, Travis 7-0 11:57 1.7 3-5 .600 3-5 .600 0-0 .000 0 0 0 0.0 0 0 0 0 0 0 9 1.312 LINDNER, Justin 7-0 15:01 2.1 3-3 1.000 1-1 1.000 2-2 1.000 0 4 4 0.6 3 0 4 5 0 0 9 1.330 PRIETO, Harrison 8-0 29:31 3.7 4-7 .571 0-1 .000 0-2 .000 4 3 7 0.9 4 0 1 1 1 1 8 1.033 MILES, Will 7-0 11:57 1.7 1-3 .333 0-0 .000 0-0 .000 1 0 1 0.1 2 0 1 1 0 0 2 0.342 YATES, Cleveland 5-0 05:17 1.1 0-1 .000 0-0 .000 0-0 .000 0 1 1 0.2 0 0 0 0 0 0 0 0.044 HANDS, Ty 1-0 00:39 0.7 0-0 .000 0-0 .000 0-0 .000 0 0 0 0.0 1 0 0 0 0 0 0 0.0Team 30 37 67 5Total 26 5250 711-1554 .458 202-555 .364 341-444 .768 295 619 914 35.2 455 6 357 355 146 236 1965 75.6Opponents 26 5250 575-1425 .404 181-562 .322 375-507 .740 277 581 858 33.0 441 8 258 446 74 146 1706 65.6

Team StatisticsFSU OPP

Scoring 1965 1706Points per game 75.6 65.6Scoring margin +10.0 -

Field goals-att 711-1554 575-1425Field goal pct .458 .404

3 point fg-att 202-555 181-5623-point FG pct .364 .3223-pt FG made per game 7.8 7.0

Free throws-att 341-444 375-507Free throw pct .768 .740F-Throws made per game 13.1 14.4

Rebounds 914 858Rebounds per game 35.2 33.0Rebounding margin +2.2 -

Assists 357 258Assists per game 13.7 9.9

Turnovers 355 446Turnovers per game 13.7 17.2Turnover margin +3.5 -Assist/turnover ratio 1.0 0.6

Steals 236 146Steals per game 9.1 5.6

Blocks 146 74Blocks per game 5.6 2.8

Winning streak 2 -Home win streak 14 -

Attendance 120862 98822Home games-Avg/Game 14-8633 9-10980Neutral site-Avg/Game - 3-4642

Team ResultsDate Opponent Score Att.11/06/2019 at Pittsburgh L 61-63 901611/10/2019 at Florida W 63-51 1085111/15/2019 Western Caro. W 79-74 949011/20/2019 Chattanooga W 89-53 757211/23/2019 Saint Francis (PA) W 80-65 759511/25/2019 Chicago St. W 113-56 610211/29/2019 vs Tennessee W 60-57 250011/30/2019 vs Purdue Wot 63-60 250012/03/2019 at Indiana L 64-80 1722212/08/2019 Clemson W 72-53 783412/17/2019 North Florida W 98-81 554212/21/2019 vs South Fla. W 66-60 892712/28/2019 North Ala. W 88-71 563612/31/2019 Georgia Tech W 70-58 683701/04/2020 at Louisville W 78-65 1778601/08/2020 at Wake Forest W 78-68 527701/15/2020 Virginia W 54-50 1072501/18/2020 at Miami (FL) Wot 83-79 621201/25/2020 Notre Dame W 85-84 1150001/28/2020 at Virginia L 56-61 1386902/01/2020 at Virginia Tech W 74-63 927502/03/2020 North Carolina W 65-59 1001502/08/2020 Miami (FL) W 99-81 1150002/10/2020 at Duke L 65-70 931402/15/2020 Syracuse W 80-77 1150002/18/2020 Pittsburgh W 82-67 9014

Page 7: NO. 8/8 FLORIDA STATE SEMINOLES (22-4, 12-3 ACC) AT NC STATE WOLFPACK (17-9, 8-7 … · 2020-02-21 · no. 8/8 florida state seminoles (22-4, 12-3 acc) at . nc state wolfpack (17-9,

2019-20 Florida St. Men's BasketballCombined Team Statistics

Specific games

Page 1/1as of Feb 19, 2020

Game RecordsRecord Overall Home Away NeutralALL GAMES 12-3 8-0 4-3 0-0CONFERENCE 12-3 8-0 4-3 0-0NON-CONFERENCE 0-0 0-0 0-0 0-0

Score by PeriodsTeam 1st 2nd OT TOTFlorida St. 524 564 14 1102Opponents 474 514 10 998

Team Box Score

No. PlayerTotal 3-Point F-Throw Rebounds

GP-GS MIN AVG FG-FGA FG% 3FG-FGA 3FG% FT-FTA FT% OFF DEF TOT AVG PF DQ A TO BLK STL PTS AVG24 VASSELL, Devin 14-14 426:51 30.5 77-151 .510 27-59 .458 21-27 .778 19 68 87 6.2 24 0 30 15 15 15 202 14.403 FORREST, Trent 15-15 492:31 32.8 65-140 .464 7-27 .259 39-47 .830 17 57 74 4.9 21 0 69 45 11 39 176 11.723 WALKER, M.J. 13-11 333:18 25.6 43-122 .352 27-67 .403 21-26 .808 3 14 17 1.3 30 0 18 21 4 6 134 10.34 WILLIAMS, Patrick 13-0 296:52 22.8 43-100 .430 9-26 .346 20-23 .870 20 33 53 4.1 28 0 7 19 19 9 115 8.82 POLITE, Anthony 15-5 317:20 21.2 33-86 .384 20-54 .370 9-14 .643 15 33 48 3.2 28 0 18 20 2 18 95 6.3

01 GRAY, RaiQuan 15-14 284:30 19.0 31-71 .437 6-17 .353 20-28 .714 15 38 53 3.5 41 2 17 28 10 12 88 5.910 OSBORNE, Malik 15-15 300:40 20.0 32-74 .432 10-29 .345 10-12 .833 25 42 67 4.5 29 1 5 9 15 10 84 5.631 WILKES, Wyatt 12-0 124:40 10.4 21-47 .447 15-34 .441 2-2 1.000 5 7 12 1.0 14 0 8 9 1 2 59 4.90 EVANS, RayQuan 14-0 159:15 11.4 17-32 .531 6-10 .600 7-12 .583 3 14 17 1.2 9 0 23 11 1 2 47 3.4

15 OLEJNICZAK, Dominik 14-1 146:02 10.4 20-40 .500 0-0 .000 5-6 .833 18 15 33 2.4 22 1 3 18 11 4 45 3.25 KOPRIVICA, Balsa 11-0 99:28 9.0 14-27 .519 0-0 .000 7-11 .636 15 12 27 2.5 16 1 5 6 2 3 35 3.2

20 LIGHT, Travis 3-0 03:13 1.1 2-2 1.000 2-2 1.000 0-0 .000 0 0 0 0.0 0 0 0 0 0 0 6 2.030 PRIETO, Harrison 4-0 18:06 4.5 3-4 .750 0-0 .000 0-0 .000 3 1 4 1.0 2 0 1 1 1 1 6 1.511 JACK, Nathanael 6-0 13:41 2.3 3-7 .429 1-5 .200 0-0 .000 0 3 3 0.5 3 0 0 2 0 0 7 1.212 LINDNER, Justin 3-0 04:03 1.4 1-1 1.000 1-1 1.000 0-0 .000 0 1 1 0.3 1 0 2 2 0 0 3 1.033 MILES, Will 3-0 03:13 1.1 0-0 .000 0-0 .000 0-0 .000 0 0 0 0.0 0 0 0 0 0 0 0 0.042 YATES, Cleveland 1-0 00:39 0.7 0-1 .000 0-0 .000 0-0 .000 0 0 0 0.0 0 0 0 0 0 0 0 0.044 HANDS, Ty 1-0 00:39 0.7 0-0 .000 0-0 .000 0-0 .000 0 0 0 0.0 1 0 0 0 0 0 0 0.0Team 19 21 40 3Total 15 3025 405-905 .448 131-331 .396 161-208 .774 177 359 536 35.7 269 5 206 209 92 121 1102 73.5Opponents 15 3025 338-837 .404 108-327 .330 214-284 .754 159 338 497 33.1 232 3 166 236 41 86 998 66.5

Team StatisticsFSU OPP

Scoring 1102 998Points per game 73.5 66.5Scoring margin +6.9 -

Field goals-att 405-905 338-837Field goal pct .448 .404

3 point fg-att 131-331 108-3273-point FG pct .396 .3303-pt FG made per game 8.7 7.2

Free throws-att 161-208 214-284Free throw pct .774 .754F-Throws made per game 10.7 14.3

Rebounds 536 497Rebounds per game 35.7 33.1Rebounding margin +2.6 -

Assists 206 166Assists per game 13.7 11.1

Turnovers 209 236Turnovers per game 13.9 15.7Turnover margin +1.8 -Assist/turnover ratio 1.0 0.7

Steals 121 86Steals per game 8.1 5.7

Blocks 92 41Blocks per game 6.1 2.7

Winning streak 2 -Home win streak 8 -

Attendance 78925 70749Home games-Avg/Game 8-9866 7-10107Neutral site-Avg/Game - 0-0

Team ResultsDate Opponent Score Att.11/06/2019 at Pittsburgh L 61-63 901612/08/2019 Clemson W 72-53 783412/31/2019 Georgia Tech W 70-58 683701/04/2020 at Louisville W 78-65 1778601/08/2020 at Wake Forest W 78-68 527701/15/2020 Virginia W 54-50 1072501/18/2020 at Miami (FL) Wot 83-79 621201/25/2020 Notre Dame W 85-84 1150001/28/2020 at Virginia L 56-61 1386902/01/2020 at Virginia Tech W 74-63 927502/03/2020 North Carolina W 65-59 1001502/08/2020 Miami (FL) W 99-81 1150002/10/2020 at Duke L 65-70 931402/15/2020 Syracuse W 80-77 1150002/18/2020 Pittsburgh W 82-67 9014

Page 8: NO. 8/8 FLORIDA STATE SEMINOLES (22-4, 12-3 ACC) AT NC STATE WOLFPACK (17-9, 8-7 … · 2020-02-21 · no. 8/8 florida state seminoles (22-4, 12-3 acc) at . nc state wolfpack (17-9,

2019-20 Florida St. Men's BasketballPoints-rebounds-assists

All games

Opponent Date Score 0 01 2 03 4 5 10 11EVANS,RAYQ GRAY,RAIQU POLITE,ANT FORREST,TR WILLIAMS,P KOPRIVICA, OSBORNE,MA JACK,NATHA LI

at Pitt 11/06/2019 61-63 L DNP 7-3-2 8-3-0 19-2-2 5-3-0 2-1-0 2-9-0 0-1-0at UF 11/10/2019 63-51 W DNP 7-5-2 7-2-0 8-8-7 4-5-0 2-0-0 10-4-0 DNPWCU 11/15/2019 79-74 W 0-0-0 4-2-1 3-2-1 16-2-2 18-4-1 4-2-0 6-9-1 DNPUTC 11/20/2019 89-53 W 4-0-2 DNP 1-2-0 5-4-7 16-3-3 10-7-1 10-3-2 6-5-1SF-PA 11/23/2019 80-65 W 6-2-5 DNP 8-7-2 13-5-4 6-5-1 11-3-0 9-4-0 3-1-2CSU 11/25/2019 113-56 W 6-0-2 6-7-1 9-4-5 12-2-6 16-3-1 10-7-0 4-5-1 14-1-2vs UT 11/29/2019 60-57 W 2-0-0 2-0-0 2-1-0 9-4-4 8-2-1 8-3-0 4-6-0 DNPvs Purdue 11/30/2019 63-60 Wot 4-1-0 6-7-2 2-0-0 17-4-0 4-1-2 4-2-0 4-6-0 DNPat IND 12/03/2019 64-80 L 0-0-0 8-3-2 7-3-0 13-4-2 5-1-2 0-1-0 7-3-1 DNPClem 12/08/2019 72-53 W 0-1-2 7-2-1 12-3-2 9-3-5 9-4-0 2-0-0 5-6-1 DNPUNF 12/17/2019 98-81 W 0-1-0 11-3-5 4-4-0 11-3-1 11-4-3 15-3-1 2-5-1 5-0-0vs USF 12/21/2019 66-60 W 4-2-2 11-7-1 11-5-4 11-1-3 6-5-2 0-2-0 2-1-1 DNPUNA 12/28/2019 88-71 W 7-2-1 2-3-2 11-1-1 10-4-6 12-3-3 13-3-0 14-4-0 3-0-0GaTech 12/31/2019 70-58 W 3-1-2 4-2-1 8-4-2 8-3-6 12-4-0 3-2-0 7-4-2 2-0-0at LOU 01/04/2020 78-65 W 7-1-1 2-5-0 3-2-1 20-3-5 2-3-1 DNP 7-9-1 DNPat Wake 01/08/2020 78-68 W 0-1-1 9-1-2 4-1-1 14-10-2 6-2-0 DNP 9-5-0 DNPUVa 01/15/2020 54-50 W 0-1-0 3-4-1 14-1-0 5-7-7 4-3-0 DNP 5-4-0 DNPat Miami 01/18/2020 83-79 Wot 4-1-4 2-3-0 10-5-3 12-3-5 2-2-1 DNP 6-5-0 0-0-0ND 01/25/2020 85-84 W 2-0-0 13-4-0 9-2-5 13-5-7 DNP 6-6-1 0-1-0 0-0-0at UVa 01/28/2020 56-61 L 2-2-0 8-3-1 4-3-1 4-3-3 DNP 2-1-0 5-4-0 DNPat Hokies 02/01/2020 74-63 W 4-1-2 7-1-0 7-4-2 7-9-5 7-4-1 2-0-1 1-2-0 DNPUNC 02/03/2020 65-59 W 7-1-1 12-7-1 0-0-0 14-4-3 14-9-2 2-0-0 8-6-0 DNPMiami 02/08/2020 99-81 W 8-4-3 2-4-1 2-8-0 10-6-6 14-5-1 3-5-0 6-3-0 0-0-0at Duke 02/10/2020 65-70 L 2-0-0 6-2-3 0-1-0 18-9-4 7-2-0 2-2-0 14-5-0 DNPSyr 02/15/2020 80-77 W 6-2-4 2-10-3 4-5-1 13-5-6 17-7-1 4-3-0 4-3-0 DNPPitt 02/18/2020 82-67 W 2-1-3 4-2-1 10-6-0 10-2-3 16-5-0 7-7-3 5-1-1 5-2-0

Page 9: NO. 8/8 FLORIDA STATE SEMINOLES (22-4, 12-3 ACC) AT NC STATE WOLFPACK (17-9, 8-7 … · 2020-02-21 · no. 8/8 florida state seminoles (22-4, 12-3 acc) at . nc state wolfpack (17-9,

2019-20 Florida St. Men's BasketballPoints-rebounds-assists

All games

Opponent Date Score 23 24 30 31 33 42 44WALKER,M.J VASSELL,DE PRIETO,HAR WILKES,WYA MILES,WILL YATES,CLEV HANDS,TY

at Pitt 11/06/2019 61-63 L 4-5-0 14-2-1 0-1-0 0-2-1 DNP DNP DNPat UF 11/10/2019 63-51 W 12-3-1 13-6-0 DNP 0-0-1 DNP DNP DNPWCU 11/15/2019 79-74 W 18-4-2 10-5-2 DNP 0-0-0 DNP DNP DNPUTC 11/20/2019 89-53 W DNP 17-8-1 2-1-0 5-2-0 0-0-1 0-0-0 DNPSF-PA 11/23/2019 80-65 W DNP 4-1-1 0-0-0 14-2-0 2-1-0 0-0-0 DNPCSU 11/25/2019 113-56 W DNP 16-2-1 0-2-0 8-3-2 0-0-0 0-0-0 DNPvs UT 11/29/2019 60-57 W 10-3-2 13-5-0 DNP 0-0-0 DNP DNP DNPvs Purdue 11/30/2019 63-60 Wot 7-0-2 13-6-1 DNP 0-1-0 DNP DNP DNPat IND 12/03/2019 64-80 L 10-4-0 10-4-0 DNP 0-0-0 DNP DNP DNPClem 12/08/2019 72-53 W 11-0-2 14-9-2 DNP DNP 0-0-0 0-0-0 0-0-0UNF 12/17/2019 98-81 W 12-1-3 11-4-3 DNP 5-4-3 DNP DNP DNPvs USF 12/21/2019 66-60 W 11-1-1 8-1-2 DNP 0-0-0 DNP DNP DNPUNA 12/28/2019 88-71 W 6-4-1 8-3-2 0-0-0 0-0-1 0-0-0 0-1-0 DNPGaTech 12/31/2019 70-58 W DNP 14-9-1 DNP 0-0-0 DNP DNP DNPat LOU 01/04/2020 78-65 W 23-1-3 14-6-3 DNP DNP DNP DNP DNPat Wake 01/08/2020 78-68 W 15-0-2 17-5-1 4-2-0 0-1-1 DNP DNP DNPUVa 01/15/2020 54-50 W 5-1-0 18-5-3 DNP 0-0-0 DNP DNP DNPat Miami 01/18/2020 83-79 Wot 19-0-2 23-11-5 DNP 3-1-1 DNP DNP DNPND 01/25/2020 85-84 W 8-1-0 11-7-2 DNP 19-2-0 DNP DNP DNPat UVa 01/28/2020 56-61 L 7-0-2 17-6-2 DNP 5-0-0 DNP DNP DNPat Hokies 02/01/2020 74-63 W DNP 27-3-3 DNP 8-1-2 DNP DNP DNPUNC 02/03/2020 65-59 W 2-3-0 6-9-2 DNP DNP DNP DNP DNPMiami 02/08/2020 99-81 W 14-1-2 13-5-3 2-1-0 11-1-0 0-0-0 DNP DNPat Duke 02/10/2020 65-70 L 3-1-0 11-6-0 DNP 0-0-0 DNP DNP DNPSyr 02/15/2020 80-77 W 16-0-1 DNP DNP 8-3-1 DNP DNP DNPPitt 02/18/2020 82-67 W 7-4-4 3-4-2 0-0-1 5-1-2 0-0-0 DNP DNP

Page 10: NO. 8/8 FLORIDA STATE SEMINOLES (22-4, 12-3 ACC) AT NC STATE WOLFPACK (17-9, 8-7 … · 2020-02-21 · no. 8/8 florida state seminoles (22-4, 12-3 acc) at . nc state wolfpack (17-9,

2019-20 Florida St. Men's BasketballTeam Game-by-Game

All games

Page 1/1as of Feb 19, 2020

Total 3-Pointers Free throws ReboundsOpponent Date Score FG-FGA PCT 3FG-FGA PCT FT-FTA PCT OFF DEF TOT AVG PF A TO BLK STL PTS AVGat Pittsburgh 11/06/2019 61-63 L 21-53 .396 6-20 .300 13-15 .867 10 25 35 35.0 27 6 14 6 4 61 61.0at Florida 11/10/2019 63-51 W 20-55 .364 5-17 .294 18-23 .783 11 26 37 36.0 17 11 9 5 8 63 62.0Western Caro. 11/15/2019 79-74 W 25-55 .455 6-20 .300 23-28 .821 9 23 32 34.7 18 10 14 6 3 79 67.7Chattanooga 11/20/2019 89-53 W 34-65 .523 10-25 .400 11-17 .647 11 30 41 36.3 7 20 11 5 10 89 73.0Saint Francis (PA) 11/23/2019 80-65 W 28-60 .467 9-25 .360 15-17 .882 15 23 38 36.6 15 15 19 5 11 80 74.4Chicago St. 11/25/2019 113-56 W 38-58 .655 10-23 .435 27-31 .871 14 29 43 37.7 23 21 16 3 13 113 80.8vs Tennessee 11/29/2019 60-57 W 19-54 .352 3-11 .273 19-29 .655 8 23 31 36.7 21 7 13 2 13 60 77.9vs Purdue 11/30/2019 63-60 Wot 22-58 .379 1-17 .059 18-25 .720 10 23 33 36.3 16 7 13 6 16 63 76.0at Indiana 12/03/2019 64-80 L 25-53 .472 7-19 .368 7-16 .438 7 18 25 35.0 24 7 14 2 8 64 74.7Clemson 12/08/2019 72-53 W 25-54 .463 15-32 .469 7-10 .700 9 25 34 34.9 14 16 13 9 6 72 74.4North Florida 12/17/2019 98-81 W 41-72 .569 6-19 .316 10-14 .714 15 24 39 35.3 13 20 11 4 11 98 76.5vs South Fla. 12/21/2019 66-60 W 22-55 .400 7-27 .259 15-19 .789 8 20 28 34.7 17 16 14 10 13 66 75.7North Ala. 12/28/2019 88-71 W 32-64 .500 7-21 .333 17-17 1.000 10 21 31 34.4 15 17 12 6 9 88 76.6Georgia Tech 12/31/2019 70-58 W 29-63 .460 6-17 .353 6-9 .667 10 23 33 34.3 12 16 12 9 11 70 76.1at Louisville 01/04/2020 78-65 W 32-58 .552 11-23 .478 3-5 .600 9 22 31 34.1 15 15 13 6 6 78 76.3at Wake Forest 01/08/2020 78-68 W 27-62 .435 6-23 .261 18-24 .750 12 22 34 34.1 22 10 10 5 10 78 76.4Virginia 01/15/2020 54-50 W 20-54 .370 8-22 .364 6-8 .750 12 19 31 33.9 10 11 16 5 10 54 75.1at Miami (FL) 01/18/2020 83-79 Wot 29-69 .420 10-28 .357 15-18 .833 13 23 36 34.0 20 21 16 10 15 83 75.5Notre Dame 01/25/2020 85-84 W 30-65 .462 12-18 .667 13-14 .929 12 22 34 34.0 21 15 18 2 9 85 76.0at Virginia 01/28/2020 56-61 L 21-54 .389 7-20 .350 7-11 .636 5 18 23 33.5 20 9 7 5 9 56 75.0at Virginia Tech 02/01/2020 74-63 W 28-57 .491 10-22 .455 8-11 .727 6 27 33 33.4 8 16 9 5 4 74 75.0North Carolina 02/03/2020 65-59 W 23-55 .418 4-15 .267 15-17 .882 9 34 43 33.9 19 9 16 10 3 65 74.5Miami (FL) 02/08/2020 99-81 W 35-66 .530 13-26 .500 16-17 .941 16 30 46 34.4 20 18 19 4 5 99 75.6at Duke 02/10/2020 65-70 L 25-66 .379 3-18 .167 12-20 .600 17 19 36 34.5 18 7 12 7 16 65 75.1Syracuse 02/15/2020 80-77 W 28-65 .431 11-25 .440 13-17 .765 20 27 47 35.0 22 17 18 3 7 80 75.3Pittsburgh 02/18/2020 82-67 W 32-64 .500 9-22 .409 9-12 .750 17 23 40 35.2 21 20 16 6 6 82 75.6Total 1965 711-1554 .458 202-555 .364 341-444 .768 295 619 914 35.2 455 357 355 146 236 1965 75.6Opponents 1706 575-1425 .404 181-562 .322 375-507 .740 277 581 858 33.0 441 258 446 74 146 1706 65.6

Florida St. AveragesGamesPlayed

Points/game FG Pct 3FG

Pct FT Pct Rebounds/game

Assists/game

Turnovers/game

Assist/Turnoverratio

Steals/game

Blocks/game

26 75.6 45.8 36.4 76.8 35.2 13.7 13.7 1.0 9.1 5.6

Page 11: NO. 8/8 FLORIDA STATE SEMINOLES (22-4, 12-3 ACC) AT NC STATE WOLFPACK (17-9, 8-7 … · 2020-02-21 · no. 8/8 florida state seminoles (22-4, 12-3 acc) at . nc state wolfpack (17-9,

2019-20 Florida St. Men's BasketballOpponents Game-by-Game

All games

Page 1/1as of Feb 19, 2020

Total 3-Pointers Free throws ReboundsOpponent Date Score FG-FGA PCT 3FG-FGA PCT FT-FTA PCT OFF DEF TOT AVG PF A TO BLK STL PTS AVGat Pittsburgh 11/06/2019 61-63 L 16-51 .314 9-26 .346 22-31 .710 13 24 37 37.0 16 11 13 1 5 63 63.0at Florida 11/10/2019 63-51 W 14-50 .280 4-22 .182 19-24 .792 13 26 39 38.0 19 6 16 4 3 51 57.0Western Caro. 11/15/2019 79-74 W 27-60 .450 9-23 .391 11-14 .786 10 21 31 35.7 22 10 14 1 5 74 62.7Chattanooga 11/20/2019 89-53 W 23-59 .390 5-24 .208 2-6 .333 8 22 30 34.3 17 8 16 5 4 53 60.3Saint Francis (PA) 11/23/2019 80-65 W 20-54 .370 9-22 .409 16-17 .941 10 17 27 32.8 19 9 21 3 8 65 61.2Chicago St. 11/25/2019 113-56 W 19-52 .365 3-14 .214 15-26 .577 11 9 20 30.7 21 3 22 0 9 56 60.3vs Tennessee 11/29/2019 60-57 W 14-42 .333 5-22 .227 24-29 .828 7 26 33 31.0 20 5 21 7 4 57 59.9vs Purdue 11/30/2019 63-60 Wot 21-62 .339 5-24 .208 13-17 .765 18 30 48 33.1 24 10 24 3 6 60 59.9at Indiana 12/03/2019 64-80 L 25-45 .556 7-15 .467 23-38 .605 10 25 35 33.3 19 10 18 4 5 80 62.1Clemson 12/08/2019 72-53 W 19-53 .358 9-27 .333 6-10 .600 11 21 32 33.2 14 8 18 0 5 53 61.2North Florida 12/17/2019 98-81 W 26-56 .464 13-34 .382 16-19 .842 7 20 27 32.6 14 16 16 2 4 81 63.0vs South Fla. 12/21/2019 66-60 W 24-56 .429 3-15 .200 9-15 .600 16 26 42 33.4 17 5 24 1 8 60 62.8North Ala. 12/28/2019 88-71 W 24-52 .462 10-20 .500 13-18 .722 8 21 29 33.1 17 10 18 3 4 71 63.4Georgia Tech 12/31/2019 70-58 W 22-55 .400 8-22 .364 6-8 .750 10 23 33 33.1 11 15 20 3 7 58 63.0at Louisville 01/04/2020 78-65 W 24-62 .387 8-19 .421 9-14 .643 19 18 37 33.3 13 12 16 5 5 65 63.1at Wake Forest 01/08/2020 78-68 W 19-48 .396 6-18 .333 24-32 .750 9 25 34 33.4 22 7 17 2 1 68 63.4Virginia 01/15/2020 54-50 W 21-46 .457 3-15 .200 5-8 .625 5 24 29 33.1 12 10 18 2 6 50 62.6at Miami (FL) 01/18/2020 83-79 Wot 29-62 .468 11-24 .458 10-17 .588 14 27 41 33.6 18 13 24 4 7 79 63.6Notre Dame 01/25/2020 85-84 W 26-59 .441 10-27 .370 22-27 .815 10 22 32 33.5 14 12 15 2 8 84 64.6at Virginia 01/28/2020 56-61 L 18-41 .439 5-12 .417 20-23 .870 6 30 36 33.6 15 11 17 4 1 61 64.5at Virginia Tech 02/01/2020 74-63 W 25-58 .431 7-30 .233 6-6 1.000 6 24 30 33.4 12 12 10 2 4 63 64.4North Carolina 02/03/2020 65-59 W 21-68 .309 6-19 .316 11-17 .647 14 23 37 33.6 18 10 9 2 7 59 64.1Miami (FL) 02/08/2020 99-81 W 26-64 .406 8-24 .333 21-25 .840 9 15 24 33.2 17 8 13 1 6 81 64.9at Duke 02/10/2020 65-70 L 23-51 .451 7-17 .412 17-22 .773 11 28 39 33.4 17 13 21 5 6 70 65.1Syracuse 02/15/2020 80-77 W 28-63 .444 7-25 .280 14-18 .778 10 19 29 33.2 20 11 11 7 5 77 65.6Pittsburgh 02/18/2020 82-67 W 21-56 .375 4-22 .182 21-26 .808 12 15 27 33.0 13 13 14 1 13 67 65.6Total 1706 575-1425 .404 181-562 .322 375-507 .740 277 581 858 33.0 441 258 446 74 146 1706 65.6Florida St. 1965 711-1554 .458 202-555 .364 341-444 .768 295 619 914 35.2 455 357 355 146 236 1965 75.6

Opponents AveragesGamesPlayed

Points/game FG Pct 3FG

Pct FT Pct Rebounds/game

Assists/game

Turnovers/game

Assist/Turnoverratio

Steals/game

Blocks/game

26 65.6 40.4 32.2 74.0 33.0 9.9 17.2 0.6 5.6 2.8

Page 12: NO. 8/8 FLORIDA STATE SEMINOLES (22-4, 12-3 ACC) AT NC STATE WOLFPACK (17-9, 8-7 … · 2020-02-21 · no. 8/8 florida state seminoles (22-4, 12-3 acc) at . nc state wolfpack (17-9,

F L O R I D A S T A T E U N I V E R S I T Y

GuardRayQuan Evans#0

RayQuan Evans’ Career High’sPTS ........... 8 vs. Miami (2-8-20)FGM ......... 3 vs. Miami (2-8-20)...................3 at Louisville (1-4-20)FGA .......... 5 vs. Miami (2-8-20)...................5 vs. Saint Francis (11-23-19)FG% ......... 1.000 at Louisville (1-4-20)3FGM ....... 1 vs. 3 Teams...................Last at Miami (1-18-20)3FGA ........ 2 vs. 3 Teams...................Last at Miami (1-18-20)3FG% ....... .500 at Miami (1-18-20)................... .500 vs. USF (12-21-19)FTM .......... 4 vs. Chattanooga (11-20-19)FTA ........... 6 vs. Chattanooga (11-20-19)FT% ......... 1.000 vs. 4 Teams...................Last at Virrginia (1-28-20)OR.............2 vs. Miami (2-8-20)DR .............2 vs. Syracuse (2-15-20)...................2 vs. Miami (2-8-20)...................2 at Virginia (1-28-20)...................2 vs. North Alabama (12-28-19)...................2 vs. USF (12-21-19)REBS ........4 vs. Miami (2-8-20)AST ...........5 vs. Saint Francis (11-23-19)BLK .......... 1 at Virginia (1-28-20)...................1 vs. USF (12-21-19)STL ........... 4 vs. Chattanooga (11-20-19)MIN ..........22 vs. Chicago State (11-25-19)underlined denotes career high established or tied during the 2019-20 season

6-4, 210, Junior, Billings, Montana

2019-20 Season* Playing a big role in the Seminoles’ rotation at the point guard position.* One of two junior college transfers (also Nathanael Jack) in the expected to contribute to the Seminoles’ success.* Made his Florida State debut 3 minutes played in Florida State’s victory over Western Carolina* Extended playing time against Chattanooga with 4 points and 4 steals in 13 minutes of play* Totaled 6 points, 5 assists and 2 rebounds in Florida State’s victory at home against Saint Francis* Totaled 6 points, 2 assists and 1 steal in Florida State’s victory over Chicago State in Tallahassee* Scored 4 points, earned 2 assists and 1 blocked shot in Florida State’s victory over USF in the Orange Bowl Classic* Totaled 7 points on a perfect 3 of 3 from the free throw line in Florida State’s victory over North Alabama* Totaled 7 points in 8 minutes of play in Florida State’s victory over No. 7 Louisville at the KFC Yum! Center* His career high of 8 ponits and a careear-high 4 rebounds in Florida State’s victory over Miami in Tallahassee

At North Idaho* Graduated from North Idaho College in 2019 with an Associate’s Degree in Graphic Design.* Recognized as the Northwest Athletic Conference Male Basketball Athlete of the Year in 2019.* Named to the All-East Region Defensive Team and as the East Region MVP in 2019.* LedtheCardinalstoatwo-yearcombinedrecordof56-10;theyfinishedwithacombined27-5overallrecord in NWAC play including a perfect 16-0 record during the 2018-19 season.* Averaged 18.2 points, 7.4 rebounds and 4.9 assists in leading North Idaho to its second consecutive Northwest Athletic Conference championship in 2019.

On Evans* His dad played basketball at the University of Montana. He played two seasons as a forward at Montana. (1993 and 1994). He averaged 9.1 points, 4.2 rebounds, 0.9 steals and 0.3 blocked during his career* Has three brothers – Tray, Tye and Cam.* Originally from (and born in) Georgetown, S.C. Moved to Montana to begin his freshman year of high school.

2019-20 Game-By-Game Statistics -- RayQuan EvansDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 * at Pittsburgh DNPN10 at Florida DNPN15 Western Carolina 1-0 3 0-0 .000 0-0 .000 0-0 .000 0-0 0 0 0 0 0 0 0N20 Chattanooga 2-0 13 0-1 .000 0-0 .000 4-6 .667 0-0 0 0 2 1 0 4 4N23 St. Francis (Pa.) 3-0 17 2-5 .400 0-1 .000 2-2 1.000 1-1 2 1 5 0 0 0 6N25 Chicago State 4-0 22 2-4 .500 0-2 .000 2-2 1.000 0-0 0 3 2 2 0 1 6N29 vs. Tennessee 5-0 7 1-4 .250 0-0 .000 0-0 .000 0-0 0 2 0 0 0 0 2 N30 vs. Purdue 6-0 6 1-2 .500 0-0 .000 2-2 1.00 1-0 1 1 0 1 0 0 4D3 at Indiana 7-0 3 0-0 .000 0-0 .000 0-0 .000 0-0 0 0 0 1 0 0 0D8 * Clemson 8-0 11 0-1 .000 0-0 .000 0-0 .000 0-1 1 0 2 2 0 1 0D17 North Florida 9-0 9 0-1 .000 0-0 .000 0-0 .000 0-1 1 0 0 2 0 1 0D21 vs. USF 10-0 12 1-1 1.000 1-1 1.000 1-2 .500 0-2 2 1 2 1 1 0 4D28 North Alabama 11-0 13 2-3 .667 0-0 .000 3-3 1.000 0-2 2 0 1 1 0 0 7D31 * Georgia Tech 12-0 10 1-3 .333 1-2 .500 0-0 .000 0-1 1 0 2 0 0 0 3J4 * at Louisville 13-0 8 3-3 1.000 1-1 1.000 0-0 .000 0-1 1 0 1 0 0 1 7J8 * at Wake Forest 14-0 6 0-0 .000 0-0 .000 0-0 .000 0-1 1 0 1 0 0 0 0J15 * Virginia 15-0 7 0-0 .000 0-0 .000 0-0 .000 0-1 1 0 0 2 0 0 0J18 * at Miami 16-0 12 1-4 .250 1-2 .500 1-2 .500 1-0 1 2 4 0 0 0 4J25 * Notre Dame 17-0 12 1-1 1.000 0-0 .000 0-0 .000 0-0 0 3 0 2 0 0 2J28 * at Virginia 18-0 9 0-0 .000 0-0 .000 2-2 1.000 0-2 2 0 0 0 1 0 2F1 * at Virginia Tech 19-0 15 2-3 .667 0-1 .000 0-0 .000 0-1 1 0 2 1 0 0 4F3 * North Carolina 20-0 12 2-4 .500 0-0 .000 3-4 .750 0-1 1 1 1 1 0 0 7F8 * Miami 21-0 17 3-5 .600 1-1 1.000 1-2 .500 2-2 4 0 3 0 0 0 8F10 * at Duke 22-0 8 1-2 .500 0-0 .000 0-2 .000 0-0 0 1 0 2 0 0 2F15 * Syracuse 23-0 17 2-4 .500 2-3 .667 0-0 .000 0-2 2 1 4 0 0 0 6F18 * Pittsburgh 24-0 14 1-2 .500 0-0 .000 0-0 .000 0-1 1 1 3 1 0 0 2F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

2RayQuan Evans averaged 18.2 points, 7.4 rebounds and 4.9 assists in leading North Idaho College to its second consecutive North-west Athletic Conference championship in 2019.

Page 13: NO. 8/8 FLORIDA STATE SEMINOLES (22-4, 12-3 ACC) AT NC STATE WOLFPACK (17-9, 8-7 … · 2020-02-21 · no. 8/8 florida state seminoles (22-4, 12-3 acc) at . nc state wolfpack (17-9,

F L O R I D A S T A T E U N I V E R S I T Y

2019-20 Game-By-Game Statistics -- RaiQuan GrayDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 * at Pittsburgh 1-1 27 3-6 .500 0-2 .000 1-2 .500 2-1 3 5 2 1 0 0 7N10 at Florida 2-2 24 1-5 .200 1-3 .333 4-6 .667 0-5 5 1 2 1 0 1 7N15 Western Carolina 3-3 17 1-4 .250 0-1 .000 2-2 1.000 1-1 2 1 1 2 1 0 4N20 Chattanooga DNPN23 St. Francis (Pa.) DNPN25 Chicago State 4-3 16 1-3 .333 0-2 .000 4-4 1.000 2-5 7 3 1 2 0 1 6N29 vs. Tennessee 5-3 18 1-3 .333 0-0 .000 0-0 .000 0-0 0 1 0 1 1 0 2N30 vs. Purdue 6-3 25 2-10 .200 0-4 .000 2-4 .500 1-6 7 1 2 3 1 4 6D3 at Indiana 7-3 26 4-10 .400 0-2 .000 0-1 .000 0-3 3 4 2 2 0 1 8D8 * Clemson 8-3 17 1-2 .500 1-2 .500 4-4 1.000 0-2 2 2 1 0 1 1 7D17 North Florida 9-4 22 5-6 .833 0-1 .000 1-2 .500 0-3 3 1 5 2 1 3 11D21 vs. USF 10-5 28 4-10 .400 1-3 .300 2-2 1.000 3-4 7 2 1 2 3 1 11D28 North Alabama 11-6 18 1-5 .200 0-2 .000 0-0 .000 2-1 3 0 1 1 1 1 2D31 * Georgia Tech 12-7 24 1-4 .250 0-0 .000 2-4 .500 1-1 2 4 1 5 2 1 4J4 * at Louisville 13-8 21 0-2 .000 0-0 .000 2-2 1.000 0-5 5 2 0 4 1 1 2J8 * at Wake Forest 14-9 13 3-4 .750 1-2 .500 2-6 .333 0-1 1 4 2 1 0 0 9J15 * Virginia 15-10 23 1-5 .200 0-1 .000 1-2 .500 1-3 4 0 1 1 0 0 3J18 * at Miami 16-11 14 1-2 .500 0-0 .000 0-0 .000 1-2 3 4 0 2 0 2 2J25 * Notre Dame 17-12 22 6-10 .600 1-1 1.000 0-0 .000 0-4 4 2 0 3 1 0 13J28 * at Virginia 18-13 16 3-4 .750 2-2 1.000 0-0 .000 0-3 3 4 1 2 0 0 8F1 * at Virginia Tech 19-14 20 3-5 .600 1-1 1.000 0-0 .000 1-0 1 0 0 0 0 2 7F3 * North Carolina 20-15 23 5-9 .556 0-1 .000 2-2 1.000 2-5 7 3 1 4 4 2 12F8 * Miami 21-16 12 1-3 .333 0-0 .000 0-0 .000 0-4 4 1 1 0 0 0 2F10 * at Duke 22-17 17 2-4 .500 0-2 .000 2-2 1.000 1-1 2 5 3 1 0 2 6F15 * Syracuse 23-18 21 0-8 .000 0-3 .000 2-2 1.000 5-5 10 4 3 3 0 0 2F18 * Pittsburgh 24-19 14 1-3 .333 0-0 .000 2-2 1.000 1-1 2 1 1 1 1 1 4F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

RaiQuan Gray’s Career HighsPTS ........... 13 vs. Notre Dame (1-25-20)FGM ......... 6 vs. Notre Dame (1-25-20)FGA .......... 10 vs. 4 Teams...................Last vs. Notre Dame (1-25-20)FG% ......... 1.000 vs. 3 Teams...................Last at Wake Forest (3-9-19)3FGM ....... 3 vs. Murray State (3-23-19)3FGA ........ 4 vs. Purdue (11-30-19)...................4 vs. Murray State (3-23-19)3FG% ....... 1.000 at Virginia (1-28-20)...................1.000 at North Carolina (2-23-19)FTM .......... 4 vs. 6 Teams...................Last at Duke (2-10-20)FTA ........... 6 at Wake Forest (1-8-20)...................6 at Florida (11-10-19)FT% ......... 1.000 vs. 11 Teams...................Last vs. Pitt (2-18-20)OR.............5 vs. Syracuse (2-15-20)DR .............6 vs. Purdue (11-30-19)...................6 vs. Gonzaga (3-28-19)REBS ........10 vs. Syracuse (2-15-20)AST ...........5 vs. North Florida (12-17-19)BLK .......... 4 vs. North Carolina (2-3-20)STL ........... 5 vs. Murray State (3-23-19)MIN ..........28 vs. USF (12-21-19)underlined denotes career high established or tied during the 2019-20 season

6-8, 260, Redshirt-Sophomore, Ft. Lauderdale, Fla.

#1 RaiQuan Gray Forward

2019-20 Season* One of three Seminoles with experience as a starter who is expected to play a large part in the Seminoles’ fortunes.* A starter with 7 points and 3 rebounds at Pitt in Florida State’s season opener* Totaled 7 points, 5 rebounds and 2 assists in Florida State’s victory over No. 6 Florida in Gainesville* Scored 6 points and pulled down a career-high 7 rebounds in Florida State’s victory over Chicago St. in Tallahassee* Totaled 6 points, 7 rebounds, 4 steals and 2 assist in Florida State’s victory over Purdue* Scored 8 points to go along with 4 rebounds in Florida State’s game at Indiana in the ACC / Big Ten Challenge* Totaled 11 points with a career-high 5 assists in Florida State’s victory over North Florida* Totaled 11 points and 7 rebounds in Florida State’s victory over USF in the Orange Bowl Classic* Scored his career-high of 13 points in Florida State’s victory over Notre Dame in Tallahassee* Totaled 12 points and a career-high tying 7 rebounds in Florida State’s victory over North Carolina in Tallahassee* A career-high 10 rebounds in and 2 points and Florida State’s victory over Syracuse at the Donald L. Tucker Center

2018-19 Season* Averaged 3.9 points (10th on the team), 2.3 rebounds (sixth), 0.8 steals (third) and shot .721 from the free throw. line (seventh) as he played in 36 of Florida State’s 37 games in leading the Seminoles to the Sweet 16 of the NCAA Tournament.* A starter during the regular season in Florida State’s victory over Southeast Missouri State (Dec. 17) and in the Seminoles’ NCAA Tournament games against Vermont (March 21), Murray State (March 23) and Gonzaga (March 28) in the Sweet 16.* AnintegralpartofFloridaState’srecord-setting2018-19seasonastheSeminolesfinishedwitha28-9record,a 13-5 record in ACC play, in fourth place in the ACC standings, with their third appearance in school history in the ACC Tournament Championship game and a second consecutive appearance in the Sweet 16 of the NCAA Tournament.* Totaled his career-high of 11 points in Florida State’s second round NCAA Tournament game victory over Murray State at the XL Center in Hartford, Conn. His 11 points came in a starters role during which he played his career- high of 24 minutes.

2017-18 Season* A redshirt season. He did not appear in any games during the regular season.* Averaged 8.5 points and 4.5 rebounds in Florida State’s pair of exhibition games wins to begin the season.

On Gray* Graduated from Dillard High School in 2017* As a senior he led Dillard to a 28-5 record overall while averaging a double-double of 16 points and 12 rebounds.* HelpedthePanthersfinish28-4andnationallyranked20thbyMaxPreps.* Was recognized by MaxPreps as a part of the Tour of Champions nationally ranked teams.* Selected as a member of the 2016 and 2017 All-Broward County First-Team by the Miami Herald.

4/3RaiQuan Gray started four games as a redshirt fresh-man -- one in the regular season against Southeast Missouri State and three

in the NCAA Tournament against Vermont, Murray

State and Gonzaga

Page 14: NO. 8/8 FLORIDA STATE SEMINOLES (22-4, 12-3 ACC) AT NC STATE WOLFPACK (17-9, 8-7 … · 2020-02-21 · no. 8/8 florida state seminoles (22-4, 12-3 acc) at . nc state wolfpack (17-9,

F L O R I D A S T A T E U N I V E R S I T Y

2019-20 Game-By-Game Statistics -- Anthony PoliteDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 * at Pittsburgh 1-0 23 2-10 .200 2-6 .333 2-2 1.000 1-3 4 3 0 3 0 1 8N10 at Florida 2-0 18 2-3 .667 1-1 1.000 2-2 1.000 0-2 2 1 0 1 1 1 7N15 Western Carolina 3-0 24 1-4 .250 1-4 .250 0-0 .000 0-2 2 0 1 2 1 2 3N20 Chattanooga 4-1 25 0-4 .000 0-3 .000 1-2 .500 0-2 2 1 0 1 0 0 1N23 St. Francis (Pa.) 5-2 29 3-6 .500 2-4 .500 0-0 .000 1-6 7 0 2 5 1 5 8N25 Chicago State 6-3 15 3-4 .750 1-1 1.000 2-2 1.000 2-2 4 0 5 0 0 3 9N29 vs. Tennessee 7-3 17 1-5 .200 0-3 .000 0-0 .000 0-1 1 2 0 0 0 1 2N30 vs. Purdue 8-3 21 1-2 .500 0-1 .000 0-2 .000 0-0 0 1 0 0 0 1 2D3 at Indiana 9-3 18 2-4 .500 1-3 .333 2-2 1.000 1-2 3 4 0 1 1 1 7D8 * Clemson 10-3 18 4-7 .571 4-6 .667 0-0 .000 1-2 3 0 2 1 0 0 12D17 North Florida 11-3 20 2-6 .333 0-2 .000 0-0 .000 1-3 4 1 0 1 0 0 4D21 vs. USF 12-3 24 4-9 .444 2-7 .286 1-2 .500 1-4 5 1 4 0 1 2 11D28 North Alabama 13-3 15 4-5 .800 1-2 .500 2-2 1.000 0-1 1 1 1 1 0 1 11D31 * Georgia Tech 14-4 29 2-8 .250 2-4 .500 2-2 1.000 1-3 4 1 2 2 0 2 8J4 * at Louisville 15-4 18 1-5 .200 1-4 .250 0-0 .000 2-0 2 2 1 1 0 0 3J8 * at Wake Forest 16-4 14 2-5 .400 0-3 .000 0-0 .000 0-1 1 3 1 0 0 0 4J15 * Virginia 17-4 20 5-6 .833 4-4 1.000 0-0 .0000 0-1 1 2 0 2 0 3 14J18 * at Miami 18-4 32 4-9 .444 2-6 .333 0-0 .000 2-3 5 1 3 2 0 5 10J25 * Notre Dame 19-4 25 3-7 .429 3-5 .600 0-0 .000 1-1 2 1 5 0 0 3 9J28 * at Virginia 20-4 22 1-4 .250 0-2 .000 2-4 .500 2-1 3 3 1 0 0 1 4F1 * at Virginia Tech 21-5 26 3-9 .333 0-5 .000 1-3 .333 1-3 4 3 2 2 0 1 7F3 * North Carolina 22-6 12 0-2 .000 0-1 .000 0-0 .000 0-0 0 2 0 1 0 0 0F8 * Miami 23-6 17 1-2 .500 0-1 .000 0-0 .000 1-7 8 1 0 3 0 1 2F10 * at Duke 24-6 17 0-1 .000 0-1 .000 0-0 .000 0-1 1 1 0 0 0 0 0F15 * Syracuse 25-7 24 1-5 .200 0-02 .000 2-3 .667 3-2 5 4 1 1 1 0 4F18 * Pittsburgh 26-7 19 4-6 .667 2-4 .500 0-0 .000 1-5 6 1 0 1 0 2 10F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

Anthony Polite’s Career HighsPTS ........... 14 vs. Virginia (1-15-20)FGM ......... 5 vs. Virginia (1-15-20)FGA .......... 9 at Virginia Tech (2-1-20)...................9 at Miami (1-18-20)...................9 vs. USF (12-21-19)FG% ......... 1.000 vs. Wake Forest (2-13-19)3FGM ....... 4 vs. Virginia (1-15-20)...................4 vs. Clemson (12-8-19)3FGA ........ 7 vs. USF (12-21-19)3FG% ....... 1.000 vs. Virginia (1-15-20)...................1.000 vs. Murray State (3-23-19)FTM .......... 4 vs. Canisius (11-19-18)FTA ........... 4 vs. Canisius (11-19-18)................... 4 vs. Florida (11-6-18)FT% ......... 1.000 vs. 11 teams...................Last vs. Georgia Tech (12-31-19)OR.............4 vs. Troy (12-3-18)DR .............7 vs. Miami (2-8-20)REBS ........8 vs. Miami (2-8-20)AST ...........5 vs. Notre Dame (1-25-20)...................5 vs. Chicago State (11-25-19)BLK .......... 1 vs. 8 Teams...................Last vs. Syracuse (2-15-20)STL ........... 5 at Miami (1-18-20)...................5 vs. Saint Francis (11-23-19)MIN ..........32 at Miami (1-18-20)underlined denotes career high established or tied during 2019-20 season

GuardAnthony Polite#26-6, 215, Redshirt Sophomore, Lugano, Switzerland

2019-20 Season* Named the Most Outstanding Player with 11 points, 5 rebounds and 4 assists in Florida State’s 66-60 victory over USF in the Orange Bowl Classic at the BB&T Center in Sunrise, Fla.* Will play a large role in Florida State’s success as sure-handed point guard* EntershisthirdseasonintheSeminoles’programhavingplayedin31gamesinhisfirsttwoseasons* Totaled 7 points, 2 rebounds and 1 steal in Florida State’ victory over No. 6 Florida in Gainesville* AstarterforthefirsttimeinhiscareerintheSeminoles’victoryoverChattanoogainTallahassee* Totaled 8 points and a career-high 7 rebounds in Florida State’s victory over Saint Francis in Tallahassee* Scored 9 points to go along with a career-high 5 assists in Florida State’s win over Chicago State* Totaled12pointsonacareer-high4made3-pointfieldgoalsinFSU’shomewinoverClemson* Totaled 11 points on 2 of 2 made free throws in Florida State’s victory over North Alabama on December 28* Hiscareer-highof14pointson4of4made3-pointfieldgoalsinFloridaState’svictoryoverVirginiainTallahassee* Totaled10pointson2made3-pointfieldgoalsinFloridaState’sovertimewinoverMiamionCoralGables* Totaled 2 poiunts and a career-high 8 rebounds in Florida State’s victory over Miami in Tallahassee* Totaled 10 points, 6 rebounds and 2 steals in Florida State’s victory over Pittsburgh at the Donald L. Tucker Center

2018-19 Season* Averaged 2.7 points (11th on the team), 1.6 rebounds (ninth) and 0.6 steals (seventh) while playing in 30 of Florida State’s 37 games during its record-setting and NCAA Tournament season.* Averaged 11.5 minutes played per game as one of 11 Seminoles who averaged 11 or more minutes played per game* Shot.773fromthefieldashefinishedtheseasonasoneofonlyfiveplayersontheteamtoshoot77percentorbetter

14Anthony Polite scored his career-high of 14 points in Florida State’s victory over

Virginia on January 15, 2020. He was a perfect 4

of 4 from the 3-point line in the Seminoles win.

Page 15: NO. 8/8 FLORIDA STATE SEMINOLES (22-4, 12-3 ACC) AT NC STATE WOLFPACK (17-9, 8-7 … · 2020-02-21 · no. 8/8 florida state seminoles (22-4, 12-3 acc) at . nc state wolfpack (17-9,

F L O R I D A S T A T E U N I V E R S I T Y

#3 Trent Forrest Guard

Trent Forrest’s Career HighsPTS ..........23 vs. Southeast Missouri (12-17-18)FGM ........9 at Louisville (1-4-20)FGA .........16 at Pitt (11-6-19)FG% .........857 vs. Nicholls State (12-8-16)...................857 vs. Detroit Mercy (11-20-16)3FGM ......2 vs. Pitt (2-18-20)..................2 vs. Chicago State (11-25-19)3FGA .......4 vs. Pitt (2-18-20)..................4 vs. North Florida (12-17-19)..................4 vs. Southeast Missouri (12-17-18)3FG % .....1.000 vs. Chicago State (11-25-19)..................1.000 vs. Nicholls State (12-8-16)FTM .........11 at Pitt (1-14-19)FTA ..........12 at Pitt (1-14-19)FT% ........1.000 vs. 18 Teams..................Last at Duke (2-10-20)OR............6 at Duke (2-28-17)DR ............11 vs. UAB (11-22-18)REBS .......11 vs. UAB (11-22-18)..................11 vs. Syracuse (1-13-18)AST ..........12 vs. Southern Miss (12-21-17)BLK .........3 vs. USF (12-21-19)STL ..........8 at Duke (2-10-20)MIN .........40 vs. Syracuse (1-13-18)underlined denotes career high established or tied during 2019-20 season

6-4, 210, Graduate Student, Chipley, Fla.

2019-20 Season* On the Watch List for the Bob Cousy Award presented to the nation’s top point guard.* A pre-season All-ACC Second-Team selection by the voting media at Operation ACC Basketball.* Named to the Emerald Coast Classic All-Tournament Team as the Seminoles won the championship* AteamcaptainasnamedbyHeadCoachLeonardHamiltonandhisstaff.* Scored 16 points to go along with 2 rebounds, 2 assists and 1 steal in Florida State’s win over Western Carolina* Totaled 17 points, 4 rebound and 3 steals in Florida State’s win over Purdue to win the Emerald Coast Classic* Season-high20pointson9of11shootingfromthefieldwith5assistsinFloridaState’svictoryatLouisville* Second career double double of 14 points and 10 rebounds in Florida State’s victory at Wake Forest* Totaled 13 points, 7 assists, 5 rebounds and 4 steals in Florida State’s victory over Notre Dame in Tallahassee* Tied for the team-high with 14 points, 4 rebounds and 2 blocked shots in Florida State’s victory over North Carolina* A near triple double with 18 points, 9 rebounds and 8 steals at Cameron Indoor Stadum against Duke

2018-19 Season* Averagedacareer-high9.3points(thirdontheteam),4.5rebounds(fourth),3.7assists(first)andacareer-high1.9 steals(first)asFloridaState’sstartingpointguard.* Named to the NCAA Tournament All-West Regional Tournament team in leading FSU to the NCAA Sweet 16* Career-high 23 points with 8 rebounds, 4 assists and 3 steals in Florida State’s victory over Southeast Missouri * Totaled 10 points, 6 rebounds and 3 assists in Florida State’s victory over No. 2 Virginia in the ACC Tournament* Totaled 20 points, 5 rebounds, 4 assists and 3 steals in Florida State’s Sweet 16 game against Gonzaga in the NCAA Tournament

2017-18 Season * Averaged7.9points(fifth)and3.9assists(first)asheplayedin34gameswithtwostarts* Named to the 2018 All-ACC Academic Men’s Basketball Team and the 2018 ACC Honor Roll* Career-high21pointsandfirstcareerdouble-doubleof21pointsand10reboundsagainstBostonCol.onMarch3* Totaled 16 points and 4 assists came in Florida State’s overtime win over Clemson on Feb. 14* Totaled 14 points, 5 rebounds, 4 steals and 3 assists in Florida State’s victory over Xavier in the NCAA Tournament

2016-17 Season* Averaged4.9points(tiedforseventh),2.7rebounds(seventh)and1.2steals(first)asheplayedinall35games* Named to the 2017 ACC All-Academic Men’s Basketball Team * Totaled his season-high of 13 points and 6 rebounds in Florida State’s victory over Nicholls State on Dec. 8

On Forrest* A consensus top 50 prep player who was ranked 45th among all prep players by ESPN.com entering college with the class of 2016* Ranked as the seventh best player in the state of Florida, the 11th best shooting guard in the nation, the 48th best player in the country and was a four-star player by Sports Illustrated* Ranked as the 62nd best high school player in the nation by Scout.com2019-20 Game-By-Game Statistics -- Trent ForrestDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 * at Pittsburgh 1-1 39 8-16 .500 1-3 .333 2-3 .667 0-2 2 2 2 5 1 2 19N10 at Florida 2-2 31 1-7 .143 1-3 333 5-6 .833 3-5 8 1 7 4 0 1 8N15 Western Carolina 3-3 32 5-14 .357 1-3 .333 5-5 1.000 1-1 2 4 2 1 0 1 16N20 Chattanooga 4-4 30 2-4 .500 0-1 .000 1-2 .500 0-4 4 1 7 4 2 1 5N23 St. Francis (Pa.) 5-5 26 3-7 .429 0-1 .000 7-7 1.000 1-4 5 1 4 3 0 2 13N25 Chicago State 6-6 15 5-8 .625 2-2 1.000 0-0 .000 0-2 2 0 6 2 0 3 12N29 vs. Tennessee 7-7 34 3-11 .273 0-0 .000 3-5 .600 0-4 4 2 4 8 1 1 9N30 vs. Purdue 8-8 39 6-13 .462 0-3 .000 5-6 .833 2-2 4 0 0 2 0 3 17D3 at Indiana 9-9 35 5-9 .556 0-0 .000 3-6 .500 4-0 4 2 2 4 0 1 13D8 * Clemson 10-10 30 4-8 .500 1-3 .333 0-0 .000 0-3 3 2 5 2 0 1 9D17 North Florida 11-11 26 4-9 .444 1-4 .250 2-2 1.000 0-3 3 1 1 1 0 0 11D21 vs. USF 12-12 28 5-10 .500 1-2 .500 0-0 .000 0-1 1 2 3 2 3 2 11D28 North Alabama 13-13 23 3-4 .750 1-1 1.000 3-3 1.000 2-2 4 2 6 3 1 0 10D31 * Georgia Tech 14-14 35 4-11 .364 0-2 .000 0-0 .000 0-3 3 2 6 1 2 1 8J4 * at Louisville 15-15 33 9-11 .818 1-1 1.000 1-2 .500 1-2 3 1 5 3 0 2 20J8 * at Wake Forest 16-16 34 5-11 .454 0-1 .000 4-4 1.000 3-7 10 1 2 1 0 4 14J15 * Virginia 17-17 34 1-6 .167 0-2 .000 3-4 .750 1-6 7 2 7 5 2 4 5J18 * at Miami 18-18 38 4-9 .444 0-0 .000 4-4 1.000 2-1 3 1 5 3 1 2 12J25 * Notre Dame 19-19 32 3-9 .333 0-0 .000 7-8 .875 1-4 5 2 7 4 0 4 13J28 * at Virginia 20-20 31 1-4 .250 0-1 .000 2-2 1.000 2-1 3 3 3 1 1 3 4F1 * at Virginia Tech 21-21 34 3-7 .429 902 .000 1-1 1.000 1-8 9 0 5 1 1 1 7F3 * North Carolina 22-22 35 5-12 .417 1-3 .333 3-4 .750 0-4 4 1 3 4 2 1 14F8 * Miami 23-23 23 3-6 .500 0-1 .000 4-4 1.000 2-4 6 1 6 2 0 2 10F10 * at Duke 24-24 32 6-13 .462 0-3 .000 6-6 1.000 3-6 9 1 4 2 1 8 18F15 * Syracuse 25-25 37 5-7 .714 1-1 1.000 2-5 .400 1-4 5 1 6 6 0 2 13F18 * Pittsburgh 26-26 25 4-9 .444 2-4 .500 0-0 .0000 0-2 2 1 3 4 0 2 10F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

3Trent Forrest became just the third player in FSU

history to be named to the NCAA All-Region Team in 2019. Phil Cofer and

Terance Mann were named to the All-West

Regional Team in 2018.

Page 16: NO. 8/8 FLORIDA STATE SEMINOLES (22-4, 12-3 ACC) AT NC STATE WOLFPACK (17-9, 8-7 … · 2020-02-21 · no. 8/8 florida state seminoles (22-4, 12-3 acc) at . nc state wolfpack (17-9,

F L O R I D A S T A T E U N I V E R S I T Y

2019-20 Game-By-Game Statistics -- Patrick WilliamsDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 * at Pittsburgh 1-0 27 1-5 .200 1-2 .500 2-2 1.000 0-2 2 1 0 1 1 0 5N10 at Florida 2-0 15 2-4 .500 0-1 .000 0-0 .000 1-4 5 2 0 1 3 1 4N15 Western Carolina 3-0 23 5-8 .625 1-2 .500 7-7 1.000 1-3 4 0 1 2 0 0 18N20 Chattanooga 4-0 20 6-10 .600 3-5 .600 2-2 1.000 1-2 3 0 3 0 0 1 16 N23 St. Francis (Pa.) 5-0 22 2-6 .333 0-2 .000 2-2 1.000 1-4 5 1 1 5 1 1 6N25 Chicago State 6-0 20 6-8 .750 0-1 .000 4-4 1.000 1-2 3 3 1 1 0 1 16N29 vs. Tennessee 7-0 18 4-6 .667 0-0 .000 0-1 .000 0-2 2 0 1 2 0 1 8N30 vs. Purdue 8-0 17 26 .333 0-1 .000 0-1 .000 0-1 1 1 2 1 0 3 4D3 at Indiana 9-0 26 2-7 .286 0-2 .000 1-2 .500 0-1 1 2 2 1 1 1 5D8 * Clemson 10-0 26 3-6 .500 2-4 .500 1-2 .000 1-3 4 2 0 0 2 0 9D17 North Florida 11-0 21 4-7 .571 1-2 .500 2-2 1.000 3-1 4 0 3 2 1 1 11D21 vs. USF 12-0 25 2-4 .500 0-1 .000 2-2 1.000 2-3 5 3 2 4 0 1 6D28 North Alabama 13-0 19 4-9 .444 2-2 1.000 2-2 1.000 0-3 3 2 3 2 1 1 12D31 * Georgia Tech 14-0 26 6-9 .667 0-1 .000 0-0 .000 3-1 4 1 0 1 2 1 12J4 * at Louisville 15-0 24 1-4 .250 0-1 .000 0-0 .000 1-2 3 1 1 3 3 1 2J8 * at Wake Forest 16-0 21 3-9 .333 0-4 .000 0-0 .000 0-2 2 3 0 1 1 0 6J15 * Virginia 17-0 12 2-6 .333 0-1 .000 0-0 .000 3-0 3 3 0 2 0 1 4J18 * at Miami 18-0 17 0-4 .000 0-2 .000 2-2 1.000 0-2 2 3 1 2 4 1 2J25 * Notre Dame DNPJ28 * at Virginia DNPF1 * at Virginia Tech 19-0 24 3-10 .300 0-2 .000 1-1 1.000 1-3 4 2 1 1 0 0 7F3 * North Carolina 20-0 24 3-4 .750 2-2 1.000 6-6 1.000 0-9 9 3 2 1 0 1 14F8 * Miami 21-0 19 5-9 .556 2-3 .667 2-2 1.000 3-2 5 4 1 3 1 1 14 F10 * at Duke 22-0 22 2-9 .222 0-1 .000 3-5 .600 1-1 2 0 0 1 1 3 7F15 * Syracuse 23-0 32 7-14 .500 1-2 .500 2-2 1.000 2-5 7 3 4 0 0 0 17F18 * Pittsburgh 24-0 22 7-12 .583 1-1 1.000 1-1 1.000 4-1 5 2 0 1 1 0 16F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

Patrick Williams’ Career HighsPTS ..........18 vs. Western Carolina (11-15-19)FGM ........7 vs. Pitt (2-18-20)..................7 vs. Syracuse (2-15-20)FGA .........14 vs. Syracuse (2-15-20)FG% .........750 vs. Chicago State (11-25-19)3FGM ......2 vs. 4 Teams..................Last vs. North Carolina (2-3-20)3FGA .......4 vs. Clemson (12-8-19)3FG % .....1.000 vs. North Carolina (2-3-20)..................1.000 vs. North Alabama (12-28-19)FTM .........7 vs. Western Carolina (11-15-19)FTA ..........7 vs. Western Carolina (11-15-19)FT% ........1.000 vs. 12 Teams..................Last vs. Syracuse (2-15-20)OR............4 vs. Pitt (2-18-20)DR ............9 vs. North Carolina (2-3-20)REBS .......9 vs. North Carolina (2-3-20)AST ..........3 vs. North Alabama (12-28-19)..................3 vs. North Florida (12-17-19)..................3 vs. Chattanooga (11-20-19)STL ..........3 at Duke (2-10-20)..................3 vs. Purdue (11-30-19)BLK .........4 at Miami (1-18-20)MIN .........32 vs. Syracuse (2-15-20)underlined denotes career high established or tied during 2018-19 season

6-8, 225, Freshman, Charlotte, N.C.

2019-20 * AtopcandidateforACCRookieoftheYearinhisfirstseasonasaSeminole* A silky smooth player who can play any position on the court* Totaled 5 points, 2 rebounds and 1 blocked shot in his career debut at Pitt* Totaled 4 points, 5 rebounds and a game-high tying 3 blocked shots in Florida State’s victory over No. 6 Florida* Scored a game-high tying 18 points and was a perfect 7-7 from the free throw line in FSU’s win over W. Carolina* Totaled 16 points, 3 rebounds, 3 assists and 2 steals in Florida State’s win over Chattanooga in Tallahassee* Totaled 16 points, 3 rebounds and 1 blocked shot in Florida State’s victory over Chicago State in Tallahassee* Doublefigureswith11points,4reboundsand3assistsinFloridaState’svictoryoverNorthFlorida* Doublefigureswith12points,3reboundsand3assistsinFloridaState’svictoryoverNorthAlabama* Doublefigureswith12points,4rebounds,2blockedshotsand1stealinFloridaState’swinoverGeorgiaTech* Totaled 14 points, a career-high 9 rebounds and 2 assists in Florida State’s victory over North Carolina in Tallahassee* Scored 14 points to go along with 5 rebounds, 1 blocked shot and 1 steal in Florida State’s win at home over Miami* Totaled 17 points in a careare-high 32 minutes played in Florida State’s victory over Syracuse in Tallahassee* Scored 16 points to go along with 5 rebounds and 1 blocked shot in Florida State’s win over Pitt in Tallahassee

On Williams* Afive-starplayerandaconsensustop-25recruit* ESPN ranked him as the 34th best player and the sixth best small forward in the country* The No. 7 small forward and the top prospect in the state of North Carolina in 2019* Named to the Naismith High School Boy’s Watch List prior to the start of his freshman season* Was a guard growing up as he arrived as a freshman at West Charlotte on only 6-0* His growth spurt has allowed him to be one of the most versatile players in the incoming class.

ForwardPatrick Williams#4

1/7Patrick Williams was named as the No. 1

prospect in the state of North Carolina and the No. 7 small forward prospect in the nation by ESPN.com as

a high school senior.

Page 17: NO. 8/8 FLORIDA STATE SEMINOLES (22-4, 12-3 ACC) AT NC STATE WOLFPACK (17-9, 8-7 … · 2020-02-21 · no. 8/8 florida state seminoles (22-4, 12-3 acc) at . nc state wolfpack (17-9,

F L O R I D A S T A T E U N I V E R S I T Y

Balsa Koprivica’s Career HighsPTS ........... 15 vs. North Florida (12-17-19)FGM ......... 6 vs. North Florida (12-17-19)FGA .......... 8 vs. North Florida (12-17-19)FG% ......... 1.000 vs. Purdue (11-30-19)...................1.000 vs. Tennessee (11-29-19)...................1.000 vs. Western Carolina (11-15-19)3FGM .......3FGA ........3FG% .......FTM .......... 4 vs. Tennessee (11-29-19)...................4 vs. Chicago State (11-25-19)FTA ........... 6 vs. Saint Francis (11-23-19)FT% ......... 1.000 vs. 5 Teams...................Last vs. Notre Dame (1-25-20)OR.............4 vs. Pitt (2-18-20)...................4 vs. Notre Dame (1-25-20)DR .............5 vs. Chicago State (11-25-19)REBS ........7 vs. Pitt (2-18-20)...................7 vs. Chicago State (11-25-19)...................7 vs. Chattanooga (11-20-19)AST ...........3 vs. Pitt (2-18-20)BLK .......... 2 vs. Purdue (11-30-19)STL ........... 2 vs. Tennessee (11-29-19)...................2 vs. Saint Francis (11-23-19)MIN ..........20 vs. Saint Francis (11-15-19)underlined denotes career high established or tied during 2019-20 season

#5 Balsa Koprivica Center7-1, 260, Freshman, Belgrade, Serbia

2019-20 Season* One of two 7-footers on the Seminoles’ roster who will earn a great deal of playing time. * Totaled 4 points, 2 rebounds and 1 blocked shot in Florida State’s victory over Western Carolina* Doublefiguresscoringforthefirsttimeinhiscareerwith10pointsand7reboundsinFloridaState’swinover Chattanooga* Totaled 11 points, 3 rebounds and 2 steals in Florida Stat’s victory over Saint Francis in Tallahassee* Doublefiguresforthethirdstraightgamewith10pointsand7reboundsinFloridaState’swinoverChicagoState* Totaled 8 points, 3 rebounds and 2 steals in Florida State’s victory over Tennessee in the Emerald Coast Classic* Earned 4 points, 2 rebounds and 2 blocked shots in Florida State’s victory over Purdue in the Emerald Coast Classic Championship game* Career-high 15 points in Florida State’s victory over North Florida* Doublefigureswith13piintsand3reboundsinFloridaState’svictoryoverNorthAlabama* Scored 6 points and added 6 rebounds after missing 4 games in Florida State’s victory over Notre Dame* Totaled 7 points, a career-high tying 7 rebounds and a career-high 3 assists in Florida State’s win over Pitt

On Koprivica* A consensus top-60 national recruit* A four-star recruit by Scout, Rivals, 247 Sports and ESPN* The No. 12 center and the No. 56 overall player in the 2019 recruiting class according to 247Sports* Considered to be the third best player in the talent-rich state of Florida* Has good hands, can consistently make jump shots and has strong rebounding abilities.

2019-20 Game-By-Game Statistics -- Balsa KopriviciaDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 * at Pittsburgh 1-0 6 0-0 .000 0-0 .000 2-2 1.000 1-1 2 5 0 1 0 0 2N10 at Florida 2-0 6 1-2 .500 0-0 .000 0-0 .000 0-0 0 3 0 0 0 0 0N15 Western Carolina 3-0 11 2-2 1.000 0-0 .000 0-0 .000 1-1 2 3 0 3 1 0 4N20 Chattanooga 4-0 12 5-6 .833 0-0 .000 0-2 .000 3-4 7 1 1 0 1 0 10N23 St. Francis (Pa.) 5-0 20 5-6 .833 0-0 .000 1-3 .222 2-1 3 0 0 0 0 1 11N25 Chicago State 6-0 18 3-4 .750 0-0 .000 4-5 .800 2-5 7 1 1 3 0 1 10N29 vs. Tennessee 7-0 19 2-2 1.000 0-0 .000 4-4 1.000 1-2 3 3 0 1 0 2 8N30 vs. Purdue 8-0 15 2-2 1.000 0-0 .000 0-0 .0000 2-2 4 4 0 1 2 1 4D3 at Indiana 9-0 6 0-0 .000 0-0 .000 0-0 .000 0-1 1 2 0 0 0 0 0D8 * Clemson 10-0 8 1-1 1.000 0-0 .000 0-0 .000 0-0 0 0 0 0 0 0 2D17 North Florida 11-0 14 6-8 .750 0-0 .000 3-5 .600 3-0 3 3 1 2 1 1 15D21 vs. USF 12-0 9 0-1 .000 0-0 .000 0-0 .000 0-2 2 3 0 0 0 0 0D28 North Alabama 13-0 21 5-6 .833 0-0 .000 3-3 1.000 0-3 3 2 0 2 0 0 13D31 * Georgia Tech 14-0 2 1-1 1.000 0-0 .000 1-1 1.000 1-1 2 0 0 0 0 1 3J4 * at Louisville DNPJ8 * at Wake Forest DNPJ15 * Virginia DNPJ18 * at Miami DNPJ25 * Notre Dame 15-0 13 2-6 .333 0-0 .000 2-2 1.000 4-2 6 3 1 0 0 1 6J28 * at Virginia 16-0 14 1-3 .333 0-0 .000 0-2 .000 0-1 1 2 0 1 0 1 2F1 * at Virginia Tech 17-0 10 1-3 .333 0-0 ,000 0-0 ,000 0-0 0 0 1 0 0 0 2F3 * North Carolina 18-0 7 1-1 1.000 0-0 .000 0-0 .000 0-0 0 0 0 0 0 0 2F8 * Miami 19-0 9 1-3 .333 0-0 .000 1-1 1.000 1-4 5 1 0 2 0 0 3F10 * at Duke 20-0 7 1-2 .500 0-0 .000 0-1 .000 1-1 2 1 0 0 0 0 2F15 * Syracuse 21-0 6 2-3 .667 0-0 .000 0-0 .000 3-0 0 0 0 1 1 0 4F18 * Pittsburgh 22-0 17 3-4 .750 0-0 .000 1-2 .500 4-3 7 4 3 0 0 0 7F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

57-3Balsa Koprivica helped

lead Montverde Academy to a 57-3 record

(.950 winning percentage)in his two seasons.

Page 18: NO. 8/8 FLORIDA STATE SEMINOLES (22-4, 12-3 ACC) AT NC STATE WOLFPACK (17-9, 8-7 … · 2020-02-21 · no. 8/8 florida state seminoles (22-4, 12-3 acc) at . nc state wolfpack (17-9,

F L O R I D A S T A T E U N I V E R S I T Y

ForwardMalik Osborne#106-9, 215, Redshirt Sophomore, Matteson, Ill.

2019-20* BeginsplayinhisfirstactiveseasonintheSeminoles’rosteraftersittingoutthe2018-19seasonaftertransferring to Florida State from Rice prior to the season* A starter with 2 points and a game-high 9 rebounds in Florida State’s season-opener at Pitt* Totaled 10 points, 4 rebounds and 1 steal in Florida State’s victory at No. 6 Florida in Gainesville* Totaled 6 points, 9 rebounds and 1 blocked shot in Florida State’s victory over Western Carolina* Totaled 10 points and 3 rebounds as a starter in Florida State’s victory over Chattanooga in Tallahassee* Totaled 4 points, 6 rebounds and 3 steals in Florida State’s victory over Tennessee in the Emerald Coast Classic* Florida State career-high of 14 points with 4 rebounds in Florida State’s victory over North Alabama* Totaled 7 points, 9 rebounds and 1 blocked shot in Florida State’s victory over Louisville on the road in the ACC* Scored 8 points to go along with 6 rebounds in Florida State’s victory over North Carolina in Tallahassee* Totled 14 points, 5 rebounds and 2 blocked shots in Florida State’s game at Duke in Durham

2018-19 Season * Sat out the 2018-19 season after transferring from Rice where he played as a freshman during the 2017-18 season* TraveledwiththeSeminolestoHartford,Conn.,forthefirsttworoundsofthe2019NCAATournament

2017-18 Season* Averaged9.0points(fourthontheteam),6.5rebounds(second),0.8blockedshots(first)and0.6steals(third), whileshooting.414fromthefield* Ranked third amongst his Owl teammates with 280 points* Rankedfifthontheteamwith223-pointshotsmade* Started 27 of the Owls’ 31 games

On Osborne* Graduated from Rich South High School in Illinois in 2016* Averaged 10.8 points, 7.1 rebounds and 1.6 blocked shots as a member of the varsity team as a senior* Led the Stars to an 18-8 record* Earned All-Conference First Team and All-Area Honorable Mention honors in 2017* A team leader as Rich South advanced to the second round of the state high school championship tournament* Played in 25 of the Rich South’s 26 games…

Malik Osborne’s Career HighsPTS ........... 22 vs. Marshall (2-15-18)FGM ......... 7 at FIU (2-14-18)................... 7 vs. Marshall (2-15-18)FGA .......... 17 vs. Marshall (2-15-18)FG% ......... 1.000 vs. Chicago State (11-25-19)3FGM ....... 3 vs. 5 teams...................Last vs. Saint Francis (11-23-19)3FGA ........ 9 vs. Marshall (2-15-18)3FG% ....... 1.000 vs. Miami (2-8-20)FTM .......... 9 vs. Charlotte (1-6-18)FTA ........... 11 vs. Charlotte (1-6-18)FT% ......... 1.000 vs. 12 Teams...................Last vs. Syracuse (2-15-20)OR............. 5 vs. UNLV (11-20-17)DR ............. 10 vs. Marshall (2-15-18)REBS ........ 13 vs. Texas San Antonio (12-28-17)................... 13 vs. Marshall (2-15-18)AST ........... 2 vs. 6 teams...................Last at FIU (2-14-18)BLK .......... 4 at Pitt (11-6-19)STL ........... 4 at Stephen F. Austin (12-9-17)MIN .......... 36 at Stephen F. Austin (12-9-17)underlined denotes career high established or tied during 2019-20 season

22Malik Osborne scored his career-high of 22 points against Marshall on Feb.

15, 2018. After transferring to Florida State from Rice he has three years of eligi-

bility remaining

2019-20 Game-By-Game Statistics -- Malik OsborneDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 * at Pittsburgh 1-1 23 1-4 .250 0-2 .000 0-0 .000 2-7 9 2 0 1 4 0 2N10 at Florida 2-2 26 4-7 .571 0-0 .000 2-2 1.000 2-2 4 4 0 0 0 1 10N15 Western Carolina 3-3 15 2-2 1.000 0-0 .000 2-3 .667 4-5 9 2 1 1 1 0 6N20 Chattanooga 4-4 20 4-10 .400 1-3 .333 1-1 1.000 0-3 3 1 2 1 0 0 10N23 St. Francis (Pa.) 5-5 24 3-7 .429 3-5 .600 0-0 .000 1-3 4 2 0 1 2 0 9N25 Chicago State 6-6 15 2-2 1.000 0-0 .000 0-0 .000 2-3 5 1 1 0 0 0 4N29 vs. Tennessee 7-7 16 1-1 1.000 1-1 1.000 1-4 .250 2-4 6 1 0 0 0 3 4 N30 vs. Purdue 8-8 18 1-3 .333 0-1 .000 2-2 1.000 2-4 6 2 0 0 0 0 4D3 at Indiana 9-9 22 3-5 .600 1-2 .500 0-0 .000 1-2 3 1 1 1 0 2 7D8 * Clemson 10-10 22 2-5 .400 1-4 .250 0-0 .000 1-5 6 3 1 1 2 0 5D17 North Florida 11-10 9 1-5 .200 0-1 .000 0-0 .000 3-2 5 0 1 0 1 0 2D21 vs. USF 12-10 14 1-2 .500 0-1 .000 0-0 .000 1-0 1 2 1 1 0 2 2D28 North Alabama 13-11 18 6-12 .500 2-5 .400 0-0 .000 3-1 4 2 0 0 1 1 14D31 * Georgia Tech 14-12 22 3-5 .600 1-1 1.000 0-0 .000 0-4 4 1 2 0 1 2 7J4 * at Louisville 15-13 29 3-7 .429 1-3 .000 0-0 .000 4-5 9 4 1 1 1 0 7J8 * at Wake Forest 16-14 21 3-6 .500 1-1 1.000 2-2 1.000 3-2 5 2 0 1 0 3 9J15 * Virginia 17-15 26 2-5 .400 1-3 .333 0-0 .000 3-1 4 0 0 0 0 0 5J18 * at Miami 18-16 31 2-4 .500 0-1 .000 2-3 .667 1-4 5 3 0 0 1 1 6J25 * Notre Dame 19-17 14 0-2 .000 0-1 .000 0-0 .000 0-1 1 2 0 2 0 0 0J28 * at Virginia 20-18 25 2-7 .286 0-2 .000 1-1 1.000 1-3 4 2 0 0 2 1 5F1 * at Virginia Tech 21-19 10 0-0 .000 0-0 .000 1-2 .500 0-2 2 0 0 0 0 0 1F3 * North Carolina 22-20 15 3-5 .600 1-1 1.000 1-1 1.000 2-4 6 1 0 0 0 0 8F8 * Miami 23-21 12 2-3 .667 2-2 1.000 0-0 .000 1-2 3 2 0 0 0 0 6F10 * at Duke 24-22 23 6-13 .462 2-6 .333 0-0 .000 4-1 5 3 0 2 2 0 14F15 * Syracuse 25-23 17 1-4 .250 0-0 .000 2-2 1.000 2-1 3 1 0 0 0 2 4 F18 * Pittsburgh 26-24 11 2-4 .500 0-2 .000 1-1 .000 1-0 1 0 1 1 1 1 5F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

Page 19: NO. 8/8 FLORIDA STATE SEMINOLES (22-4, 12-3 ACC) AT NC STATE WOLFPACK (17-9, 8-7 … · 2020-02-21 · no. 8/8 florida state seminoles (22-4, 12-3 acc) at . nc state wolfpack (17-9,

F L O R I D A S T A T E U N I V E R S I T Y

2019-20 Game-By-Game Statistics -- Nathanael JackDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 * at Pittsburgh 1-0 3 0-0 .000 0-0 .000 0-0 .000 0-1 1 0 0 0 0 0 0N10 at Florida DNPN15 Western Carolina DNPN20 Chattanooga 2-0 14 2-5 .400 2-5 .400 0-0 .000 1-4 5 1 1 1 0 1 6N23 St. Francis (Pa.) 3-0 9 1-5 .200 1-5 .200 0-0 .000 0-1 1 1 2 2 0 0 3N25 Chicago State 4-0 14 4-6 .667 4-6 .667 2-2 1.000 0-1 1 3 2 0 0 0 14N29 vs. Tennessee DNPN30 vs. Purdue DNP D3 at Indiana DNPD8 * Clemson DNPD17 North Florida 5-0 7 2-4 .500 1-3 .333 0-0 .000 0-0 0 2 0 0 0 0 5D21 vs. USF DNPD28 North Alabama 6-0 7 1-2 .500 1-2 .500 0-0 .000 0-0 0 2 0 0 0 0 3D31 * Georgia Tech 7-0 1 1-2 .500 0-1 .000 0-0 .000 0-0 0 0 0 0 0 0 2J4 * at Louisville DNPJ8 * at Wake Forest DNPJ15 * Virginia DNPJ18 * at Miami 8-0 1 0-0 .000 0-0 .000 0-0 .000 0-0 0 1 0 1 0 0 0J25 * Notre Dame 9-0 2 0-1 .000 0-1 .000 0-0 .000 0-0 0 0 0 0 0 0 0J28 * at Virginia DNPF1 * at Virginia Tech DNPF3 * North Carolina DNPF8 * Miami 10-0 3 0-2 .000 0-2 .000 0-0 .000 0-0 01 0 0 0 0 0 0F10 * at Duke DNPF15 * Syracuse DNPF18 * Pittsburgh 11-0 4 2-2 1.000 1-1 1.000 0-0 .000 0-2 2 1 0 1 0 0 5F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

Nathanael Jack’s Career HighsPTS ........... 14 vs. Chicago State (11-25-19)FGM ......... 4 vs. Chicago State (11-25-19)FGA .......... 6 vs. Chicago State (11-25-19)FG% ......... 1.000 vs. Pitt (2-18-20)3FGM ....... 4 vs. Chicago State (11-25-19)3FGA ........ 6 vs. Chicago State (11-25-19)3FG% ....... .667 vs. Chicago State (11-25-19)FTM .......... 2 vs. Chicago State (11-25-19)FTA ........... 2 vs. Chicago State (11-25-19)FT% ......... 1.000 vs. Chicago State (11-25-19)OR............. 1 vs. Chattanooga (11-20-19)DR ............. 4 vs. Chattanooga (11-20-19)REBS ........ 5 vs. Chattanooga (11-20-19)AST ........... 2 vs. Chicago State (11-25-19)................... 2 vs. Saint Francis (11-23-19)BLK ..........STL ........... 1 vs. Chattanooga (11-20-19) MIN .......... 14 vs. Chicago State (11-25-19)................... 14 vs. Chattanooga (11-20-19)underlined denotes career high established or tied during 2019-20 season

#11 Nathanael Jack Guard

6-5, 195, Junior, Mississauga, Ontario, Canada

2019-20 Season* WillbeintheSeminoles’rotationattheguardpositioninhisfirstseasonatFloridaState.* A junior college transfer from Eastern Florida State College which is located in Cocoa, Florida* Totaled 6 points and 5 rebounds in 11 minutes of playing time in the Seminoles’ victory over Chattanooga * Career-high 14 points and 2 assists in Florida State’s victory over Chicago State in Tallahassee* Totaled 5 points and 2 rebounds in Florida State’s victory over Pitt in Tallahassee

At Eastern Florida State College* Graduated from Eastern Florida State College in 2019 with an Associate’s Degree in General Education.* Helped lead Eastern Florida State College to the Junior College National Championship Tournament in Hutchinson, Kan., in both of his seasons.* TheTitansfinishedasthenationalrunners-upin2018andadvancedtothequarterfinalsin2019.* Led Eastern Florida to two consecutive Mid-Florida Conference Championships in both of his years at the school.

On Jack* Was born in Canada and still considers Canada to be his home.* Chose Florida State over Kansas, Oklahoma, Texas Tech Arizona State and Miami.* Major is Social Science - with a specialization of Social Entrepreneurship and Innovation.

8Nathanael Jack made his ju-nior college career-high of eight3-pointfieldgoalsinEastern Florida State Col-lege’s victory over Chipola College during the 2018-19

season

Page 20: NO. 8/8 FLORIDA STATE SEMINOLES (22-4, 12-3 ACC) AT NC STATE WOLFPACK (17-9, 8-7 … · 2020-02-21 · no. 8/8 florida state seminoles (22-4, 12-3 acc) at . nc state wolfpack (17-9,

F L O R I D A S T A T E U N I V E R S I T Y

Justin Lindner’s Career HighsPTS ........... 4 vs. Chicago State (11-25-19)FGM ......... 1 vs. North Alabama (12-28-19)...................1 vs. Clemson (12-8-19)...................1 vs. Chicago State (11-25-19)FGA .......... 1 vs. North Alabama (12-28-19)................... 1vs. Chicago State (11-25-19)...................1 vs. Murray State (3-23-19)...................1 vs. Southern Miss (12-21-17)FG% .........3FGM ....... 1 vs. Clemson (12-8-19)3FGA ........ 1 vs. Clemson (12-8-19)3FG% .......FTM .......... 2 vs. Chicago State (11-25-19)...................2 at Georgia Tech (2-16-19)FTA ........... 2 vs. Chicago State (11-25-19)...................2 at Georgia Tech (2-16-19)...................2 vs. Wake Forest (2-13-19)FT% ......... 1.000 vs. Chicago State (11-25-19) ................... 1.000 at Georgia Tech (2-16-19)OR.............1 vs. Wake Forest (2-13-19)DR .............2 vs. Chicago State (11-25-19)REBS ........2 vs. Chicago State (11-25-19)AST ...........2 vs. Miami (2-8-20)...................2 vs. Chattanooga (11-20-19)...................2 vs. Southern Miss (12-21-17)STL ........... 1 at Georgia Tech (2-16-19)MIN ..........5 vs. Chattanooga (11-20-19)underlined denotes career high established or tied during 2019-20 season

#12 Justin Lindner Guard

2019-20 Game-By-Game Statistics -- Justin LindnerDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 * at Pittsburgh DNPN10 at Florida DNPN15 Western Carolina DNPN20 Chattanooga 1-0 5 0-0 .000 0-0 .000 0-0 .000 0-1 1 0 2 1 0 0 0N23 St. Francis (Pa.) 2-0 1 0-0 .000 0-0 .000 0-0 .000 0-0 0 1 0 0 0 0 0N25 Chicago State 3-0 4 1-1 1.000 0-0 .000 2-2 1.000 0-2 2 1 0 2 0 0 4N29 vs. Tennessee DNPN30 vs. Purdue DNPD3 at Indiana DNPD8 * Clemson 4-0 1 1-1 1.000 1-1 1.000 0-0 .000 0-0 0 0 0 0 0 0 3D17 North Florida DNPD21 vs. USF DNPD28 North Alabama 5-0 1 1-1 1.000 0-0 .000 0-0 .000 0-0 0 0 0 0 0 0 2D31 * Georgia Tech DNPJ4 * at Louisville DNPJ8 * at Wake Forest DNPJ15 * Virginia DNPJ18 * at Miami DNPJ25 * Notre Dame DNPJ28 * at Virginia DNPF1 * at Virginia Tech DNPF3 * North Carolina DNPF8 * Miami 6-0 2 0-0 .000 0-0 .000 0-0 .000 0-1 1 1 2 1 0 0 0F10 * at Duke DNPF15 * Syracuse DNPF18 * Pittsburgh 7-0 1 0-0 .000 0-0 .000 0-0 .000 0-0 0 0 0 1 0 0 0F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

6-1, 180, Redshirt Junior, Memphis, Tennessee

2019-20* One of the Seminoles’ most experienced guards who is in his fourth season as a member of the program* HashelpedtheSeminolesreachtheNCAATournamentinhisfirstthreeseasonsasaSeminole.* Joined the team as a freshman in the fall of 2016.* Career high of 5 minutes of playing time with 2 assists in Florida State’s victory over Chattanooga in Tallahassee* Firstcareerfieldgoalandcareer-high4pointsin4minutesofplayinFloridaState’svictoryoverChicagoState* Firstcareer3-pointfieldgoaland3pointsinFloridaState’swinoverClemsoninTallahassee

2018-19 Season* Averaged 0.3 points, 0.7 rebounds and 0.7 assists as he played in a career-high seven games.* A member of Florida State’s 2018 NCAA Elite Eight team who is in his third season as a member of the Seminole men’s basketball team.

2017-18 Season* Averaged0.0pointsand0.2reboundsasheplayedinfivegamesinhissecondseasonasaSeminole* Averaged 4.0 points and 1.0 rebound in Florida State’s two-game exhibition season to begin the season* EarnedplayingtimeinaregularseasongameforthefirsttimeinhiscareeragainstFordhamintheJamaicaClassic* Totaled 1 rebound in 2 minutes of playing time in Florida State’s victory over The Citadel on Nov. 24* Earned 1 minute of playing time in Florida State’s victory over Missouri in the NCAA Tournament

2016-17* Became a member of the Seminole men’s basketball team to begin the 2016-17 season* Practiced and traveled with the team but did not play in any games

On Lindner* Graduated from Christian Brothers School in Memphis, Tenn., in 2016* A member of the varsity at Christian Brothers High School as a sophomore, junior and as a senior* Helped Christian Brothers to a 57-3 record (.950 winning percentage) and two state championship tournament appearances during his junior and senior seasons* Averaged 11.0 points, 4.8 assists and 0.9 steals while shooting 53 percent from the field in leading Christian Brothers to a 28-2 record and to the semifinals of the state championship tournament as a junior

57-3Justin Linder helped

Christian Brothers High School in Memphis to a

57-3 record and two state championship tournament

appearances as a junior and senior

Page 21: NO. 8/8 FLORIDA STATE SEMINOLES (22-4, 12-3 ACC) AT NC STATE WOLFPACK (17-9, 8-7 … · 2020-02-21 · no. 8/8 florida state seminoles (22-4, 12-3 acc) at . nc state wolfpack (17-9,

F L O R I D A S T A T E U N I V E R S I T Y

CenterDominik Olejniczak#157-0, Graduate, Transfer, Torun, Poland (Pronounced: DOM-A-Nick Oh-Lynn-A-Chuck)

2019-20 Season (at Florida State)* PlayinghisfinalseasonofeligibilityaftertransferringtoFloridaStatefromOleMissasagraduatetransfer.* OnlythethirdgraduatetransferatFloridaStatefollowingthefootstepsofJeffPeterson(2012)andDavidNichols (2019). Both Peterson and Nichols helped lead the Seminoles to the NCAA Tournament.* Comes to Florida State after one season at Drake (2015-16) and two seasons at Ole Miss (2017-18 and 2018-19)* Made his Florida State debut with 2 rebounds in 7 minutes of play in Florida State’s win at Florida in Gainesville* Scored 10 points in the Seminoles’ victory over Chattanooga in Tallahassee * ScoredhisFloridaStatehighof11pointson5madefieldgoalsinFloridaState’svictoryoverNorthFlorida

2018-19 Season (At Ole Miss)* Averaged5.3points(seventhontheteam),3.0rebounds(fifth),acareer-highandteam-leading0.9blockedshots (first)andshotateamleading.575fromthefieldasheplayedinall33gamesatOleMiss.* Established career-highs for games played (33), games started (22), assists (23), blocked shots (30), steals (17), minutes played (603) and average minutes played per game (16.3).* Led the Rebels to the NCAA Tournament with a 20-13 overall record and a 10-8 record in SEC play.

2017-18 Season (At Ole Miss)* Averaged 4.3 points (eighth on the team), 2.6 rebounds (sixth) and 0.6 blocked shots (fourth) while playing in all 32 games for the Rebels.* Started11gamesfortheRebelsinhisfirstseasonofeligibilityinOxford.* Shot.531fromthefieldashecontinuedtodisplayhisfieldgoalshootingprowess.

2016-17 (at Ole Miss)* Sat out the season at Ole Miss as a redshirt due to NCAA transfer regulations…practiced but did not travel with the Rebels during the season.

2015-16 Season* Averagedacareer-high6.5points(fourthontheteam),acareer-high4.1rebounds(third)and0.7blockedshots(first) in helping Drake to a 7-24 overall record.* Drake is a member of the Missouri Valley Conference.* Played in 30 of the Bulldogs 31 games and averaged 16.4 minutes played per game.* Shotacareer-high.722fromthefieldandwasonly18fieldgoalsmadeshortofestablishingtheDrakeschoolrecord forbestfieldgoalpercentageinasingleseason.

On Olejniczak* OlejniczakisworkingtowardsearninghisMaster’sdegreeinInternationalAffairsatFloridaState.* Named to the National Team of Poland for competition in the FIBA World Cup of Basketball in China on August. 30, 2019.* Polandadvancedtothequarterfinalsandearnedaneighthplacestandingwitha5-3record.

Dominik Olejniczak’s Career HighsPTS ........... 19 vs. Loyola (2-17-16)*FGM ......... 9 vs. Missouri State (3-3-16)*FGA .......... 13 at Texas (1-27-18)**................... 13 vs. Missouri State (3-3-16)*FG% ......... 1.000 vs. 15 Teams...................Last vs. Pitt (2-18-20)***3FGM .......3FGA ........3FG% .......FTM .......... 9 vs. Auburn (1-9-19)**FTA ........... 12 vs. Auburn (1-9-19)**FT% ......... 1.000 vs. 18 Teams...................Last vs. Syracuse (2-15-20)***OR.............6 at Auburn (1-9-19)**DR .............11 vs. Simpson College (11-13-15)*REBS ........12 vs. Simpson College (11-13-15)*AST ...........3 vs. Oklahoma (3-22-19)**BLK .......... 6 vs. Loyola (2-17-16)*STL ........... 8 at Duke (2-10-20)***...................3 vs. Chattanooga (12-16-18)**................... 3 at Auburn (1-9-18)**MIN ..........34 vs. Loyola (2-27-16)*underlined denotes career high established or tied during 2019-20 season* - Denotes at Drake (2015-16)** - Denotes at Ole Miss (2017-18, 2018-19)*** - Denotes at Florida State (2019-20)

8Dominik Olejniczak helped lead Poland to an 8th place finishinthe2019FIBA

World Championships. It washisfirsttimeplaying

his national team from Po-land in competition

2019-20 Game-By-Game Statistics -- Dominik OlejniczakDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 * at Pittsburgh DNPN10 at Florida 1-0 7 0-1 .000 0-1 .000 0-0 .000 1-1 2 2 0 0 0 0 0N15 Western Carolina 2-0 4 0-0 .000 0-0 .000 0-0 .000 0-0 0 2 0 0 0 0 0N20 Chattanooga 3-0 8 5-6 .833 0-0 .000 0-0 .000 2-1 3 1 0 0 0 0 10N23 St. Francis (Pa.) 4-1 13 1-3 .333 0-0 .000 2-2 1.000 4-0 4 2 0 2 1 0 4N25 Chicago State 5-2 16 3-4 .750 0-0 .000 2-2 1.000 1-3 4 2 0 2 2 0 8N29 vs. Tennessee 6-3 14 1-3 .333 0-0 .000 0-0 .000 2-2 4 4 0 0 0 2 2N30 vs. Purdue 7-4 13 1-2 .500 0-0 .000 0-0 .000 0-1 1 2 0 0 0 0 2D3 at Indiana 8-5 9 2-2 1.000 0-0 .000 0-2 .000 1-1 2 1 0 0 0 0 4D8 * Clemson 9-6 8 0-3 .000 0-0 .000 0-0 .000 3-0 3 2 1 1 0 1 0D17 North Florida 10-7 16 5-7 .714 0-0 .000 1-2 .500 1-2 3 0 0 1 0 2 11D21 vs. USF 11-8 5 1-1 1.000 0-0 .000 0-0 .000 0-0 0 1 0 1 0 0 2D28 North Alabama DNPD31 * Georgia Tech 12-8 15 4-6 .667 0-0 .000 1-2 .500 1-1 2 0 2 1 1 1 9J4 * at Louisville 13-8 7 0-0 .000 0-0 .000 0-0 .000 0-1 1 2 0 0 0 0 0J8 * at Wake Forest 14-8 7 0-0 .000 0-0 .000 0-0 .000 2-0 2 2 0 2 0 0 0J15 * Virginia 15-8 9 0-1 .000 0-0 .000 0-0 .000 1-1 2 0 0 0 0 0 0J18 * at Miami 16-8 9 1-2 .500 0-0 .000 0-0 .000 0-0 0 0 0 0 1 0 2J25 * Notre Dame 17-8 10 2-3 .667 0-0 .000 0-0 .000 2-3 5 4 0 2 0 0 4J28 * at Virginia 18-8 6 1-3 .333 0-0 .000 0-0 .000 0-0 0 0 0 1 0 0 2F1 * at Virginia Tech 19-8 16 2-5 .400 0-0 .000 0-0 .000 0-2 2 1 0 2 2 1 4F3 * North Carolina 20-8 10 0-3 .000 0-0 .000 0-0 .000 2-2 4 2 0 0 1 0 0F8 * Miami 21-8 13 3-4 .750 0-0 .000 2-2 1.000 2-0 2 1 0 3 0 2 8F10 * at Duke 22-8 11 1-3 .333 0-0 .000 0-0 .000 3-1 4 1 0 3 1 0 2F15 * Syracuse 22-8 14 2-3 .667 0-0 .000 2-2 1.000 1-3 4 5 0 2 0 0 6F18 * Pittsburgh 23-8 11 4-4 1.000 0-0 .000 0-0 .0000 1-1 2 2 0 1 2 0 8F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

Page 22: NO. 8/8 FLORIDA STATE SEMINOLES (22-4, 12-3 ACC) AT NC STATE WOLFPACK (17-9, 8-7 … · 2020-02-21 · no. 8/8 florida state seminoles (22-4, 12-3 acc) at . nc state wolfpack (17-9,

F L O R I D A S T A T E U N I V E R S I T Y

#20 Travis Light Guard

Travis Light’s Career HighsPTS ........... 6 vs. Miami (2-8-20)...................6 vs. Southern Miss (12-21-17)FGM ......... 2 vs. Miami (2-8-20)...................2 vs. Southern Miss (12-21-17)FGA .......... 3 vs. Southern Miss (12-21-17)FG% ......... 1.000 vs. Miami (2-8-20)3FGM ....... 2 vs. Miami (2-8-20)...................2 vs. Southern Miss (12-21-17)3FGA ........ 3 vs. Southern Miss (12-21-17)3FG% ....... 1.000 vs. Miami (2-8-20)FTM ..........FTA ...........FT% .........OR.............DR .............1 vs. The Citadel (11-24-17)REBS ........1 vs. The Citadel (11-24-17)AST ...........BLK ..........STL ...........MIN ..........4 vs. Chicago State (11-25-19)underlined denotes career high established or tied during 2019-20 season

10.4Travis Light averaged 10.4 points in his only season at IMG Academy during the

2015-16 season

6-5, 175, Redshirt Junior, Vienna, Va.

2019-20 Season* In his fourth season as a member of the Seminole men’s basketball team and at the beginning of the 2019-20 season * Has two years of eligibility remaining* A member of three NCAA Tournament teams – the second round in 2017, the Elite Eight in 2018 and the Sweet 16 in 2019* Has played in three NCAA Tournament games in his career — two in 2018 (against Missouri and Gonzaga) and one in 2019 (against Murray State)* Made his 2019-20 debut with 3 points in 3 minutes of playing time in Florida State’s victory over Chattanooga* Career-high6pointsonacareer-high2made3-pointfieldgoalsinFloridaState’svictoryoverMiamathome

2018-19 Season* Averaged 0.0 points, 0.0 rebounds and 0.2 steals while playing a career-high six games as he helped Florida State reach the NCAA Tournament for the third time in his career.* The Seminoles advanced to the Sweet 16 of the NCAA Tournament for the third time in his career.

2017-18 Season* Averaged1.2pointsand0.2reboundsasheplayedinacareer-highfivegames* Averaged 1.5 points as he earned playing time in both of Florida State’s exhibition games in 2017-18* EarnedplayingtimeinaregularseasongameforthefirsttimeinhiscareeragainstFordhamintheJamaicaClassic* Career-highsixpoints--thefirstpointsofhiscareer--inFloridaState’svictoryoverSouthernMiss

2016-17 Season * A redshirt season* Practiced and traveled with the team throughout the year* One of the Seminoles’ top practice players who often emulates the opponent’s best shooter in practice* Helped Florida State to a 26-9 overall record and a 12-6 record in ACC play* TheSeminoles’12-6overallrecordallowedthemtofinishinsecondplaceintheACCstandingsandtiedtheschool record for ACC wins in a single season

On Travis Light* Averaged 10.4 points, 3.6 rebounds and 2.3 assists in 18 games played at IMG Academy in 2016* Graduated from Montverde Academy in 2015* Was a member of the Eagles’ prep team coached by former North Carolina shooting guard Dante Calabria…

2019-20 Game-By-Game Statistics -- Travis LightDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 * at Pittsburgh DNPN10 at Florida DNPN15 Western Carolina DNPN20 Chattanooga 1-0 3 1-1 1.000 1-1 1.000 0-0 .000 0-0 0 0 0 0 0 0 3N23 St. Francis (Pa.) 2-0 1 0-1 .000 0-1 .000 0-0 .000 0-0 0 0 0 0 0 0 0N25 Chicago State 3-0 4 0-0 .000 0-0 .000 0-0 .000 0-0 0 0 0 0 0 0 0N29 vs. Tennessee DNPN30 vs. Purdue DNPD3 at Indiana DNPD8 * Clemson 4-0 1 0-0 .000 0-0 .000 0-0 .000 0-0 0 0 0 0 0 0 0D17 North Florida DNPD21 vs. USF DNPD28 North Alabama 5-0 1 0-1 .000 0-1 .000 0-0 .000 0-0 0 0 0 0 0 0 0D31 * Georgia Tech DNPJ4 * at Louisville DNPJ8 * at Wake Forest DNPJ15 * Virginia DNPJ18 * at Miami DNPJ25 * Notre Dame DNPJ28 * at Virginia DNPF1 * at Virginia Tech DNPF3 * North Carolina DNPF8 * Miami 6-0 1 2-2 1.000 2-2 1.000 0-0 .000 0-0 0 0 0 0 0 0 6F10 * at Duke DNPF15 * Syracuse DNPF18 * Pittsburgh 7-0 1 0-0 .000 0-0 .000 0-0 .000 0-0 0 0 0 0 0 0 0F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

Page 23: NO. 8/8 FLORIDA STATE SEMINOLES (22-4, 12-3 ACC) AT NC STATE WOLFPACK (17-9, 8-7 … · 2020-02-21 · no. 8/8 florida state seminoles (22-4, 12-3 acc) at . nc state wolfpack (17-9,

F L O R I D A S T A T E U N I V E R S I T Y

GuardM.J. Walker#23

M.J. Walker’s Career HighsPTS ........... 24 at Virginia Tech (1-20-18)FGM ......... 9 at Louisville (1-4-20)FGA .......... 16 vs. LSU (11-23-18)FG% ......... .800 vs. George Washington (11-14-17)3FGM ....... 6 at Miami (1-27-19)3FGA ........ 9 vs. Syracuse (2-15-20)...................9 at Miami (1-18-20)...................9 vs. LSU (11-23-18)...................9 vs. Southern Miss (12-21-17)3FG% ....... .857 at Miami (1-27-19)FTM .......... 7 vs. Pitt (2-18-18)FTA ........... 8 vs. Pitt (2-18-18)FT% ......... 1.000 vs. 23 Teams...................Last vs. Miami (2-8-20)OR.............3 vs. Canisius (11-19-18)DR .............6 at Virginia Tech (1-20-18)REBS ........6 vs. Murray State (3-23-19)...................6 at Virginia Tech (1-20-18)AST ...........5 at Miami (1-27-19)...................5 vs. Duke (1-12-19)STL ........... 3 vs. LSU (11-23-18)...................3 vs. Michigan (3-24-18)BLK .......... 2 at Boston College (1-20-19)MIN ..........42 vs. LSU (11-23-18)underlined denotes career high established or tied during 2018-19 season

6-5, 213, Junior, Jonesboro, Ga.

2019-20* AteamcaptainasnamedbyHeadCoachLeonardHamiltonandhisstaff.* A starter in the Seminoles’ backcourt for the second consecutive season* A member of two NCAA Tournament teams -- the Elite Eight in 2018 and the Sweet 16 in 2019* Totaled 12 points, 3 rebounds, 1 assist and 1 steal in Florida State’s victory over No. 6 Florida in Gainesville* Totaled 18 points (17 in the second half) along with 4 rebounds and 2 assists in Florida State’s win over W. Carolina* Scored10pointswith2assistsinFloridaState’svictoryoverTennesseeintheEmeraldCoastClassicsemifinals* Scored 10 points to go along with 4 rebounds in Florida State’s game at Indiana in the ACC / Big Ten Challenge* Totaled 11 points to goal along with 2 assists and 1 steal in Florida State’s victory over Clemson at home* Totaled12pointson5madefieldgoalswith3assistsinFloridaState’svictoryoverNorthFlorida* Scored 11 points to go along with 2 steals in Florida State’s victory in the Orange Bowl Classic over USF* Totaled 23 points on 5 made 3-point shots in Florida State’s victory over on the road in the ACC at Louisville* Totaled 15 points on 3 made 3-point shorts in Florid State’s victory over Wake Forest in Winston-Salem* Scored 19 points (17 in the second half and 2 in overtime) in Florida State’s overtime win over Miami in Coral Gables* Totaled16pointson5made3-pointfieldgoalsinFloridaState’svictoryoverSyracuseinTallahassee

2018-19 Season* Averaged a career-high 7.5 points (fourth on the team), a career-high 2.2 rebounds (seventh), a career-high 1.6 assists (fourth) and a career-high 0.8 steals (second) while making a career-high 44 3-point shots (second)* Shot a career-high .759 from the free throw line and made a career-high 49 free throws* HelpedleadtheSeminolestoa29-8overallrecord,a13-3markintheACC,toafourthplacefinishintheACCstand ings, Florida State’s appearance in the ACC Tournament Championship for the third time in school history and to the Sweet 16 of the NCAA Tournament for the second consecutive season

2017-18 Season* Averaged 7.0 points (seventh) and 1.7 rebounds (ninth) while making 41 3-point shots (fourth) in 35 games* Career-high24pointson8madefieldgoalsand4made3-pointfieldgoalsinFloridaState’swinoverVirginiaTech* Totaled14pointsinhisfirstcareerstartinFloridaState’s88-75victoryoverPittinTallahasseeonFeb.18* Totaled 12 points, 3 rebounds and 2 assists in his career debut against George Washington on Nov. 14* Scored 15 points to go along with 2 assists and 1 steal in Florida State’s victory over Southern Miss on Dec. 21* Scoredateam-high22pointson5made3-pointfieldgoalsinFloridaState’svictoryoverColoradoState

On Walker* Graduated from Jonesboro High School in 2017* Named the 6A Player of the Year in the State of Georgia by the Atlanta Journal-Constitution as he averaged 27.8 points, 6.5 rebounds and 2.4 assists as a senior* Led Jonesboro to a 23-6 overall record as a senior* Named to the USA Today All-USA Second-Team in 2016

3M.J. Walker received three scholarshipofferstoplay

football at Clemson, Miami (Fla.) and Michigan. He

was a free safety and a wide receiver as a high school

football star

2019-20 Game-By-Game Statistics -- M.J. WalkerDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 * at Pittsburgh 1-1 16 0-4 .000 0-2 .000 4-4 1.000 0-5 5 4 0 0 0 0 4N10 at Florida 2-2 32 3-10 .300 1-5 .200 5-6 .833 0-3 3 1 1 2 1 1 12N15 Western Carolina 3-3 26 5-11 .455 3-6 .500 5-7 .714 0-4 4 3 2 1 1 0 18N20 Chattanooga DNPN23 St. Francis (Pa.) DNPN25 Chicago State DNPN29 vs. Tennessee 4-4 24 3-10 .300 1-3 .333 3-5 .600 1-2 3 3 2 1 0 0 10N30 vs. Purdue 5-5 26 2-8 .250 1-5 .200 2-2 1.000 0-0 0 0 2 4 1 1 7D3 at Indiana 6-6 19 4-8 .500 2-6 .333 0-0 .000 0-4 4 5 0 2 0 0 10D8 * Clemson 7-7 28 3-9 .333 3-6 .500 2-2 1.000 0-0 0 1 2 3 0 1 11D17 North Florida 8-8 18 5-7 .714 1-2 .500 1-1 1.000 0-1 1 1 3 0 0 0 12D21 vs. USF 9-9 23 2-9 .222 1-6 .167 6-7 .857 1-0 1 0 1 2 0 2 11D28 North Alabama 10-10 16 1-6 .167 0-2 .000 4-4 1.000 0-4 4 3 1 1 - 2 6D31 * Georgia Tech DNPJ4 * at Louisville 11-11 28 9-13 .714 5-7 .714 0-1 .000 0-1 1 1 3 1 1 0 23J8 * at Wake Forest 12-12 32 5-14 .357 3-8 .375 2-3 .667 0-0 0 2 2 2 0 0 15J15 * Virginia 13-13 28 2-9 .222 1-6 .167 0-0 .000 0-1 1 2 0 3 0 1 5J18 * at Miami 14-14 23 6-15 .400 4-9 .444 3-3 1.000 0-0 0 3 2 1 1 1 19J25 * Notre Dame 15-15 24 3-8 .375 2-3 .667 0-0 .000 0-1 1 2 0 3 1 0 8J28 * at Virginia 16-16 31 3-10 .300 1-2 .500 0-0 .000 0-0 0 1 2 0 1 1 7F1 * at Virginia Tech DNPF3 * North Carolina 17-16 25 1-7 .143 0-4 .000 0-0 .000 1-2 3 3 0 2 0 0 2F8 * Miami 18-17 30 4-10 .400 2-4 .500 4-4 1.000 0-1 1 4 2 2 1 0 14F10 * at Duke 19-18 25 1-5 .200 0-3 .000 1-2 .500 1-0 1 1 0 1 0 1 3F15 * Syracuse 20-19 18 5-11 .455 5-9 .556 1-1 1.000 0-0 0 1 1 1 0 0 16F18 * Pittsburgh 21-20 24 1-7 .143 1-4 .250 4-6 .667 1-3 4 4 4 2 0 0 7F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

Page 24: NO. 8/8 FLORIDA STATE SEMINOLES (22-4, 12-3 ACC) AT NC STATE WOLFPACK (17-9, 8-7 … · 2020-02-21 · no. 8/8 florida state seminoles (22-4, 12-3 acc) at . nc state wolfpack (17-9,

F L O R I D A S T A T E U N I V E R S I T Y

#24 Devin Vassell Guard/ Forward

Devin Vassell’s Career HighsPTS ..........27 at Virginia Tech (2-1-20)FGM ........9 at Miami (1-18-20)FGA .........16 at Miami (1-18-20)FG% .........857 vs. Chicago State (11-25-19)...................857 at Pitt (11-6-19)3FGM ......7 at Virginia Tech (2-1-20)3FGA .......7 at Virginia Tech (2-1-20)3FG% ......1.000 vs. 6 Teams ..................Last at Virginia Tech (2-1-20)FTM .........8 at Wake Forest (1-8-20)..................8 vs. Tennessee (11-29-19)FTA ..........10 vs. Tennessee (11-29-19)FT% ........1.000 vs. 8 teams..................Last vs. Virginia (2-8-20)OR............5 vs. Chattanooga (11-20-19)DR ............7 vs. North Carolina (2-3-20)REBS .......11 at Miami (1-18-20)AST ..........5 at Miami (1-18-20)BLK .........4 vs. USF (12-21-19)STL ..........3 vs. 6 Teams ..................Last at Miami (1-18-20)MIN .........36 vs. North Carolina (2-3-20)..................36 at Miami (1-18-20)..................36 vs. Purdue (11-30-19)underlined denotes career high established or tied during the 2019-20 season

7Devin Vassell made a

career-high73-pointfieldgoals against Virginia Tech on February 1, 2020 -- he

was a perfect 7-7 from the 3-point line in Florida

State’s win over the Hokies in Blacksburg

6-6, 180, Sophomore, Suwanee, Ga. (Pronounced Dev-In Va-Sell)

2019-20 Season* The Most Outstanding Performer and named to the Emerald Coast Classic All-Tournament team * The ACC Player of the Week by the ACC on January 20 after his performances in wins over Virgnia and Miami* NamedasafinalistfortheJuliusErvingAwardastheNation’sTopSmallForward* Named to the Midseason Naismith Award Defenisve Player of the Year Award* Takes advantage of his incredible wing-span (measured at 6-9 1/4), his height (6-5) and his leaping ability on bothoffenseanddefense.* Totaled 14 points, 2 rebounds and 1 assist in Florida State’s season opener at Pitt* Scored 13 points, pulled down 6 rebounds and added 2 steals in Florida State’s victory over No. 6 Florida* Totaled 10 points, 5 rebounds and 2 assists in Florida State’s victory over Western Carolina* Totaled a team-high 13 points on a career-high 8 free throws with 5 rebounds in Florida State’s win over Tennessee* Scored 13 points, pulled down 6 rebounds, blocked two shots and earned two steals in Florida State’s victory over Purdue in the championship game of the Emerald Coast Classic* Totaled 10 points, 4 rebounds and 2 steals in Florida State’s game at Indiana in the ACC / Big Ten Challenge* Scored a team-high 14 points to go along with 9 rebounds in Florida State’s victory over Clemson in Tallahassee* Scored 14 points, with 6 rebounds and 3 assists in Florida State’s victory over Louisville on the road in the ACC* Team high 17 points on 8 of 9 made free throws in Florida State’s victory over Wake Forest in Winston-Salem* Teamhigh18points,on7madefieldgoalsinFloridaState’svictoryoverVirginiainTallahassee* Team-high23points,career-high11rebounds,firstcareerdoubledoubleinFloirdaState’svictoryatMiami* Team-leading 17 points and a team-leading 6 rebounds in Florida State’s game at Virginia in Charlottesville* Career-high 27 points on a perfect 7 of 7 from the 3-point line in Florida State’s victory at Virginia Tech

2018-19 Season* Averaged 4.5 points (ninth on the team) and 1.5 rebounds (10th) while playing in 33 of Florida State’s 37 games.* Averaged 10.7 minutes played per game in leading the Seminoles to the Sweet 16 of the NCAA Tournament in his firstseasonasaSeminole* Shotateam-leading.419fromthe3-pointline–hefinishedastheonlySeminoletoshoot40percentorbetterfrom the 3-point line -- led the ACC’s freshmen with his .419 3-point shooting percentage – he was one of only two fresh men in the ACC (also Isaiah Wilkins of Virginia Tech) to shoot 40 percent or better from the 3-point line with 50 or more attempts during the 2018-19 season. * Career-high 16 points, 4 rebounds, 1 assist and 1 steal in Florida State’s 85-68 win over Southeast Missouri

On Vassell * Florida State’s lone scholarship freshman in the 2018 recruiting class* AneffectiverebounderanddefenderwhofitsintoFloridaState’steamdefensivephilosophywell* A talented scorer who can shoot well from long range and who has the athleticism to drive to the basket

2019-20 Game-By-Game Statistics -- Devin VassellDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 * at Pittsburgh 1-1 21 6-7 .857 2-2 1.000 0-0 .000 2-0 2 2 1 1 0 0 14N10 at Florida 2-2 34 6-15 .400 1-3 .333 0-1 .000 2-4 6 1 0 0 1 2 13N15 Western Carolina 3-3 32 4-9 .444 0-3 .000 2-4 .500 1-4 5 2 2 1 1 0 10N20 Chattanooga 4-4 26 6-10 .600 3-5 .600 2-2 1.000 3-5 8 1 1 1 2 1 17N23 St. Francis (Pa.) 5-5 17 2-4 .500 0-0 .000 0-0 .000 0-1 1 4 1 0 0 1 4N25 Chicago State 6-6 13 6-7 .857 1-2 .500 3-4 .750 2-0 2 0 1 1 0 3 16N29 vs. Tennessee 7-7 30 2-9 .222 1-4 .250 8-10 .800 1-4 5 3 0 0 0 3 13N30 vs. Purdue 8-8 36 4-9 .444 0-1 .000 5-6 .833 2-4 6 4 1 1 2 2 13D3 at Indiana 9-9 34 3-7 .429 3-3 1.000 1-3 .333 0-4 4 3 0 1 0 2 10D8 * Clemson 10-10 28 6-10 .600 2-6 .333 0-2 .000 1-8 9 1 2 2 3 1 14D17 North Florida 11-11 20 5-10 .500 1-3 .333 0-0 .000 1-3 4 2 3 0 0 3 11D21 vs. USF 12-12 17 2-7 .286 1-5 .200 3-4 .750 0-1 1 1 2 0 4 1 8D28 North Alabama 13-13 22 4-9 .444 0-3 .000 0-0 .000 1-2 3 1 2 0 2 2 8D31 * Georgia Tech 14-14 34 6-13 .462 2-5 .400 0-0 .000 2-7 9 2 1 1 1 2 14J4 * at Louisville 15-15 30 6-13 .462 2-6 .333 0-0 .000 1-5 6 2 3 0 0 1 14J8 * at Wake Forest 16-16 33 4-8 .500 1-3 .333 8-9 .889 1-4 5 1 1 1 3 2 17J15 * Virginia 17-17 34 7-15 .467 2-4 .500 2-2 1.000 1-4 5 1 3 0 0 1 18J18 * at Miami 18-18 36 9-16 .563 2-5 .400 3-4 .750 3-8 11 1 5 4 2 3 23J25 * Notre Dame 19-19 28 4-8 .500 1-1 1.000 2-2 1.000 2-5 7 1 2 2 0 1 11J28 * at Virginia 20-20 34 7-15 .467 3-8 .375 0-0 .000 0-6 6 2 2 0 0 2 17F1 * at Virginia Tech 21-21 33 8-10 .800 7-7 1.000 4-4 1.000 0-3 3 2 3 0 0 1 27F3 * North Carolina 22-22 36 3-8 .375 0-3 .000 0-0 .000 2-7 9 3 2 3 0 2 6F8 * Miami 23-23 24 5-9 .556 1-4 .250 2-2 1.000 2-3 5 1 3 1 0 1 13F10 * at Duke 24-24 34 5-14 .357 1-2 .500 0-2 .000 1-5 6 2 0 0 2 2 11F15 * Syracuse DNPF18 * Pittsburgh 25-25 20 1-5 .200 1-3 .333 0-0 .000 1-3 4 3 2 0 0 0 3F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

Page 25: NO. 8/8 FLORIDA STATE SEMINOLES (22-4, 12-3 ACC) AT NC STATE WOLFPACK (17-9, 8-7 … · 2020-02-21 · no. 8/8 florida state seminoles (22-4, 12-3 acc) at . nc state wolfpack (17-9,

F L O R I D A S T A T E U N I V E R S I T Y

#30 Harrison Prieto Forward

Harrison Prieto’s Career HighsPTS ..........4 at Wake Forest (1-8-20)FGM ........2 at Wake Forest (1-8-20)FGA .........3 at Wake Forest (1-8-20)FG% .........667 at Wake Forest (1-8-20)FTM .........FTA ..........2 vs. Chicago State (11-25-19)FT% ........OR............2 at Wake Forest (1-8-20)..................2 vs. Murray State (3-23-19)DR ............2 vs. Murray State (3-23-19)..................2 vs. Wake Forest (2-13-19)REBS .......4 vs. Murray State (3-23-19)AST ..........2 vs. Miami (2-8-20)BLK .........1 at Wake Forest (1-8-20)STL ..........1 at Wake Forest (1-8-20)MIN .........10 at Wake Forest (1-8-20)underlined denotes career high established or tied during 2019-20 season

206Harrison Prieto blocked 206

shots during his four-year varsity career at St. Paul’s High School in Covington,

La.

2019-20 Game-By-Game Statistics -- Harrison PrietoDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 * at Pittsburgh 1-0 5 0-0 .000 0-0 .000 0-0 .000 0-1 1 0 0 0 0 0 0N10 at Florida DNPN15 Western Carolina DNPN20 Chattanooga 2-0 3 1-1 1.000 0-0 .000 0-0 .000 0-1 1 0 0 0 0 0 2N23 St. Francis (Pa.) 3-0 2 0-2 .000 0-1 .000 0-0 .000 0-0 0 1 0 0 0 0 0N25 Chicago State 4-0 6 0-0 .000 0-0 .000 0-2 .000 1-1 2 1 0 0 0 0 0N29 vs. Tennessee DNPN30 vs. Purdue DNPD3 at Indiana DNPD8 * Clemson DNPD17 North Florida DNPD21 vs. USF DNPD28 North Alabama 5-0 1 0-0 .000 0-0 .000 0-0 .000 0-0 0 0 0 0 0 0 0D31 * Georgia Tech DNPJ4 * at Louisville DNPJ8 * at Wake Forest 6-0 10 2-3 .667 0-0 .000 0-0 .000 2-0 2 2 0 1 1 1 4J15 * Virginia DNPJ18 * at Miami DNPJ25 * Notre Dame DNPJ28 * at Virginia DNPF1 * at Virginia Tech DNPF3 * North Carolina DNPF8 * Miami 7-0 2 1-1 1.000 0-0 .000 0-0 .000 1-0 1 0 0 0 0 0 2F10 * at Duke DNPF15 * Syracuse DNPF18 * Pittsburgh 8-0 1 0-0 .000 0-0 .000 0-0 .000 0-0 0 0 1 0 0 0 0F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

6-8, 230, Redshirt-Junior, Mandeville, La.

2019-20 Season* AteamcaptainasnamedbyHeadCoachLeonardHamiltonandhisstaff.* Continues to earn an expanded role as a member of the Seminoles’ frontcourt rotation as he has developed into a valuable reserve for the Seminoles.* His growing importance to the Seminoles was evident during the 2018-19 season as he played in a career-high nine games,acareer-highfiveACCgamesandinFloridaState’svictoryoverMurrayStateintheNCAATournament.* Career-highswith4points,2fieldgoalsmade,2offensiverebounds,and10minutesplayedinFloridaState’svicrory over at Wake Forest

2018-19 Season* Averaged0.9pointsand0.9reboundsandshot.667fromthefieldwhileplayinginacareer-highninegames.* Tiedhiscareer-highwithtwopointsinfourdifferentgamesasaredshirtsophomore–atSyracuse,againstWakeForest at home, at Georgia Tech and against Murray State in the NCAA Tournament.* A happy homecoming with 1 rebound in 4 minutes of play in Florida State’s victory over Tulane in New Orleans* First career ACC basket in Florida State’s victory over Syracuse in the Carrier Dome.* Totaled 2 points and a career-high 4 rebounds in Florida State’s 90-62 win over Murray State in the ACC Tournament.

2017-18* Averaged 1.0 point and 0.0 rebounds in two games played during the 2017-18 season.* EarnedplayingtimeforthefirsttimeinhiscareerinFloridaState’svictoryoverTheCitadelonNov.24.* Totaled 2 points in 3 minutes of playing time in Florida State’s victory over Southern Miss on Dec. 21.

2016-17 Season* Practiced and traveled with the team throughout the year.* One of the Seminoles’ top practice players who often emulates the opponent’s best shooter in practice.* Helped Florida State to a 26-9 overall record and a 12-6 record in ACC play.

On Prieto* Graduated from St. Paul’s School in Covington, La., in 2016.* Totaled 1,178 career points, 736 career rebounds and 206 career blocked shots as a four-year member of the St. Paul’s varsity.* Team captain and St. Paul’s Player of the Year as a senior.* Earned the Jimmy Dunn award in 2016 as Most Outstanding Athlete.

Page 26: NO. 8/8 FLORIDA STATE SEMINOLES (22-4, 12-3 ACC) AT NC STATE WOLFPACK (17-9, 8-7 … · 2020-02-21 · no. 8/8 florida state seminoles (22-4, 12-3 acc) at . nc state wolfpack (17-9,

F L O R I D A S T A T E U N I V E R S I T Y

#31 Wyatt Wilkes

Wyatt Wilkes’ Career HighsPTS ........... 19 vs. Notre Dame (1-25-20)FGM ......... 6 vs. Notre Dame (1-25-20)FGA .......... 10 vs. Notre Dame (1-25-20)FG% ......... 1.000 vs. North Florida (12-17-19)...................1.000 vs. Canisius (11-19-18)...................1.000 vs. George Washington (11-14-17)3FGM ....... 5 vs. Notre Dame (1-25-20)3FGA ........ 7 vs. Chicago State (11-25-19)3FG% ....... 1.000 vs. Canisius (11-19-18)FTM .......... 2 vs. Notre Dame (1-25-20)...................2 vs. Chicago State (11-25-19)...................2 at Virginia (1-5-19)FTA ........... 3 at Virginia (1-5-19)FT% ......... 1.000 vs. Notre Dame (1-25-20)...................1.000 vs. Chicago State (11-25-19)OR.............2 vs. Notre Dame (1-25-20)DR .............4 vs. North Florida (12-17-19)REBS ........4 vs. North Florida (12-17-19)...................4 vs. The Citadel (11-24-17)AST ...........3 vs. North Florida (12-17-19)BLK .......... 1 vs. Murray State (3-23-19)...................1 vs. Southern Miss (12-21-17)...................1 vs. The Citadel (11-24-17)STL ........... 1 vs. 7 teams...................Last vs. Purdue (11-30-10)MIN ..........19 vs. Notre Dame (1-25-20)underlined denotes career high established or tied during 2019-20 season

6-8, 220, Redshirt Sophomore, Orlando, Fla.

2019-20 Season* One of the Seminoles’ hardest workers who has been a member of two NCAA Tournament teams.* Helped the Seminoles to the Elite Eight of the 2018 NCAA Tournament and to the Sweet 16 of the 2019 NCAA Tournament.* HashelpedFloridaStatetoanaverageof26winsinthefirsttwoseasonsofhiscareer.* Astarterforthefirsttimewith5pointsand2reboundsinFloridaState’svictoryoverChattanooga* Totaled 14 points and 2 rebounds in a career-high 16 minutes of play in Florida State’s win over Saint Francis* Totaled 8 points, 3 rebounds and 2 assists in Florida State’s victory over Chicago State in Tallahassee* Scored 5 points with a career high tying 4 rebs and a career-high 3 assists in Florida State’s victory over N. Florida* A career-high 19 points in Florida State’s victory over Notre Dame in Tallahassee* Totaled11pointson3made3-pointfieldgoalsinFloridaState’svictoryoverMiamiinTallahassee* Totaled8pointson2made3-pointfieldgoalsinFloridaState’svictoryoverSyracuseinTallahassee

2018-19 Season* Averaged 1.5 points and 0.7 rebounds as he played in a career-high 15 games as a redshirt freshman.* Earned increased throughout the season as compared to his freshman season when he played in only six game.* FloridaStatefinishedhissecondseasonwitha29-8overallrecord,a13-5ACCrecord,afourthplacefinishinthe ACC standings and an appearance in the Sweet 16 of the NCAA Tournament.

2017-18 Season* A redshirt season after an ankle injury limited him to just six games during his true freshman season.* Averaged0.7pointsand1.5reboundswhileappearinginsixgamesduringhisfirstseasonasaSeminole.* Totaled 2 points in his career debut against George Washington on Nov. 14.* Totaled 4 rebounds and 1 blocked shot in 8 minutes of play in Florida State’s victory over The Citadel on Nov. 24.

On Wilkes* Graduated from Winter Park High School in 2017.* Earned All-State Class 8A Second Team honors as a senior.* All-Area First Team selection in 2015 and 2016 by the Orlando Sentinel.* Averaged 17.4 points, 9.5 rebounds and 4.5 assists per game in his senior season.

1,474Wyatt Wilkes scored 1,474

career points, was a member of the Winter Park varsity for four seasons and averagedindoublefigurescoring in three of his four

seasons on the varsity

Forward

2019-20 Game-By-Game Statistics -- Wyatt WilkesDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 * at Pittsburgh 1-0 8 0-1 .000 0-1 .000 0-0 .000 1-1 2 0 1 0 0 1 0N10 at Florida 2-0 6 0-1 000 0-1 .000 0-0 .000 0-0 0 1 1 0 0 0 0N15 Western Carolina 3-0 2 0-1 .000 0-1 .000 0-0 .000 0-0 0 1 0 0 0 0 0N20 Chattanooga 4-1 15 2-5 .400 1-4 .250 0-0 .000 1-1 2 0 0 1 0 1 5N23 St. Francis (Pa.) 5-1 16 5-7 .714 3-5 .600 1-1 1.000 1-1 2 1 0 1 0 0 14N25 Chicago State 6-1 18 2-7 .286 2-7 .286 2-2 1.000 1-2 3 2 2 0 1 1 8N29 vs. Tennessee 7-1 3 0-0 .000 0-0 .000 0-0 .000 0-0 0 0 0 0 0 0 0N30 vs. Purdue 8-1 9 0-1 .000 0-1 .000 0-0 .000 1-0 1 0 0 0 0 1 0 D3 at Indiana 9-1 2 0-1 .000 0-1 .000 0-0 .000 0-0 0 0 0 0 0 0 0D8 * Clemson DNPD17 North Florida 10-1 16 2-2 1.000 1-1 1.000 0-0 .000 0-4 4 2 3 0 0 0 5D21 vs. USF 11-1 4 0-1 .000 0-1 .000 0-0 .000 0-0 1 0 0 0 0 0 0D28 North Alabama 12-1 13 0-1 .000 0-1 .000 0-0 .000 0-0 0 0 1 1 0 1 0D31 * Georgia Tech 13-1 2 0-1 .000 0-1 .000 0-0 .000 0-0 0 1 0 1 0 0 0J4 * at Louisville DNPJ8 * at Wake Forest 14-1 7 0-2 .000 0-1 .000 0-0 .000 0-1 1 1 1 0 0 0 0 J15 * Virginia 15-1 8 0-1 .000 0-1 .000 0-0 .000 0-0 0 0 0 1 0 0 0J18 * at Miami 16-1 11 1-4 .250 1-3 .333 0-0 .000 0-1 1 1 1 0 0 0 3J25 * Notre Dame 17-1 19 6-10 .600 5-6 .833 2-2 1.000 2-0 2 1 0 0 0 0 19J28 * at Virginia 18-1 12 2-4 .500 1-3 .333 0-0 .000 0-0 0 3 0 2 0 0 5F1 * at Virginia Tech 19-1 10 3-5 .600 2-4 .500 0-0 .000 0-1 1 0 2 1 0 0 8F3 * North Carolina DNPF8 * Miami 20-1 15 4-7 .571 3-6 .500 0-0 .000 1-0 1 2 0 1 0 0 11F10 * at Duke 21-1 5 0-0 .000 0-0 .000 0-0 .000 0-0 0 2 0 0 0 0 0F15 * Syracuse 22-1 13 3-6 .500 2-5 .400 0-0 .000 1-2 3 2 1 1 0 1 8F18 * Pittsburgh 23-1 15 2-6 .333 1-3 .333 0-0 .000 0-1 1 1 2 2 1 0 5F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

Page 27: NO. 8/8 FLORIDA STATE SEMINOLES (22-4, 12-3 ACC) AT NC STATE WOLFPACK (17-9, 8-7 … · 2020-02-21 · no. 8/8 florida state seminoles (22-4, 12-3 acc) at . nc state wolfpack (17-9,

F L O R I D A S T A T E U N I V E R S I T Y

Will Miles’ Career HighsPTS ..........2 vs. Saint Francis (11-23-19)FGM ........1 vs. Saint Francis (11-23-19)FGA .........2 vs. Chattanooga (11-20-19)..................2 vs. Murray State (3-23-19)FG% ........1.000 vs. Saint Francis (11-23-19)3FGM ......3FGA .......1 vs. Murray State (3-23-19)..................1 vs. Southern Miss (12-21-17)..................1 vs. The Citadel (11-24-17)3FG% ......FTM .........1 vs. Wake Forest (2-13-19)FTA ..........2 vs. Wake Forest (2-13-19)FT% .........500 vs. Wake Forest (2-13-19)OR............1 vs. Saint Francis (11-23-19)DR ............1 at Georgia Tech (2-16-19)..................1 vs. Southern Miss (12-21-17)REBS .......1 vs. Saint Francis (11-23-19)..................1 at Georgia Tech (2-16-19)..................1 vs. Southern Miss (12-21-17)ASTS........1 vs. Chattanooga (11-20-19)STL ..........1 vs. Wake Forest (2-13-19)MIN .........4 vs. Chicago State (11-25-19)underlined denotes career high established or tied during 2019-20 season

13.7Will Miles averaged 13.7 points in 30 games as a

senior at Trinity Prep as a senior in 2016. He led the Saints to a 24-6 record and

to the Class 4A regional finals

6-6, 220, Redshirt Junior, Orlando, Fla.

2019-20* AmemberofthreeNCAATournamentteamsinhisfirstthreeseasonsasamemberofthemen’sbasketballteamat Florida State.* Helped the Seminoles to the Elite Eight of the 2018 NCAA Tournament, the Sweet 16 of the 2019 NCAA Tournament and to the Second Round of the 2017 NCAA Tournament.* In his third season as a member of the basketball team at Florida State.* Missedhisentirefirstseason(2017-18)withabackinjury.* Made his 2019-20 debut with 1 assist in 3 minutes played in Florida State’s victory over Chattanooga

2018-19 Season* Averaged 0.2 points and 0.2 rebounds as he played in a career-high six games in his third season as a member of the Florida State Men’s Basketball team.* Playedinacareer-highsixgamesandscoredthefirstpointofhiscareerasaredshirtsophomore.* Played in a career-high three ACC games.* Earned 2 minutes of playing time in Florida State’s 90-62 win over Murray State in the NCAA Tournament.

2017-18 Season* Averaged 0.0 points and 0.3 rebounds in three games during the 2017-18 season.* Averaged 2.0 points as he earned playing time in both of the Seminoles’ exhibition games to begin the 2017-18 season.* EarnedplayingtimeinaregularseasongameforthefirsttimeinhiscareeragainstFordhamintheJamaicaClassic.

2016-17 Season* Joined the Seminole men’s basketball team for the 2016-17 season.* A redshirt season in 2016-17.

On Will Miles* A third generation family member who is the fourth member of his family to play basketball at Florida State.* His father, an uncle and his grandfather all played basketball at Florida State.

Guard#33 Will Miles

2019-20 Game-By-Game Statistics -- Will MilesDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 * at Pittsburgh DNPN10 at Florida DNPN15 Western Carolina DNPN20 Chattanooga 1-0 3 0-2 .000 0-0 .000 0-0 .000 0-0 0 0 1 0 0 0 0N23 St. Francis (Pa.) 2-0 1 1-1 1.000 0-0 .000 0-0 .000 1-0 1 0 0 0 0 0 2N25 Chicago State 3-0 4 0-0 .000 0-0 .000 0-0 .000 0-0 0 2 0 1 0 0 0N29 vs. Tennessee DNPN30 vs. Purdue DNPD3 at Indiana DNPD8 * Clemson 4-0 1 0-0 .000 0-0 .000 0-0 .000 0-0 0 0 0 0 0 0 0 D17 North Florida DNPD21 vs. USF DNPD28 North Alabama 5-0 1 0-0 .000 0-0 .000 0-0 .000 0-0 0 0 0 0 0 0 0D31 * Georgia Tech DNPJ4 * at Louisville DNPJ8 * at Wake Forest DNPJ15 * Virginia DNPJ18 * at Miami DNPJ25 * Notre Dame DNPJ28 * at Virginia DNPF1 * at Virginia Tech DNPF3 * North Carolina DNPF8 * Miami 6-0 1 0-0 .000 0-0 .000 0-0 .000 0-0 0 0 0 0 0 0 0F10 * at Duke DNPF15 * Syracuse DNPF18 * Pittsburgh 7-0 1 0-0 .000 0-0 .000 0-0 .000 0-0 0 0 0 0 0 0 0F22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

Page 28: NO. 8/8 FLORIDA STATE SEMINOLES (22-4, 12-3 ACC) AT NC STATE WOLFPACK (17-9, 8-7 … · 2020-02-21 · no. 8/8 florida state seminoles (22-4, 12-3 acc) at . nc state wolfpack (17-9,

F L O R I D A S T A T E U N I V E R S I T Y

Cleveland Yates

2019-20 Game-By-Game Statistics -- Cleveland YatesDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 * at Pittsburgh DNPN10 at Florida DNPN15 Western Carolina DNPN20 Chattanooga 1-0 1 0-0 .000 0-0 .000 0-0 .000 0-0 0 0 0 0 0 0 0N23 St. Francis (Pa.) 2-0 1 0-0 .000 0-0 .000 0-0 .000 0-0 0 0 0 0 0 0 0N25 Chicago State 3-0 1 0-0 .000 0-0 .000 0-0 .000 0-0 0 0 0 0 0 0 0N29 vs. Tennessee DNPN30 vs. Purdue DNPD3 at Indiana DNPD8 * Clemson 4-0 1 0-0 .000 0-0 .000 0-0 .000 0-0 0 0 0 0 0 0 0D17 North Florida DNPD21 vs. USF DNPD28 North Alabama 5-0 1 0-0 .000 0-0 .000 0-0 .000 0-1 1 0 0 0 0 0 0D31 * Georgia Tech DNPJ4 * at Louisville DNPJ8 * at Wake Forest DNPJ15 * Virginia DNPJ18 * at Miami DNPJ25 * Notre Dame DNPJ28 * at Virginia DNPF1 * at Virginia Tech DNPF3 * North Carolina DNPF8 * Miami DNPF10 * at Duke DNPF15 * Syracuse DNPF18 * Pittsburgh DNPF22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

Cleveland Yates’ Career HighsPTS ...........FGM .........FGA ..........FG% .........3FGM .......3FGA ........3FG% .......FTM ..........FTA ...........FT% .........OR.............DR .............1 vs. North Alabama (12-28-19)REBS ........1 vs. North Alabama (12-28-19)AST ...........BLK ..........STL ...........MIN ..........1 vs. North Alabama (12-28-19)...................1 vs. Clemson (12-8-19)...................1 vs. Chicago State (11-25-19)................... 1 vs. Saint Francis (11-23-19)...................1 vs. Chattanooga (11-20-19)underlined denotes career high established or tied during 2019-20 season

#42 Guard6-2, 214, Freshman, Memphis, Tenn.

2019-20* Joined the team in the fall of 2019* Made his collegiate debut in Florida State’s victory over Chattanooga on Nov. 20

On Cleveland Yates* Began playing basketball in the second grade…played for M33M and Mike Miller in AAU Basketball* Has been nationally recognized for his leadership and community service* Was chosen by the National Civil Rights Museum to Co-Host the Freedom Award Student Forum honoring former Vice President Joe Biden, Rev. Jesse Jackson and Philanthropist Pitt Hyde in 2018* Cleveland and his parents launched the Kidz Do Pozitive Thingz TV Show when he was only nine years old. He served as host, musician and producer

2019Cleveland Yates led BriarcliffAcademyto

the Tennessee State High School Championship in

2019

Page 29: NO. 8/8 FLORIDA STATE SEMINOLES (22-4, 12-3 ACC) AT NC STATE WOLFPACK (17-9, 8-7 … · 2020-02-21 · no. 8/8 florida state seminoles (22-4, 12-3 acc) at . nc state wolfpack (17-9,

F L O R I D A S T A T E U N I V E R S I T Y

Ty Hands’ Career HighsPTS ...........FGM .........FGA ..........FG% .........3FGM .......3FGA ........3FG% .......FTM ..........FTA ...........FT% .........OR.............DR .............REBS ........AST ...........BLK ..........STL ...........MIN ..........1 vs. Clemson (12-8-19)underlined denotes career high established or tied during 2019-20 season

6-5, 180, Redshirt-Freshman, Palm Beach Lakes, Fla.

2019-20 Season* In his second season as a member of the Seminole men’s basketball team.* Hasfouryearsofeligibilityremainingbeginningwiththe2019-20seasonaftersufferingakneeinjurypriortothestart of the 2019-20 season.* Because of the injury, he took a redshirt season and has worked to get himself back into the Seminoles’ rotation for his second season at Florida State.* A member of the Seminoles’ NCAA Tournament Sweet 16 Team in 2019.* Made his career debut with 1 minute of playing time in Florida State’s victory over Clemson in Tallahassee

2018-19 Season* A redshirt season after undergoing surgery for a torn ACL in his right knee.* Underwent successful surgery on August 22, 2018.* Traveled to many of Florida State’s games and practiced with the team while rehabilitating his knee.

On Hands* Ty and his younger brother, Tre, are the sons of two FSU alum, Tera and Lorenzo Hands, a former Seminole star and four-year letterman at Florida State from 1988 to 1993.* Lorenzo was a member of four NCAA Tournament teams including Florida State’s 1993 Elite Eight team.* Afour-yearlettermanofthevarsitybasketballandtrackandfieldteamsatPalmBeachLakes.* Served as the team captain during his junior and senior seasons.* A member of the Palm Beach County Fab Five Team as a senior.

2019-20 Game-By-Game Statistics -- Ty HandsDate Opponent G-GS Min FG-A Pct. 3FG-A Pct. FT-A Pct. O-D Rebs PF A TO B S PtsN6 * at Pittsburgh DNPN10 at Florida DNPN15 Western Carolina DNPN20 Chattanooga DNPN23 St. Francis (Pa.) DNPN25 Chicago State DNPN29 vs. Tennessee DNPN30 vs. Purdue DNPD3 at Indiana DNPD8 * Clemson 1-0 1 0-0 .000 0-0 .000 0-0 .000 0-0 0 0 0 0 0 0 0D17 North Florida DNPD21 vs. USF DNPD28 North Alabama DNPD31 * Georgia Tech DNPJ4 * at Louisville DNPJ8 * at Wake Forest DNPJ15 * Virginia DNPJ18 * at Miami DNPJ25 * Notre Dame DNPJ28 * at Virginia DNPF1 * at Virginia Tech DNPF3 * North Carolina DNPF8 * Miami DNPF10 * at Duke DNPF15 * Syracuse DNPF18 * Pittsburgh DNPF22 * at NC State F24 * Louisville F29 * at Clemson M4 * at Notre Dame M7 * Boston College

Ty Hands#44 Guard

14.7/5.4Ty Hands averaged 4.7

points and 5.4 rbounds as a senior captain at Palm

Beach Lakes High School during the 2017-18 season

Page 30: NO. 8/8 FLORIDA STATE SEMINOLES (22-4, 12-3 ACC) AT NC STATE WOLFPACK (17-9, 8-7 … · 2020-02-21 · no. 8/8 florida state seminoles (22-4, 12-3 acc) at . nc state wolfpack (17-9,

Exhibition 1 -- Florida State 95,Barry 66

TALLAHASSEE, Fla. – Florida State’s exhibition opener provided a glimpse of what lies ahead for the Seminoles – both in the upcoming season and beyond. It also showed coach Leonard Hamilton a few things he’d like for his team to tighten up between now and the Seminoles’ season opener on November 6. So, in that sense, it was a near-perfect evening for FSU, which got 19 points and five assists from senior Trent Forrest in a 95-66 victory over Barry University at the Donald L. Tucker Center. Forrest, the central figure for an FSU team that lost its top two scorers from a year ago, was one of six Seminoles to finish in double-figures. Anthony Polite added 18 – including 16 in the second half – while RaiQuan Gray (10 points) and newcomers Patrick Williams (12, nine rebounds), Nathanael Jack (10), Dominik Olejniczak (10 points, seven rebounds) and Malik Osborne (seven points, seven boards) all enjoyed productive outings.

Florida State 95, Barry University 66Donald L. Tucker Center

Oct. 22, 2019Barry Min FG 3FG FT O-D Reb F A T B S Pts.Walshe 21 0-3 0-2 6-8 0-1 1 2 0 1 0 0 6Moya 17 2-7 1-5 0-1 0-3 3 1 2 3 0 1 5Birts 20 1-4 1-1 4-4 3-2 5 2 0 4 1 1 7Allende 17 0-5 0-3 0-0 0-2 2 1 1 0 0 0 0Dolven 24 1-4 0-0 1-3 2-3 5 4 1 2 0 0 3Perez 21 4-8 0-1 0-0 0-0 0 4 1 2 0 2 8Sheffield 7 2-3 2-2 0-0 1-2 3 0 2 0 0 0 6Marcinekvisius 3 0-0 0-0 01 0-1 0 0 0 0 0 0 0Kakar 18 4-8 2-4 2-2 2-1 3 1 0 4 0 0 12Scerbinskis 26 4-7 4-5 2-3 1-1 2 2 0 1 1 1 14Mikyska 9 0-0 0-0 0-0 1-0 1 2 0 2 0 0 0Dean 9 0-6 0-0 0-0 0-1 1 1 1 3 0 1 0Mejia 8 1-5 1-4 2-2 0-0 0 1 0 0 0 0 5Team 0-4 4 Totals 200 19-60 11-27 17-24 10-20 30 21 8 22 2 6 66

Fl. State Min FG 3FG FT O-D Reb F A T B S Pts.Gray 26 4-6 2-3 0-1 0-4 4 2 4 4 0 4 10Polite 22 7-9 3-4 1-1 0-2 2 3 0 0 1 3 18Forrest 21 7-10 0-1 5-6 1-2 3 1 5 3 1 1 19Williams 18 5-10 0-3 2-2 1-8 9 2 0 3 1 0 12Olejniczak 16 5-5 0-0 0-0 2-3 5 1 0 2 0 0 10Osborne 26 2-8 0-3 3-4 4-3 7 3 0 2 2 1 7Jack 24 3-12 3-13 1-2 4-3 7 4 0 1 0 0 10Lindner 16 0-0 0-0 0-2 0-1 1 2 3 2 0 0 0Prieto 5 0-1 0-0 1-2 1-0 1 1 0 2 0 0 1Wilkes 18 3-9 2-7 0-0 2-4 6 2 0 1 0 0 8Light 3 0-0 0-0 0-0 0-0 0 0 0 1 0 0 0Miles 5 0-0 0-0 0-0 1-2 3 2 0 0 0 0 0Team 0-3 3 Totals 200 36-70 10-31 13-20 16-35 51 23 12 22 5 9 95 FG% - Barry, .317, Florida State, .514. 3FG% - Barry, .407, Florida State, .323. FT% - Barry, .708. Florida State, .650. Technical Fouls: Barry -- None. Florida State -- None. Referees - Ray Styons, Les Jones, Anthony Burris

Barry 21 45 - 66Florida State 27 58 - 95

Exhibition 2 -- Florida State 84, Columbus State 54

TALLAHASSEE, Fla. – - In its final exhibition game before regular season play begins at Pittsburgh, Florida State earned an 84-54 victory over Columbus State at the Donald L. Tucker Civic Center. Sophomore Devin Vassell led three Seminoles in double figures with 18 points. Also in double figures were Anthony Polite with 16 points and freshman Patrick Williams with 10. The game saw some familiar faces returning to the court after missing Florida State’s exhibition victory over Barry. Both M.J. Walker and Devin Vassell made their highly anticipated season debuts and came back with a vengeance. Walker, who started and played nine first half minutes, totaled six points on two made 3-point shots. Vassell totaled 18 points (three-of-three three-pointers) and finished with six rebounds.

Florida State 84, Columbus StateDonald L. Tucker Center

Nov. 1, 2019Columbus Min FG 3FG FT O-D Reb F A T B S Pts.Thomas 19 0-5 0-3 0-0 0-1 1 1 1 2 0 2 0Givens 21 6-12 2-7 2-3 0-1 1 0 1 7 0 1 16Taylor 21 2-7 0-4 0-0 0-1 1 1 2 1 0 0 4Paulding 23 0-1 0-0 0-2 0-3 3 0 0 0 3 0 0Moore 24 2-3 0-0 2-4 0-2 2 0 1 1 0 3 6Horton, L 26 5-13 1-6 4-2 1-2 3 2 2 3 0 0 15Preston 16 2-3 0-0 1-0 1-4 5 1 1 0 0 0 5Porter-Wilson 14 1-3 0-0 0-0 1-1 2 2 2 0 0 0 2Horton, C. 8 1-3 1-3 0-0 0-0 0 2 0 0 0 0 3David, Jr. 6 0-3 0-2 0-0 0-1 1 0 0 2 0 0 0Ivey 4 1-2 1-2 0-0 0-0 0 1 0 0 0 0 3Jedenski 4 0-1 0-1 0-0 0-0 0 0 0 0 0 0 0Jones 2 0-0 0-0 0-0 0-0 0 0 0 1 0 0 0Kemp 2 0-0 0-0 0-0 0-0 0 0 0 0 0 0 0Gaines 2 0-0 0-0 0-0 0-0 0 0 0 0 0 0 0Team 0-0 2 Totals 200 20-56 5-28 9-13 3-18 21 10 10 17 3 6 54

Fl. State Min FG 3FG FT O-D Reb F A T B S Pts.Gray 20 1-4 0-0 2-2 2-6 7 0 3 3 0 3 4Forrest 28 1-5 0-2 0-0 0-3 3 2 7 2 0 2 2Osborne 20 3-11 0-0 1-1 2-6 10 0 0 1 0 0 7Walker 10 2-6 2-6 0-0 1-0 1 2 0 2 0 0 6Vassell 23 7-9 3-3 1-1 1-5 6 2 0 2 2 0 18Williams 23 5-11 0-2 0-0 3-1 4 1 1 3 0 1 10Koprivica 19 4-5 0-0 0-0 5-6 11 3 1 2 0 0 8Polite 25 5-9 2-4 4-4 0-1 1 2 2 2 0 3 16Jack 15 2-8 1-6 0-0 1-0 1 0 3 2 0 1 5Wilkes 14 2-5 1-3 1-2 4-2 6 0 1 0 0 1 6Lindner 2 1-1 0-0 0-0 0-0 0 0 0 0 0 0 2Light 2 0-0 0-0 0-0 0-0 0 0 0 0 0 0 0Prieto 2 0-0 0-0 0-0 0-1 1 0 0 1 0 0 0Team 2-3 5 Totals 200 33-74 9-26 9-10 22-34 56 12 18 20 2 11 84

FG% - Columbis Sate, .357, Florida State, .446. 3FG% - Columbus State, .179, Florida State, .346. FT% - Collumbus State, .692. Florida State, .900. Technical Fouls: Columbus State -- None. Florida State -- None. Referees - Leee Cassell, Jemel Spearman, Kellen Milner

Columbus State 29 55 - 54Florida State 41 43 - 84

Game 1 -- Pitt 63, Florida State 61

PITTSBURGH, Pa. – Reserves Ryan Murphy and TerrellBrown scored 13 points to lead Pitt to a 63-61 win over FloridaState in the season opener for both teams. The Panthers wondespite shooting just 31 percent (16 of 51) from the fi eld.Pitt survived by getting into the lane relentlessly against thebigger Seminoles, an approach that helped them outscoreFlorida State 22-13 at the free throw line. Senior guard TrentForrest led Florida State with 19 points. Devin Vassell added14 but the Seminoles couldn’t survive 14 turnovers and 27fouls. RaiQuan Gray, Malik Osborne and Balsa Koprivica allfouled out for Florida State. Florida State went up 40-31 on alayup by Osborne with 13:37 to play. The Panthers, however,responded. The Seminoles had a chance to tie it at the endof regulation but Patrick Williams missed a jumper with twoseconds to go. Anthony Polite grabbed the off ensive reboundbut couldn’t get a shot off before the buzzer. Florida Stateshot 40 percent (21 of 53) from the floor.

Pitt 63, Florida State 61Petersen Events Center

Nov. 6, 2019Fl. State Min FG 3FG FT O-D Reb F A T B S Pts.Gray 27 3-6 0-2 1-2 2-1 3 5 2 1 0 0 7Osborne 23 1-4 0-2 0-0 2-7 9 5 0 1 4 0 2Forrest 39 8-16 1-3 2-3 0-2 2 2 2 5 1 2 19Walker 16 0-4 0-2 4-4 0-5 5 4 0 0 0 0 4Vassell 21 6-7 2-2 0-0 2-0 2 2 1 1 0 0 14Polite 25 2-10 2-6 2-2 1-3 4 3 0 3 0 1 8Williams 27 1-5 1-2 2-2 0-2 2 1 0 1 1 0 5Koprivica 6 0-0 0-2 2-2 1-0 1 5 0 1 0 0 2Wilkes 8 0-1 0-0 0-0 1-1 2 0 1 0 0 1 0Jack 3 0-0 0-0 0-0 0-1 1 0 0 0 0 0 0Prieto 5 0-0 0-0 0-0 0-1 1 0 0 0 0 0 0Team 1-2 3 Totals 200 21-53 6-20 13-15 10-25 35 27 6 14 6 4 61

Pitt Min FG 3FG FT O-D Reb F A T B S Pts.Hamilton 18 2-2 0-0 2-3 3-0 3 1 0 0 0 0 6Drumgoole, Jr. 20 0-4 0-3 0-0 0-1 1 1 1 2 0 1 0Johnson 38 3-11 2-4 5-8 0-6 6 3 1 2 0 2 13McGowens 34 2-6 2-5 4-6 1-6 7 4 5 6 0 1 10Toney 13 0-7 0-3 0-0 2-0 2 1 1 0 0 1 0Browne 22 4-5 0-0 5-6 2-1 3 2 0 0 0 0 13Murphey 31 3-7 3-6 4-4 1-3 4 1 3 2 0 0 13Champagnie 23 2-9 2-5 2-4 2-4 6 3 0 0 0 0 8Team 2-3 5 1 Totals 200 16-51 9-26 22-31 13-24 37 16 11 13 0 5 63 FG% - Florida State, .396, Pitt, .314. 3FG% - Florida State, .300, Pitt, .346. FT% - Florida State, .867. Pitt, .710. Technical Fouls: Florida State -- Walker. Pitt -- Champagnie. Referees - Ted Valentine, Mike Stephens, Tony Henderson

Florida State 25 36 - 61Pitt 25 38 - 63

Game 2 -- Florida State 63, Florida 51

GAINESVILLE, Fla. – Devin Vassell scored 13 points, M.J. Walker added 12 and Florida State upset No. 6 Florida 63-51 on Sunday, extending its series winning streak to six. The Seminoles (1-1) avoided their first 0-2 start since 2000 thanks to suffocating defense that forced the rival Gators (1-1) into 16 turnovers and a woeful shooting performance. Florida was 14 of 50 from the field, including 4 of 22 from 3-point range. A sellout crowd witnessed FSU take over late in the first half and really seize control after the break. The Gators went 10 minutes with just one field goal -- a dunk on an inbound play -- as Florida State pulled ahead 38-25 in the opening minutes of the second half. The ‘Noles went up by 14 on Anthony Polite’s 3-pointer with 9:31 to play. The Seminoles made 11 of their first 20 shots in the second half. They also finished with five blocked shots and eight steals.

Florida State 63, Florida 61Exactech Arena at Stephen C. O’Connell Center

Nov. 10, 2019Fl. State Min FG 3FG FT O-D Reb F A T B S Pts.Gray 24 1-5 1-3 4-6 0-5 5 1 2 1 0 1 7Osborne 26 4-7 0-0 2-2 2-2 4 4 0 0 0 1 10Forrest 31 1-7 1-3 5-6 3-5 8 1 7 4 0 1 8Walker 32 3-10 1-5 5-6 0-3 3 1 1 2 0 1 12Vassell 34 6-15 1-3 0-1 2-4 6 1 0 0 1 2 14Polite 18 2-3 1-1 2-2 0-2 2 1 0 1 1 1 7Williams 16 2-4 0-1 0-0 1-4 5 2 0 1 3 1 4Kaprovica 6 1-2 0-0 0-0 0-0 0 3 0 0 0 0 2Olejniczak 7 0-1 0-0 0-0 1-1 2 2 0 0 0 0 0Wilkes 6 0-1 0-1 0-0 0-1 0 1 1 0 0 0 0Team 2-1 3 Totals 200 20-55 5-17 18-23 11-26 37 17 11 9 5 8 63

Florida Min FG 3FG FT O-D Reb F A T B S Pts.Johnson 30 8-12 1-2 2-2 1-3 4 2 0 4 0 0 19Blacksher 35 0-5 0-2 10-14 4-9 13 4 2 1 1 2 10Mann 23 1-6 1-4 2-2 0-2 2 4 0 1 0 0 5Nembhard 38 2-7 2-5 0-0 0-5 5 1 3 4 0 0 6Locke 30 1-11 0-7 0-0 0-3 3 1 1 2 0 0 2Lewis 22 0-4 0-2 4-4 1-0 1 3 0 1 3 1 4Payne 4 2-4 0-0 1-2 2-2 4 2 0 0 0 0 5Glover 6 0-1 0-0 0-0 0-0 0 1 0 0 0 0 0Jitoboh 2 0-0 0-0 0-0 0-0 0 1 0 0 0 0 0Team 5-2 7 3 Totals 200 14-50 4-22 19-26 13-26 39 19 6 16 4 3 51 FG% - Florida State, .364, Florida, .280. 3FG% - Florida State, .294, Florida, .182. FT% - Florida State, .783. Florida, .791. Technical Fouls: Florida State -- None. Florida -- None. Referees - Doug Shows, Tony Greene, Mike Eades

Florida State 25 38 - 63Florida 21 30 - 51

Game 3 -- Florida State 79, Western Carolina 74

TALLAHASSEE, Fla. – Freshman Patrick Williams and junior M.J. Walker each scored 18 points and Florida State rallied to top Western Carolina 79-74 in the Seminoles’ home opener. Forrest had 16 points for the Seminoles who trailed 41-24 with 3:41 left before halftime. Florida State gradually chipped away at the lead, going ahead for good with 45 seconds left in the second half as Williams made a layup. Mason Faulkner scored 21 points, including 12 in the first half, as WCU took a commanding early lead. The Catamounts made 7 of 14 3-pointers in the first half but cooled off and was just 2 of 9 in the second half. After Williams made a pair of free throws to give Florida State a 77-74 lead, Faulkner missed a long jumper with three seconds left as he hoped to make the shot and draw the foul in an attempt to tie it up and send the game to overtime. Florida State won its home opener, securing a 33rd straight nonconference victory at the Donald L. Tucker Center.

Florida State 79, Western Carolina 74Donald L. Tucker Center

Nov. 15, 2019W. Car. Min FG 3FG FT O-D Reb F A T B S Pts.Dotson 27 5-11 0-0 1-2 2-6 8 3 0 2 0 1 11Steger 31 3-8 1-4 2-3 2-3 5 5 1 3 0 3 9Halvorsen 36 3-8 3-6 0-0 0-2 2 1 2 1 0 0 9Faulkner 37 6-15 2-6 7-7 2-2 4 1 7 3 0 1 21Gibson 33 6-10 3-5 0-0 0-1 1 4 0 3 0 0 15McCray 13 2-4 0-1 0-0 0-1 1 3 0 0 0 0 4Cork 8 1-1 0-0 1-2 0-0 0 4 0 1 1 0 3Myers 5 0-1 0-1 0-0 1-2 3 0 0 0 0 0 0Sledd 5 1-2 0-0 0-0 1-0 1 1 0 0 0 0 2Harris 4 0-0 0-0 0-0 0-1 1 0 0 0 0 0 0Team 2-3 5 1 Totals 200 27-60 9-23 11-14 10-21 31 22 10 14 1 5 74

Page 31: NO. 8/8 FLORIDA STATE SEMINOLES (22-4, 12-3 ACC) AT NC STATE WOLFPACK (17-9, 8-7 … · 2020-02-21 · no. 8/8 florida state seminoles (22-4, 12-3 acc) at . nc state wolfpack (17-9,

Fl. State Min FG 3FG FT O-D Reb F A T B S Pts.Gray 17 1-4 0-1 2-2 1-1 2 1 1 2 1 0 4Osborne 25 2-2 0-0 2-3 4-5 9 2 1 1 1 0 6Forrest 32 5-14 1-3 5-5 1-1 2 4 2 1 0 1 16Walker 26 5-11 3-6 5-7 0-4 4 3 2 1 1 0 18Vassell 32 4-9 0-3 2-4 1-4 5 2 2 1 1 0 10Evans 3 0-0 0-0 0-0 0-0 0 0 0 0 0 0 0Polite 24 1-4 1-4 0-0 0-2 2 0 1 2 1 2 3Williams 22 5-8 1-2 7-7 1-3 4 0 1 2 0 0 18Koprovica 10 2-2 0-0 0-0 1-1 2 3 0 3 1 0 4Wilkes 2 0-1 0-1 0-0 0-0 0 1 0 0 0 0 0Olenniczak 4 0-0 0-0 0-0 0-0 0 2 0 1 0 0 0Team 0-2 2 Totals 200 25-55 6-20 23-28 9-23 32 18 10 14 6 3 79 FG% - Western Carolina, .450, Florida State, .455. 3FG% - Western Carolina, .391, Florida State, .300. FT% - Western Carolina, .786. Floirida State, .821. Technical Fouls: Western Carolina -- None. Florida State -- None. Referees - Mark Schnur, Lamar Simpson, Jermey Mosier

Western Carolina 43 31 - 74Florida State 36 43 - 79

Game 4 -- Florida State 89, Chattanooga 53

TALLAHASSEE, Fla. – Devin Vassell scored a career-high 17 points and pulled down a career-high eight rebounds while Patrick Williams added 16 points as Florida State cruised to an 89-53 rout of Chattanooga. Ole Miss graduate transfer Dominik Olejniczak scored his first points at Florida State, going five for six from the floor for 10 points and grabbed three rebounds. The Seminoles shot 34 of 65 (52.3%) from the floor. David Jean-Baptiste had 15 points for Chattanooga. Rod Johnson had 11 points and six rebounds for the Mocs, who shot 23 of 59 (39%).

Florida State 89, Chattanooga 53Donald L. Tucker Center

Nov. 20, 2019UTC Min FG 3FG FT O-D Reb F A T B S Pts.Johnson 25 5-13 1-6 0-0 1-5 6 0 1 1 1 0 11Vila 26 4-6 0-0 0-0 0-2 2 2 1 0 2 0 8Ryan 25 3-6 3-6 1-2 1-1 2 4 0 2 1 1 10Jean-Baptiste 28 7-13 0-4 1-4 0-4 4 0 1 5 0 0 15Commander 30 1-6 0-2 0-0 0-2 2 2 3 0 0 1 2Scott 14 0-2 0-0 0-0 1-1 2 3 1 2 0 0 0Doomes 12 1-3 0-1 0-0 1-3 4 3 0 3 0 0 2Caldwell 11 0-2 0-2 0-0 0-1 1 0 1 0 0 0 0Brown 11 0-0 0-0 0-0 0-3 3 0 0 0 1 1 0Ledford 10 1-4 0-2 0-0 2-0 2 2 0 3 0 0 2Obidiebube 4 0-3 0-0 0-0 2-0 2 1 0 0 0 1 0Tostado 1 0-0 0-0 0-0 0-0 0 0 0 0 0 0 0Smith 1 1-1 1-1 0-0 0-0 0 0 0 0 0 0 3Team 0-0 0 Totals 200 23-59 5-24 2-6 8-22 30 17 8 16 5 4 53

Fl. State Min FG 3FG FT O-D Reb F A T B S Pts.Osborne 20 4-10 1-3 1-1 0-3 3 1 2 1 0 0 10Wilkes 15 2-5 1-4 0-0 1-1 2 0 0 1 0 1 5Polite 25 0-4 0-3 1-2 0-2 2 1 0 1 0 0 1Forrest 30 2-4 0-1 1-2 0-4 4 1 7 4 2 1 5Vassell 26 6-10 3-5 2-2 3-5 8 1 1 1 2 1 17Evans 14 0-1 0-0 4-6 0-0 0 0 2 1 0 4 4Williams 20 6-10 2-3 2-2 1-2 3 0 3 0 0 2 16Koprivica 12 5-6 0-0 0-2 3-4 7 1 1 0 1 0 10Jack 14 2-5 2-5 0-0 1-4 5 1 1 1 0 1 6Olejniczak 8 5-6 0-0 0-0 2-1 3 1 0 0 0 0 10Lindner 5 0-0 0-0 0-0 0-1 1 0 2 1 0 0 0Light 3 1-1 1-1 0-0 0-0 0 0 0 0 0 0 3Prieto 3 1-1 0-0 0-0 0-1 1 0 0 0 0 0 2Miles 3 0-2 0-0 0-0 0-0 0 0 1 0 0 0 0Yates 1 0-0 0-0 0-0 0-0 0 0 0 0 0 0 0Team 0-2 2 Totals 200 34-65 10-25 11-17 11-30 41 7 20 11 5 10 89 FG% - Chattanooga, .390, Florida State, .523. 3FG% - Chattanooga, .208, Florida State, .400. FT% - Chattanooga, .333. Floirida State, .647. Technical Fouls: Chattanooga -- None. Florida State -- None. Referees - Ted Valentine, Brian Dorsey, Joff Pon

Chattanooga 29 24 - 53Florida State 41 48 - 89

Game 5 -- Florida State 80, Saint Francis 65

TALLAHASSEE, Fla. – Wyatt Wilkes scored a career-high 14 points while Trent Forrest added 13 points and five re-bounds as Florida State defeated Saint Francis (Pa.) 80-65. A redshirt sophomore, Wilkes had scored just five points in four games this season before turning in an unexpected five of seven performance from the floor against the Red Flash. Wilkes also knocked down 3-of-5 3-pointers. Myles Thompson scored a career-high 23 points, knocking down 9 of 12 shots for Saint Francis. Thompson came into the game averaging eight points. Forrest was 7 of 7 at the free-throw line as the Seminoles continued to impress by going 15 of 17 at the charity stripe. Florida State came into the game as the only ACC team shooting better than 75 percent from the free-throw line. Freshman center Balsa Koprivica has had back-to-back double-digit scoring games, finishing with 11 points on 5 of 6 shooting versus the Red Flash. Florida State won its 35th straight non-conference home game, a streak that dates nearly five years.

Florida State 80, Saint Francis (Pa.) 65Donald L. Tucker Center

Nov. 23, 2019SFU Min FG 3FG FT O-D Reb F A T B S Pts.Thompson 31 9-12 4-5 1-1 0-4 4 1 0 3 0 1 23Kuzavas 19 0-2 0-0 0-0 1-1 2 4 0 1 1 0 0Meredith 28 1-8 1-6 0-0 0-1 1 2 2 3 0 0 3Gaskins 24 2-3 1-2 2-2 0-2 2 3 1 2 0 2 7Braxton 35 2-9 1-4 8-8 1-4 5 2 3 5 0 1 13Stewart 24 5-15 2-4 2-2 2-2 4 0 1 2 1 2 14Flagg 16 0-1 0-0 0-0 0-0 0 3 0 1 1 1 0Dixon-Conver 13 0-2 0-0 0-0 1-1 2 1 1 4 0 1 0Laskey 4 0-1 0-1 0-0 0-1 1 2 0 0 0 0 0Ikediashi 2 0-0 0-0 3-4 1-1 2 1 0 0 0 0 3Labriola 2 0-0 0-0 0-0 1-0 1 0 1 0 0 0 0Henry 1 1-1 0-0 0-0 0-0 0 0 0 0 0 0 2Team 3-0 3 Totals 200 20-54 9-22 16-17 10-17 27 19 9 21 3 8 65

Fl. State Min FG 3FG FT O-D Reb F A T B S Pts.Osborne 24 3-7 3-5 0-0 1-3 4 2 0 1 2 0 9Olejniczak 13 1-3 0-0 2-2 4-0 4 2 0 2 1 0 4Polite 29 3-6 2-4 0-0 1-6 7 0 2 5 1 5 8Forrest 26 3-7 0-1 7-7 1-4 5 1 4 3 0 2 13Vassell 17 2-4 0-0 0-0 0-1 1 4 1 0 0 1 4Williams 22 2-6 0-2 2-2 1-4 5 1 1 5 1 1 6Koprivica 22 5-6 0-0 1-3 2-1 3 0 0 0 0 2 11Evans 17 2-5 0-1 2-2 1-1 2 1 5 0 0 0 6Wilkes 16 5-7 3-5 1-1 1-1 2 1 0 1 0 0 14Jack 9 1-5 1-5 0-0 0-1 1 1 2 2 0 0 3Prieto 2 0-2 0-1 0-0 0-0 0 1 0 0 0 0 0Lindner 1 0-0 0-0 0-0 0-0 0 1 0 0 0 0 0Light 1 0-1 0-1 0-0 0-0 0 0 0 0 0 0 0Miles 1 1-1 0-0 0-0 1-0 0 0 0 0 0 0 2Yates 1 0-0 0-0 0-0 0-0 1 0 0 0 0 0 0Team 2-1 3 Totals 200 28-60 9-25 15-17 15-23 38 15 15 19 5 11 80 FG% - Saint Francis, .370, Florida State, .467. 3FG% - Saint Francis, .409, Florida State, .360. FT% - Saint Francis, .941. Floirida State, .882. Technical Fouls: Saint Francis -- None. Florida State -- None. Referees - Mike Roberts, Jerry Heater, Warl Walton

Saint Francis 36 29 - 65Florida State 48 32 - 80

Game 6 -- Florida State 113, Chicago State 56

TALLAHASSEE, Fla. – Devin Vassell and Patrick Williams scored 16 points apiece as Florida State had its best shoot-ing night of the year in a 113-56 win over Chicago State. Nathanael Jack added 14 points for the Seminoles, who shot 73.3% in the first half as they took a 65-29 lead at the break. Andrew Lewis scored 18 points for Chicago State (3-4). Trent Forrest scored 12 points for Florida State, which finished 38 of 58 (65.5%) from the floor. Balsa Koprivica and RaiQuan Gray each had seven rebounds for Florida State, which won the rebounding battle 43-20. This was the first time the Seminoles scored 100 points in regulation since a 113-78 win over The Citadel on Nov. 24, 2017. Twelve Semi-noles scored points in one of the more dominating victories in school history. Florida State’s 57-point margin of victory was just outside the top five in school history.

Florida State 113, Chicago State 56Donald L. Tucker Center

Nov. 25, 2019Chi. St. Min FG 3FG FT O-D Reb F A T B S Pts.Jones 17 0-3 0-1 2-2 1-0 1 5 0 2 0 2 2Colley 26 3-8 0-1 0-4 1-1 2 4 0 1 0 1 6Hunt 31 5-6 0-0 0-1 2-2 5 2 0 3 0 1 10lewis 26 5-13 2-3 6-7 0-2 2 2 0 3 0 1 18Johnson 27 3-10 1-5 2-2 1-2 3 2 0 7 0 2 9Gholizadeh 25 2-7 0-2 4-0 2-1 3 2 2 2 0 0 8Bigirumwami 21 0-1 0-0 0-0 1-0 1 3 1 2 0 2 0Johnson 14 0-1 0-1 1-2 0-0 0 0 0 1 0 0 1Whitehead 13 1-3 0-1 0-0 1-0 1 1 0 1 0 0 2Team 1-1 2 Totals 200 19-52 3-14 15-26 11-9 20 21 3 22 0 9 56

Fl. State Min FG 3FG FT O-D Reb F A T B S Pts.Osborne 15 2-2 0-0 0-0 2-3 5 1 1 0 0 0 4Olejinczak 16 3-4 0-0 2-2 1-3 4 2 0 2 2 0 8Polite 15 3-4 1-1 2-2 2-2 4 0 5 0 0 3 9Forrest 15 5-8 2-2 0-0 0-2 2 0 6 2 0 3 12Vassell 13 6-7 1-2 3-4 2-0 2 0 1 1 0 3 16Evans 22 2-4 0-2 2-2 0-0 0 3 2 2 0 1 6Gray 16 1-3 0-2 4-4 2-5 7 3 1 3 0 1 6Williams 20 6-8 0-1 4-4 1-2 3 3 1 1 0 1 16Koprivica 18 3-4 0-0 4-5 2-5 7 1 0 2 0 0 10Wilkes 19 2-7 2-0 2-2 1-2 3 2 2 0 1 1 8Jack 15 4-6 4-7 2-2 0-1 1 3 2 0 0 0 14Prieto 16 0-0 0-6 0-2 1-1 2 1 0 0 0 0 0Lindner 4 1-1 0-0 2-2 0-2 2 1 0 2 0 0 4Light 4 0-0 0-0 0-0 0-0 0 0 0 0 0 0 0Miles 4 0-0 0-0 0-0 0-0 0 2 0 1 0 0 0Yates 1 0-0 0-0 0-0 0-0 0 0 0 0 0 0 0Team 0-1 1 Totals 200 38-58 10-23 27-31 14-29 43 23 21 16 13 3 113

FG% - Chicago State, .365, Florida State, .655. 3FG% - Chicago State, .214, Florida State, .435. FT% - Chicago State, .577. Florida State, .871. Technical Fouls: Chicago State -- None. Florida State -- None. Referees - Bert Smith, Raymie Styons, Clarence Armstrong

Chicago State 29 27 - 56Florida State 65 48 - 113

Game 7 -- Florida State 60, Tennessee 57

NICEVILLE, Fla. – Florida State held No. 16 ranked Tennes-see to a season-low 33.3 percent shooting en route to a 60-57 victory that advanced the Seminoles into the championship of the sixth annual Emerald Coast Classic held at Northwest Florida State College. Florida State, winning its sixth straight game, moved to 6-1 and will play Purdue for the championship. Guard Lamonte Turner scored a game-high 20 points for Ten-nessee which its suffered its first loss of the season falling to 5-1. Tennessee committed a season-high 21 turnovers with Florida State scoring 23 points off those miscues. Sophomore guard Devin Vassell led Florida State with 13 points, while MJ Walker collected 10 points. The Seminoles came out firing to open the game, making six of their first eight shots to race to a 10-2 lead.

Florida State 60, Tennessee 57The Arena at Northwest Florida State College

Nov. 29, 2019Fl. State Min FG 3FG FT O-D Reb F A T B S Pts.Forrest 34 3-11 0-0 3-5 0-4 4 2 4 8 1 1 9Osborne 16 1-1 1-1 1-4 2-4 6 1 0 0 0 3 4Olejniczak 14 1-3 0-0 0-0 2-2 4 4 0 0 0 2 2Walker 24 3-10 1-3 3-5 1-2 3 3 2 1 0 0 10Vassell 30 2-9 1-4 8-10 1-4 5 3 0 0 0 3 13Evans 7 1-4 0-0 0-0 0-0 0 2 0 0 0 0 2Gray 18 1-3 0-0 0-0 0-0 0 1 0 1 1 0 2Polite 17 1-5 0-3 0-0 0-1 1 2 0 0 0 1 2Williams 18 4-6 0-0 0-1 0-2 2 0 1 2 0 1 8Koprivica 19 2-2 0-0 4-4 1-2 3 3 0 1 0 2 8Wilkes 3 0-0 0-0 0-0 0-0 0 0 0 0 0 0 0Team 1-2 3 Totals 200 19-54 3-11 19-29 8-23 31 21 7 13 2 13 60

Tenn. Min FG 3FG FT O-D Reb F A T B S Pts.Turner 36 4-14 1-4 11-14 0-3 3 2 2 8 0 1 20James 29 2-6 0-3 5-5 2-5 7 4 1 5 2 0 9Fulkerson 29 1-2 0-0 0-0 1-1 2 5 2 1 1 1 2Bowden 37 3-10 2-7 3-3 1-4 5 3 0 2 0 1 11Pons 38 4-8 2-6 3-4 1-9 10 2 0 1 3 0 13Gaines 15 0-1 0-1 2-3 0-1 1 0 0 0 0 1 2Pember 6 0-1 0-1 0-0 0-1 1 2 0 0 0 0 0Johnson 2 0-0 0-0 0-0 0-0 0 0 0 2 1 0 0Nkamhoua 8 0-0 0-0 0-0 1-2 3 2 0 2 0 0 0Team 1-0 1 Totals 200 14-42 5-22 24-29 7-26 33 20 5 21 7 4 57

FG% - Florida State, .352, Tennessee, .333. 3FG% - Florida State, .273, Tennessee, .227. FT% - Florida State, .655. Tennessee, .828. Technical Fouls: Florida State -- Team, 2. Tennessee -- None. Referees - Doug Shows, Jeff Anderson, Ron Groover

Florida State 29 31 - 60Tennessee 24 33 - 57

Page 32: NO. 8/8 FLORIDA STATE SEMINOLES (22-4, 12-3 ACC) AT NC STATE WOLFPACK (17-9, 8-7 … · 2020-02-21 · no. 8/8 florida state seminoles (22-4, 12-3 acc) at . nc state wolfpack (17-9,

Game 8 -- Florida State 63, Purdue 60 (OT)

NICEVILLE, Fla. – Trent Forrest scored 17 points to lead Florida State to a 63-60 overtime victory over Purdue in the Emerald Coast Classic championship game. The Seminoles outscored the Boilermakers 5-2 in the extra period by getting their points at the free-throw line including the final two with only one second left to play. Purdue, trailing by only a point, took several potentially winning shots in the last minute but was unable to score against a stifling Florida State defense.Devin Vassell was the only other Seminole scoring in double figures with 13 points. That included the final two free throws in overtime after getting fouled when he grabbed a missed Purdue shot. Matt Haarms led the Boilermakers with 16 points followed by Jahaad Proctor with 12 and Eric Hunter Jr. with 10. It was a back-and-forth game with 10 lead changes and 11 ties. Florida State never led by more than four points while the Boilermakers briefly went ahead by seven early in the second half after trailing 27-24 at the intermission.

Florida State 63, Purdue 60 (OT)The Arena at Northwest Florida State College

Nov. 30, 2019Fl. State Min FG 3FG FT O-D Reb F A T B S Pts.Forrest 39 6-13 0-3 5-6 2-2 4 0 0 2 0 3 17Osborne 18 1-3 0-1 2-2 2-4 6 2 0 0 0 0 4Olejniczak 13 1-2 0-0 0-0 0-1 1 2 0 0 0 0 2Walker 26 2-8 1-5 2-2 0-0 0 0 2 4 1 1 7Vassell 36 4-9 0-1 5-6 2-4 6 4 1 1 2 2 13Evans 6 1-2 0-0 2-2 1-0 1 1 0 1 0 0 4Gray 25 2-10 0-4 2-4 1-6 7 1 2 3 1 4 6Polite 21 1-2 0-1 0-2 0-0 0 1 0 0 0 1 2Williams 17 2-6 0-1 0-1 0-1 1 1 2 1 0 3 4Koprivica 15 2-2 0-0 0-0 0-2 2 4 0 1 2 1 4Wilkes 9 0-1 0-1 0-0 1-0 1 0 0 0 0 1 0Team 1-3 4 Totals 225 22-58 1-17 18-25 10-23 33 16 7 13 6 16 63

Purdue Min FG 3FG FT O-D Reb F A T B S Pts.Wheeler 27 2-12 0-7 0-0 4-4 8 5 0 3 0 1 4Hunter, Jr. 40 4-10 1-4 1-1 2-1 3 3 4 4 0 3 10Proctor 35 4-14 2-5 2-2 1-2 3 2 2 2 1 0 12Thompson 33 2-7 1-3 0-0 0-2 2 0 0 1 0 1 5Boudreaux 19 0-6 0-1 2-2 1-2 3 3 1 2 0 0 2Eastern 14 0-1 0-1 0-0 0-7 7 5 3 3 0 0 0Haarms 28 6-6 1-1 3-3 3-5 8 3 0 4 1 0 16Williams 17 3-4 0-0 2-6 3-4 7 1 0 4 1 0 8Stefanovic 12 0-2 0-2 3-3 0-2 2 2 0 1 0 1 3Team 4-1 5 Totals 225 21-62 5-24 13-17 18-30 48 24 10 24 3 6 60

FG% - Florida State, .379, Purdue, .339. 3FG% - Florida State, .059, Purdue, .208. FT% - Florida State, .720. Purdue, .765. Technical Fouls: Florida State -- None. Purdue -- None. Referees - John Higgins, Mike Eades, Jeff Anderson

Florida State 27 31 5 - 63Purdue 24 34 2 - 60

Game 9 -- Indiana 80, Florida State 64

BLOOMINGTON, Ind. – Devonte Green senior scored a career-high 30 points, knocked down five 3-pointers and helped fuel a late spurt with two big shots to lead undefeated Indiana past No. 17 Florida State 80-64 in the ACC/Big Ten Challenge. Green went 10 of 15 from the field, 5 of 7 on 3s and 5 for 7 at the free throw line. He also grabbed six rebounds and finished with three assists and two steals -- not bad for someone who missed Indiana’s first three games with an injured hamstring. With Green back, the Hoosiers are off to their best start since 2012-13. They earned their third straight win over a ranked team dating to last season and head into Big Ten play with a boost of confidence. It wasn’t just Green, either. Freshman forward Trayce Jackson-Davis had 15 points and eight rebounds, while junior Justin Smith chipped in with 14 points and five boards. Trent Forrest scored 13 to lead the Seminoles, who had their seven-game winning streak snapped. M.J. Walker and Devin Vassell added 10 points apiece.

Indiana 80, Florida State 64Assembly HallDec. 3, 2019Fl. State Min FG 3FG FT O-D Reb F A T B S Pts.Osborne 22 3-5 1-3 0-0 1-2 3 1 1 1 0 2 7Olejniczak 8 2-2 0-0 0-2 1-1 2 1 0 0 0 0 4Forrest 35 5-9 0-0 3-6 4-0 4 2 2 4 0 1 13Walker 19 4-8 2-6 0-0 0-4 4 5 0 2 0 0 10Vassell 34 3-7 3-3 1-3 0-4 4 3 0 1 0 2 10Evans 3 0-0 0-0 0-0 0-0 0 0 0 1 0 0 0Gray 26 4-10 0-2 0-1 0-3 3 4 2 2 0 1 8Polite 18 2-4 1-3 2-2 1-2 3 4 0 1 1 1 7Koprivica 6 0-0 0-0 0-0 0-1 1 2 0 0 0 0 0Williams 26 2-7 0-2 1-2 0-1 1 2 2 1 1 1 5Wilkes 2 0-1 0-1 0-0 0-0 0 0 0 0 0 0 0Team 0-0 0 1 Totals 200 25-53 7-19 7-16 7-18 25 25 7 14 2 8 64

Indiana Min FG 3FG FT O-D Reb F A T B S Pts.Smith 35 4-7 0-1 6-9 2-3 5 1 1 2 0 0 14Jackson-Davis 35 3-5 0-0 9-14 5-3 8 2 0 2 2 2 15Brunk 16 2-3 0-0 0-2 1-2 3 1 0 1 1 0 4Durham 26 2-7 0-2 1-4 0-2 2 2 4 3 0 0 5Franklin 23 3-5 1-3 2-2 2-2 4 3 1 1 0 1 9Green 29 10-15 5-7 5-7 0-6 6 2 3 4 0 2 30Anderson 20 1-3 1-2 0-0 0-0 0 2 1 2 1 0 3Thompson 9 0-0 0-0 0-0 0-3 3 2 0 0 0 0 0Davis 1 0-0 0-0 0-0 0-0 0 2 0 1 0 0 0Hunter 7 0-0 0-0 0-0 0-2 2 2 0 2 0 0 0Team 0-2 2 Totals 200 25-45 7-15 23-38 10-25 35 19 10 18 4 5 80

FG% - Florida State, .472, Indiana, .556. 3FG% - Florida State, .368, Indiana, .467. FT% - Florida State, .438. Indiana, .605. Technical Fouls: Florida State -- Coach. Indiana -- None. Referees - Terry Oglesby, Courtney Green, Paul Szeic

Florida State 30 34 - 64Indiana 41 39 - 80

Game 10 -- Florida State 72, Clemson 53

TALLAHASSEE, Fla. – Devin Vassell had 14 points and nine rebounds and No. 17 Florida State made 15 three-pointers in a 72-53 rout of Clemson. Anthony Polite had 12 points on four 3-point shots as the Seminoles bounced back following a road loss to Indiana. Tevin Mack scored 14 points and Al-Amir Dawes added 13 points for Clemson. M.J. Walker scored 11 points, including a trio of three-pointers, for Florida State. Eight Seminoles made at least one shot from beyond the arc. Florida State shot 25 of 54 (.463 percent) from the floor. Clemson cooled off in the second half, shooting just 7 of 27 (.259 percent). The Tigers shot 19 of 53 (.358 percent) for the game. The Seminoles are 20-1 at home since the start of the 2018-19 season.

Florida State 72, Clemson 53Donald L. Tucker CenterDec. 8, 2019Clemson Min FG 3FG FT O-D Reb F A T B S Pts.Moore 20 1-5 0-2 0-0 0-1 1 1 1 1 0 1 2Simms 27 3-7 2-3 0-0 2-2 4 4 1 2 0 1 8Dawes 34 5-13 2-8 1-2 1-2 3 1 2 6 0 0 13Mack 31 5-10 2-4 2-5 1-2 3 2 3 3 0 3 14Newmann III 29 2-5 1-2 1-1 0-1 1 1 1 1 0 0 6Scott 17 2-5 1-2 2-2 0-4 4 2 0 3 0 0 7Jemison 11 0-1 0-0 0-0 0-0 0 3 0 1 0 0 0Baehre 13 0-1 0-1 0-0 1-2 3 0 0 1 0 0 0Tyson 13 1-5 1-4 0-0 1-3 4 0 0 0 0 0 3Grinde 2 0-0 0-0 0-0 0-0 0 0 0 0 0 0 0Fox 1 0-0 0-0 0-0 0-0 0 0 0 0 0 0 0McBride 1 0-0 0-0 0-0 1-0 1 0 0 0 0 0 0Hoag 1 0-1 0-1 0-0 0-0 0 0 0 0 0 0 0 Team 4-4 8 Totals 200 19-53 9-27 6-10 11-21 32 14 8 18 0 5 53

Fl. State Min FG 3FG FT O-D Reb F A T B S Pts.Osborne 22 2-5 1-4 0-0 1-5 6 3 1 1 2 0 5Olejniczak 8 0-3 0-0 0-0 3-0 3 2 1 1 0 1 0Forrest 30 4-8 1-3 0-0 0-3 3 2 5 2 0 1 9Walker 28 3-9 3-6 2-2 0-0 0 1 2 3 0 1 11Vassell 28 6-10 2-6 0-2 1-8 9 1 2 2 3 1 14Gray 17 1-2 1-2 4-4 0-2 2 2 1 0 1 1 7Koprivica 8 1-1 0-0 0- 0-0 0 0 0 1 1 0 2Polite 18 4-7 4-6 0-0 1-2 3 0 2 1 0 0 12Williams 26 3-6 2-4 1-0 1-3 4 2 0 0 2 0 9Evans 11 0-1 0-0 0-2 0-1 1 0 2 2 0 1 0Lindner 1 1-1 1-1 0-0 0-0 0 0 0 0 0 0 3Light 1 0-0 0-0 0-0 0-0 0 0 0 0 0 0 0Miles 1 0-0 0-0 0-0 0-0 0 0 0 0 0 0 0Yates 1 0-1 0-0 0-0 0-0 0 0 0 0 0 0 0Hands 1 0-0 0-0 0-0 0-0 0 1 0 0 0 0 0Team 2-1 3 Totals 200 25-54 15-32 7-10 9-25 34 14 16 13 9 6 72

FG% - Clemson, .358, Florida State, .463. 3FG% - Clemson, .333, Florida State, .469. FT% - Clemson, .600. Florida State, .700. Technical Fouls: Clemson -- None. Florida State -- None. Referees - Roger Ayers, Pat Driscoll, Brian O’Connell

Clemson 33 20 - 53Florida State 27 45 - 72

Game 11 -- Florida State 98, North Florida 81

TALLAHASSEE, Fla. – Balsa Koprivica scored 15 points and fellow big man Dominik Olejniczak added 11 as No. 19 Florida State defeated North Florida 98-81. The 7-footers were able

to capitalize on their height advantage, making shots in the lane and leading the Seminoles to a 39-27 rebounding edge. Koprivica was 6 of 8 from the floor, while Olejniczak went 5 for 7. M.J. Walker had 11 points, one of seven Seminoles who scored in double figures. Florida Statehas won 12 straight home games in a streak that dates to the 2018-19 season. Ivan Gandia-Rosa scored 23 points, knocking down four 3-pointers, for North Florida. Garrett Sams added 20 points, also making four 3s. North Florida came into the game with 149 made 3-pointers, which led Division I. The Ospreys shot 13 of 34 (38.2%) from beyond the arc.

Florida State 98, North Florida 81Donald L. Tucker CenterDec. 17, 2019UNF Min FG 3FG FT O-D Reb F A T B S Pts.Aminu 23 4-5 0-0 0-0 2-1 3 3 0 1 1 0 8James 29 0-2 0-2 2-2 0-2 2 2 0 3 0 0 2Hendrickson 25 2-12 1-7 0-0 0-5 5 4 2 2 0 0 5Gandia-Rose 29 6-12 4-9 7-8 1-3 4 0 7 4 0 0 23Sams 31 7-12 4-9 2-3 1-1 2 4 3 3 0 3 20Endicott 10 1-2 0-1 0-0 0-1 1 0 0 0 0 0 2Day 9 1-1 0-0 0-0 0-0 0 0 0 0 0 0 2Burkhardt 24 4-6 4-6 0-0 1-4 5 1 1 0 0 1 12Adedoyin 12 0-1 0-0 0-0 0-1 1 0 2 2 0 0 0Balogun 8 1-3 0-0 5-6 2-0 2 0 0 1 1 0 7Team 0-2 2 Totals 200 26-56 13-34 16-19 7-20 27 14 16 16 2 4 80

Fl. State Min FG 3FG FT O-D Reb F A T B S Pts.Gray 22 5-6 0-1 1-2 0-3 3 1 5 2 1 3 11Olejniczak 16 5-7 0-0 1-2 1-2 3 0 0 1 0 2 11Forrest 20 4-9 1-4 2-2 0-3 3 1 1 1 0 0 11Walker 18 5-7 1-2 1-1 0-1 1 1 3 0 0 0 12Vassell 12 5-10 1-3 0-0 1-3 4 2 3 0 0 3 11Koprivica 14 6-8 0-0 3-5 3-0 3 3 1 2 1 1 15Evans 9 0-1 0-0 0-0 0-1 1 0 0 2 0 1 0Polite 20 2-6 0-2 0-0 1-3 4 1 0 1 0 0 4Williams 21 4-7 1-2 2-2 3-1 4 0 3 2 1 1 11Wilkes 16 2-2 1-1 0-0 0-4 4 2 3 0 0 0 5Osborne 9 1-5 0-1 0-0 3-2 5 0 1 0 1 0 2Jack 7 2-4 1-3 0-0 0-0 0 2 0 0 0 0 5Team 3-1 4 Totals 200 41-72 6-19 10-14 15-24 39 13 20 11 4 11 98

FG% - North Florida, .464, Florida State, .569. 3FG% - North Florida, .382, Florida State, .316. FT% - North Florida, .842. Florida State, .714. Technical Fouls: North Florida -- None. Florida State -- None. Referees - Doug Shows, Keith Kimble, Bart Lennox

North Florida 39 42 - 81Florida State 48 50 - 98

Game 12 -- Florida State 66, USF 60

SUNRISE, Fla. – Florida State used smothering defense to overcome a 10-point deficit in the final seven minutes and beat South Florida 66-60 in the Orange Bowl Classic. The Seminoles forced 24 turnovers, including seven as they outscored the Bulls 19-3 down the stretch. Florida State forced four shot-clock violations and won despite being outrebounded by 14 and shooting only 40 percent, including 7 for 27 from 3-point range. RaiQuan Gray had 11 points, seven rebounds and three of Florida State’s 13 steals. An-thony Polite, Trent Forrest and M.J. Walker also scored 11 points apiece. Florida State scored 21 points off turnovers to earn its third win in a row. South Florida lost to a ranked team for the 27th consecutive time since 2012. A flurry of nine points in 39 seconds by the Bulls — including a pair of 3s and two free technical foul free throws — helped them lead 57-47 with 6:32 to go. But they didn’t score another field goal until garbage time with 3 seconds left, and committed turnovers on four consecutive possessions as the Seminoles pulled ahead. Devin Vassell’s jumper with two minutes left put Florida State in front to stay. Michael Durr had 15 points and seven rebounds for the Bulls, but they shot just 3 for 15 from 3-point range.

Florida State 66, USF 60BB&T CenterDec. 21, 2019USF Min FG 3FG FT O-D Reb F A T B S Pts.Durr 30 6-7 0-0 3-6 3-4 7 2 0 1 1 0 15Collins 26 5-9 1-2 3-3 0-1 1 3 1 4 0 1 14Dawson 36 3-8 0-1 2-4 0-1 1 3 0 2 0 3 8Rideau 33 6-18 1-6 1-3 0-7 7 4 4 6 0 1 14Brown 36 1-5 1-4 0-0 0-4 4 2 0 2 0 1 3Castaneda 25 3-9 0-2 0-0 1-2 3 2 0 3 0 1 6Maricevic 9 0-0 0-0 0-0 2-2 4 1 0 2 0 0 0Mack 4 0-0 0-0 0-0 0-0 0 0 0 0 0 1 0Chaplin 1 0-0 0-0 0-0 0-0 0 0 0 0 0 0 0Team 10-5 15 4 Totals 200 24-56 3-15 9-15 16-26 42 17 5 24 1 8 60

Page 33: NO. 8/8 FLORIDA STATE SEMINOLES (22-4, 12-3 ACC) AT NC STATE WOLFPACK (17-9, 8-7 … · 2020-02-21 · no. 8/8 florida state seminoles (22-4, 12-3 acc) at . nc state wolfpack (17-9,

Fl. State Min FG 3FG FT O-D Reb F A T B S Pts.Gray 28 4-10 1-3 2-2 3-4 7 2 1 2 1 3 11Olejniczak 5 1-1 0-0 0-0 0-0 0 1 0 1 0 0 2Forrest 38 5-10 1-2 0-0 0-1 1 2 3 2 3 2 11Walker 23 2-9 1-6 6-7 1-0 1 0 1 2 0 2 11Vassell 17 2-7 1-5 3-4 0-1 1 1 2 0 4 1 8Koprivica 9 0-1 0-0 0-0 0-2 2 3 0 0 0 0 0Williams 25 2-4 0-1 2-2 2-3 5 3 2 4 0 1 6Osborne 14 1-2 0-1 0-0 1-0 1 2 1 1 0 2 2Polite 24 4-9 2-7 1-2 1-4 5 1 4 0 1 2 11Evans 12 1-1 1-1 1-2 0-2 2 1 2 1 1 0 4Wilkes 4 0-1 0-1 0-0 0-0 0 1 0 0 0 0 0Team 0-3 3 1 Totals 200 22-55 7-27 15-19 8-20 28 18 16 14 10 13 66

FG% - USF, .429, Florida State, .400. 3FG% - USF, .200, Florida State, .259. FT% - USF, .600. Florida State, .789. Technical Fouls: USF -- Rideau (2nd). Florida State -- Bench (2nd), Gray (2nd). Referees - Ron Groover, A.J. Desai, Vladmir Voyard-Tadal

USF 31 29 - 60Florida State 28 38 - 66

Game 13 -- Florida State 88, North Alabama 71

TALLAHASSEE, Fla. – Malik Osborne scored 12 of his 14 points in the first half as No. 17 Florida State cruised to an 88-71 win over North Alabama. Balsa Koprivica added 13 points while Trent Forrest had 10 points and six assists for Florida State, which has won seven of its games by 10 or more points. The Seminoles made 16 of 23 of their shots from inside the 3-point arc in the first half en route to a 47-26 lead at the break. Jamari Blackmon scored 15 points and Christian Agnew added 12 points and eight rebounds for North Alabama. Florida State made 17 of 17 free-throw attempts. The Seminoles were averaging 75 percent from the free-throw line coming into the game. Florida State is 40-10 in its last 50 games. The Seminoles went 29-8 in 2018-19, reaching the Sweet 16. And Florida State continued to dominate with its 13th straight home victory.

Florida State 88, North Florida 71Donald L. Tucker CenterDec. 28, 2019UNA Min FG 3FG FT O-D Reb F A T B S Pts.James 26 3-9 1-2 1-2 1-2 2 2 2 4 1 1 8Littles 33 3-5 0-0 2-4 2-6 8 1 1 3 1 0 8Agnew 33 4-14 1-7 3-4 3-5 8 2 0 1 0 1 12Blackmon 33 4-7 2-3 5-6 0-0 0 3 2 3 0 0 15Brim 28 2-4 0-1 2-2 0-2 2 3 3 3 0 0 6Anderson 16 5-8 3-4 0-0 0-2 2 3 0 0 1 0 13King 2 0-0 0-0 0-0 0-0 0 1 0 0 0 0 0Windeler 6 0-0 0-0 0-0 0-1 1 1 0 1 0 1 0Youngblood 5 0-1 0-0 0-0 0-1 1 0 0 3 0 0 0Matic 14 3-3 3-3 0-0 0-2 2 1 2 0 0 1 9Diggs 2 0-0 0-0 0-0 0-0 0 0 0 0 0 0 0Redparth 1 0-1 0-0 0-0 0-0 0 0 0 0 0 0 0Meloche 1 0-0 0-0 0-0 0-0 0 0 0 0 0 0 0Team 2-1 3 Totals 200 24-52 10-20 13-18 8-21 29 17 10 18 3 4 71

Fl. State Min FG 3FG FT O-D Reb F A T B S Pts.Gray 18 1-5 0-2 0-0 2-1 3 0 2 1 1 1 2Osborne 18 6-12 2-5 0-0 3-1 4 2 0 0 1 1 14Forrest 23 3-4 1-1 3-3 2-2 4 2 6 3 1 0 10Walker 16 1-6 0-2 4-4 0-4 4 3 1 1 0 2 6Vassell 22 4-9 0-3 0-0 1-2 3 1 2 0 2 2 8Williams 19 4-9 2-2 2-2 0-3 3 2 3 2 1 1 12Koprivica 21 5-6 0-0 3-3 0-3 3 2 0 2 0 0 13Evans 13 2-3 0-0 3-3 0-2 2 0 1 1 0 0 7Polite 15 4-5 1-2 2-2 0-1 1 1 1 1 0 1 11Wilkes 13 0-1 0-1 0-0 0-0 0 0 1 1 0 1 0Jack 7 1-2 1-2 0-0 0-0 0 2 0 0 0 0 3Lindner 1 1-1 0-0 0-0 0-0 0 0 0 0 0 0 2Light 1 0-1 0-1 0-0 0-0 0 0 0 0 0 0 0Prieto 1 0-0 0-0 0-0 0-0 0 0 0 0 0 0 0Miles 1 0-0 0-0 0-0 0-0 0 0 0 0 0 0 0Yates 1 0-0 0-0 0-0 0-1 1 0 0 0 0 0 0Team 2-1 3 Totals 200 32-64 7-21 17-17 10-21 31 15 17 12 6 9 88

FG% - North Alabama, .462, Florida State, .500. 3FG% - North Alabama, .500, Florida State, .333. FT% - North Alabama, .722. Florida State, 1.000. Technical Fouls: North Alabama -- None. Florida State -- None. Referees - Lee Cassell, Tony Greene, Jeff Pon

North Alabama 26 45 - 71Florida State 47 41 - 88

Game 14 -- Florida State 70, Georgia Tech 58

TALLAHASSEE, Fla. – Devin Vassell scored 14 points and pulled down nine rebounds, leading No. 18 Florida State past Georgia Tech 70-58 for its 15th straight home vic-tory. Patrick Williams scored 12 points while Trent Forrest had eight points and six assists for Florida State. Michael Devoe scored 19 points, knocking down 6 of 8 three-point attempts. Moses Wright added 13 points and 10 rebounds, his fourth double-double of the season, for Georgia Tech. But the Yellow Jackets were undone by 20 turnovers, one short of their season high. Vassell had eight points and Dominik Olejniczak added seven points in the second half for Florida State, which shot 53% from the floor after halftime to pull away. The Seminoles won on their defensive strength, blocking nine shots and creating 11 steals.

Florida State 70, Georgia Tech 58Donald L. Tucker CenterDec. 31, 2019GT Min FG 3FG FT O-D Reb F A T B S Pts.Usher 31 4-11 0-4 3-3 0-1 1 3 3 3 0 0 11Wright 36 6-13 1-3 0-0 1-9 10 3 0 6 2 2 13Banks III 32 3-4 0-0 2-3 2-4 6 3 0 2 1 1 8Devoe 39 6-13 6-8 1-2 0-3 3 1 3 4 0 0 19Alvarado 39 2-10 0-4 0-0 0-2 2 1 5 3 0 3 4Price 2 0-1 0-0 0-0 0-0 0 0 0 0 0 0 0Parham 19 1-3 1-3 0-0 1-1 2 0 4 2 0 0 3Moore 2 0-0 0-0 0-0 0-0 0 0 0 0 0 1 0Team 6-3 9 Totals 200 22-55 8-22 6-8 10-23 33 11 15 20 3 7 58

Fl. State Min FG 3FG FT O-D Reb F A T B S Pts.Gray 24 1-4 0-0 2-4 1-1 2 4 1 5 2 1 4Osborne 22 3-5 1-1 0-0 0-4 4 1 2 0 1 2 7Polite 29 2-8 2-4 2-2 1-3 4 1 2 2 0 2 8Forrest 35 4-11 0-2 0-0 0-3 2 2 6 1 2 1 8Vassell 34 6-13 2-5 0-0 2-7 9 2 1 1 1 2 14Williams 26 6-9 0-1 0-0 3-1 4 1 0 1 2 1 12Evans 10 1-3 1-2 0-0 0-1 1 0 2 0 0 0 3Koprivica 2 1-1 0-0 1-1 1-1 2 0 0 0 0 1 3Wilkes 2 0-1 0-1 0-0 0-0 0 1 0 1 0 0 0Olejnizcak 15 4-6 0-0 1-2 1-1 2 0 2 1 1 1 9Jack 1 1-2 0-1 0-0 0-0 2 0 0 0 0 0 2Team 1-1 2 Totals 200 29-63 6-17 6-9 10-23 33 12 16 12 9 11 70

FG% - Georgia Tech, .400, Florida State, .460. 3FG% - Georgia Tech, .364, Florida State, .353. FT% - Georgia Tech, .750. Florida State, .667. Technical Fouls: Georgia Tech -- None. Florida State -- None. Referees - Roger Ayers, Tony Henderson, Lamar Simpson

Georgia Tech 29 29 - 58Florida State 31 39 - 70

Game 15 -- Florida State 78, Louisville 65

LOUISVILLE. Ky. – M.J. Walker scored 23 points for Florida State as the 18th-ranked Seminoles beat No. 7 Louisville 78-65. The Seminoles endured a big game from Louisville’s Jordan Nwora to pull the upset. The preseason All-American scored 32 points, matching a career high. But the Cardinals could not overcome a 55.2% shooting performance by the Seminoles in losing their second straight. Florida State made 11 of 23 3-pointers. Nwora had a hot hand early for Louisville, scoring 21 points in the first half. The junior shot 6 of 9 from the floor, but the Cardinals combined to make just 10 of 37. They went the last 5:04 without a field goal as the Seminoles took 39-32 lead into the break. Walker helped offset Nwora’s early barrage. The junior came off the bench to score 15 points in the first half on 6-of-8 shooting, including 3 of 5 from 3-point range. Walker finished one point short of his career high. Trent Forrest added 20 points on 9-of-11 shooting, and Devin Vassell scored 14. Florida State led 52-42 with 13:43 remaining. Louisville cut that to 54-51 on Nwora’s putback, but that was as close as the Cardinals would get.

Florida State 78, Louisville 65KFC YUM! CenterJan. 4, 2020Fl. State Min FG 3FG FT O-D Reb F A T B S Pts.Gray 21 0-2 0-0 2-2 0-5 5 2 0 4 1 1 2Osborne 29 3-7 1-3 0-0 4-5 9 4 1 1 1 0 7Polite 18 1-5 1-4 0-0 2-0 2 2 1 1 0 0 3Forrest 33 9-11 1-1 1-2 1-2 3 1 5 3 0 2 20Vassell 30 6-13 2-6 0-0 1-5 6 2 3 0 0 1 14Williams 24 1-4 0-1 0-0 1-2 3 1 1 3 3 1 2Olejniczak 7 0-0 0-0 0-0 0-1 1 2 0 0 0 0 0Walker 28 9-13 5-7 0-1 0-1 1 1 3 1 1 0 23Evans 8 3-3 1-1 0-0 0-1 1 0 1 0 0 1 7Team 0-0 0 Totals 200 32-58 11-23 3-5 9-22 31 15 15 13 6 6 78

L’Ville Min FG 3FG FT O-D Reb F A T B S Pts.Sutton 28 1-4 1-2 0-0 2-2 5 3 4 0 1 0 3Nwora 38 11-15 5-6 5-7 7-3 10 2 0 4 0 0 32Enoch 24 3-6 0-0 4-7 1-3 4 2 1 2 2 1 10Kimble 30 3-11 0-4 0-0 1-1 2 0 3 3 0 1 6Perry 23 2-7 2-2 0-0 0-3 3 1 0 0 0 1 6Williams 15 1-4 0-1 0-0 0-2 2 2 0 1 1 1 2Johnson 19 2-9 0-1 0-0 4-2 6 1 3 3 1 0 4McMahon 15 1-5 0-3 0-0 0-0 0 1 1 2 0 0 2Williamson 8 0-1 0-0 0-0 1-0 1 1 0 1 0 1 0Nickelberry 1 0-0 0-0 0-0 0-0 0 0 0 0 0 0 0Igiehon 1 0-0 0-0 0-0 0-0 0 0 0 0 0 0 0Team 3-1 4 Totals 200 24-62 8-19 9-14 19-18 37 13 12 16 5 5 65

FG% - Florida State, .552, Louisville, .387. 3FG% - Florida State, .478, Louisville, .421. FT% - Florida State, .600. Louisville, .643. Technical Fouls: Florida State -- None. Louisville -- None. Referees - Jeffrey Clark, John Gaffney, Tim Clougherty

Florida State 39 39 - 78Louisville 32 33 - 65

Game 16 -- Florida State 78, Wake Forest 68

WINSTON-SALEM, N.C. – Devin Vassell scored 17 points and Florida State pulled away in the final 10 minutes to beat Wake Forest 78-68, giving the Seminoles another double-digit win in league play. Florida State got in foul trouble in the first half and sent the Demon Deacons to the line 22 times before the break, then surrendered an 11-0 run out of the break that gave Wake Forest a lead. Yet Florida State tightened up its defense and stopped sending a parade of Demon Deacons players to the foul line, then began to gradually stretch out a lead on the way to a seventh straight win.M.J. Walker scored 12 of his 15 points in the first half for the Seminoles, who went ahead for good on RaiQuan Gray’s 3-pointer at the 14:04 mark. They also held the Demon Deacons to one field goal over 6 1/2 minutes as they finally asserted control, pushing a 52-49 lead to 67-56 on Malik Osborne’s 3-pointer with 2:46 left. Brandon Childress scored 20 points to lead Wake Forest, which played without starter Chaundee Brown due to a lower-leg injury. The Demon Deacons (8-6, 1-3) got off to a slow start to fall behind by a dozen in the opening minutes, but used that 11-0 run to erase a 41-34 halftime deficit and get back in it.

Florida State 78, Wake Forest 68Lawrence Joel Veterans Memorial ColiesumJan. 8, 2020Fl. State Min FG 3FG FT O-D Reb F A T B S Pts.Gray 13 3-4 1-2 2-6 0-1 1 4 2 1 0 0 9Osborne 21 3-6 1-1 2-2 3-2 5 2 0 1 0 3 9Forrest 34 5-11 0-1 4-4 3-7 10 1 2 1 0 4 14Walker 32 5-14 3-8 3-3 0-0 0 3 2 2 0 0 15Vassell 33 4-8 1-3 8-9 1-4 5 1 1 1 3 2 17Williams 22 3-9 0-4 0-0 0-2 2 3 0 1 1 0 6Evans 6 0-0 0-0 0-0 0-1 1 0 1 0 0 0 0Polite 14 2-5 0-3 0-0 0-1 1 3 1 0 0 0 4Olejniczak 7 0-0 0-0 0-0 2-0 2 2 0 2 0 0 0Prieto 10 2-3 0-0 0-0 2-0 2 2 0 1 1 1 4Wilkes 7 0-2 0-1 0-0 0-1 1 1 1 0 0 0 0Team 1-3 4 Totals 200 27-62 6-23 18-24 12-22 34 22 10 10 5 10 78

Wake Min FG 3FG FT O-D Reb F A T B S Pts.Mucius 22 3-6 1-2 0-0 2-2 4 2 0 2 1 0 7Oguama 22 0-0 0-0 2-6 2-2 4 1 0 1 1 0 2Childress 37 5-12 1-5 9-10 1-2 3 2 5 3 0 0 20Johnson 36 1-7 1-3 4-4 0-5 5 3 1 2 0 0 7White 26 3-10 1-4 2-3 0-4 4 5 0 3 0 0 9Saar 23 2-2 0-0 6-8 2-5 7 4 0 1 0 0 10Neath 20 3-6 1-2 1-2 0-1 1 3 1 3 0 1 8Massoud 12 2-4 1-2 0-0 0-1 1 2 0 1 0 0 5Wright, Jr. 1 0-1 0-0 0-0 0-0 0 0 0 0 0 0 0Team 2-3 5 1 Totals 200 19-48 6-18 24-32 9-25 34 22 7 17 2 1 68

FG% - Florida State, .435, Wake Forest, .396. 3FG% - Florida State, .261, Wake Forest, .333. FT% - Florida State, .750. Wake Forest, .750. Technical Fouls: Florida State -- None. Wake Forest -- None. Referees - Jamie Luckie, Ron Groover, Clarence Armstrong

Florida State 41 37 - 78Wake Forest 34 34 - 68

Page 34: NO. 8/8 FLORIDA STATE SEMINOLES (22-4, 12-3 ACC) AT NC STATE WOLFPACK (17-9, 8-7 … · 2020-02-21 · no. 8/8 florida state seminoles (22-4, 12-3 acc) at . nc state wolfpack (17-9,

Game 18 -- Florida State 54, Virginia 50

TALLAHASSEE, Fla. – Devin Vassell scored 18 points, including a 3-pointer and a pair of free throws in the final seconds, and No. 9 Florida State won its eighth straight game, 54-50 over Virginia. Anthony Polite came off the bench to drill four 3-pointers for the Seminoles, who have won 15 of their last 16. Mamadi Diakite scored 16 points on 6-of-8 shooting for Virginia which turned it over 18 times and made just 21 shots from the floor. Tomas Woldetensae was 3 of 4 from 3-point range but the rest of the Cavaliers were 0 for 11 from beyond the arc. Virginia, the defending national champion, has lost three straight games. Trent For-rest had five points, seven rebounds, seven assists and four steals for FSU. The Seminoles had 10 steals and five blocks.

Florida State 54, Virginia 50Donald L. Tucker CenterJan. 15, 2020Virginia Min FG 3FG FT O-D Reb F A T B S Pts.Diakite 31 6-8 0-1 4-6 2-4 6 5 1 3 2 2 16Clark 38 4-12 0-2 0-0 0-1 1 2 5 9 0 2 8Key 36 4-10 0-4 1-2 0-2 2 3 1 1 0 1 9Morsell 19 2-6 0-2 0-0 1-0 1 1 0 1 0 1 4Stattmann 18 0-2 0-1 0-0 0-1 1 0 0 2 0 0 0Huff 24 2-2 0-0 0-0 0-7 7 0 0 1 0 0 4Woldetensae 32 3-5 3-4 0-0 0-4 4 1 3 1 0 0 9Coleman 2 0-1 0-1 0-0 0-1 1 0 0 0 0 0 0Team 2-4 6 Totals 200 21-46 3-15 5-8 5-24 29 12 10 18 2 6 50

Fl. State Min FG 3FG FT O-D Reb F A T B S Pts.Gray 23 1-5 0-1 1-2 1-3 4 0 1 1 0 0 3Osborne 26 2-5 1-3 0-0 3-1 4 0 0 0 1 0 5Forrest 35 1-6 0-2 3-4 1-6 7 2 7 5 2 4 5Walker 28 2-9 1-6 0-0 0-1 1 2 0 3 0 1 5Vassell 34 7-15 2-4 2-2 1-4 5 1 3 0 0 1 18Polite 20 5-6 4-4 0-0 0-1 1 2 0 2 0 3 14Wolliams 12 2-6 0-1 0-0 3-0 3 3 0 2 1 0 4Olejniczak 9 0-1 0-0 0-0 1-1 2 0 0 0 1 1 0Evans 7 0-0 0-0 0-0 0-1 1 0 0 2 0 0 0Wilkes 8 0-1 0-1 0-0 0-0 0 0 0 1 0 0 0Team 2-1 3 Totals 200 20-54 8-22 6-8 12-19 31 10 11 16 5 10 54

FG% - Virginia, .457, Florida State, .370. 3FG% - Virginia, .200, Florida State, .364. FT% - Virginia, .625. Florida State, .750. Technical Fouls: Virginia -- None. Florida State -- None. Referees - Lee Cassell, John Gafney, Jerry Heater

Virginia 24 26 - 50Florida State 31 23 - 54

Game 18 -- Florida State 83, Miami 79 (OT)

CORAL GABLES, Fla. – No. 9-ranked Florida State forced 24 turnovers, including three in a row in overtime, and rallied Saturday to earn their ninth consecutive victory by beating Miami 83-79. Sophomore Devin Vassell set a career high for the third consecutive game by leading Florida State with 23 points while adding 11 rebounds and five assists. His two free throws with six seconds left sealed the win. Walker played only 23 minutes because of foul trouble but scored 19 points, all in the second half, Malik Osborne’s three-point play with 2:25 left in overtime put the Seminoles ahead to stay. The Seminoles won despite shooting 42 percent and committing 16 turnovers. They compensated by scoring 21 points off takeaways. Not that Florida State’s characteristically strong defense wasn’t stout from the start. The Hurricanes had to call a timeout when they were trapped on the game’s first possession. They blew a dunk, threw up air balls and had 10 shots blocked. But Miami stayed in the game early with a strong defensive effort of its own. DJ Vasiljevic sank a 3-pointer and then scored on a breakaway to give the Hur-ricanes their biggest lead with 5:20 remaining, 65-56. The Seminoles have won nine consecutive overtime games, including two this season. Their last OT loss came against Iowa in December 2016.

Florida State 83, Miami 79 (OT)Watsco CenterJan. 18, 2020Fl. State Min FG 3FG FT O-D Reb F A T B S Pts.Gray 14 1-2 0-0 0-0 1-2 3 4 0 2 0 2 2Osborne 31 2-4 0-1 2-3 1-4 5 3 0 0 1 1 6Forrest 38 4-9 0-0 4-4 2-1 3 1 5 3 1 2 12Walker 23 6-15 4-9 3-3 0-0 0 3 2 1 1 1 19Vassell 37 9-16 2-5 3-4 3-8 11 1 5 4 2 3 23Polite 32 4-9 2-6 0-0 2-5 5 1 3 2 0 5 10Williams 17 0-4 0-2 2-2 0-2 2 3 1 2 4 1 2Olejniczak 9 1-2 0-0 0-0 0-0 0 0 0 0 1 0 2Evans 12 1-4 1-2 1-2 1-1 1 2 4 0 0 0 4Jack 1 0-0 0-0 0-0 0-0 0 1 0 1 0 0 0Wilkes 11 1-4 1-3 0-0 0-1 1 1 1 0 0 0 3Team 3-2 5 1 Totals 225 29-69 10-28 15-18 13-23 36 20 21 16 10 15 83

Miami Min FG 3FG FT O-D Reb F A T B S Pts.Waardenburg 41 3-9 0-2 1-2 3-8 11 4 1 0 1 1 7Miller 24 2-4 0-0 0-0 3-5 8 4 0 1 0 0 4Lykes 41 9-18 6-10 0-3 0-0 0 1 2 6 2 1 24Vasiljevic 41 6-11 4-6 3-3 0-3 3 1 1 2 0 2 19McGusty 37 6-10 0-2 3-5 0-1 1 2 6 4 0 1 15Bererly 26 3-7 1-2 1-2 1-2 3 4 3 5 0 2 8Walker 13 0-3 0-2 2-2 2-1 3 2 0 1 1 0 2Wong 2 0-0 0-0 0-0 0-2 2 0 0 2 0 0 0Team 5-5 10 3 Totals 225 29-62 11-24 10-17 14-27 41 18 13 24 4 7 79

FG% - Florida State, .420, Miami, .468. 3FG% - Florida State, .357, Miami, .458. FT% - Florida State, .833. Miami, .588 Technical Fouls: Florida State -- None. Miami -- None. Referees - Bill Covington, Jr.,Tony Henderson, Mike Roberts

Florida State 31 38 14 - 83Miami 30 39 10 - 79

Game 19 -- Florida State 85, Notre Dame 84

TALLAHASSEE, Fla. – Wyatt Wilkes scored 19 points and No. 5 Florida State held off Notre Dame 85-84 for its 10th straight victory. Wilkes drilled 5 of 6 from 3-point range and the Seminoles made 12 of 18 from beyond the arc. Florida State missed its last nine shots from the floor and Notre Dame nearly took advantage. The Fighting Irish had a few chances in the final moments, including Rex Pflueger’s desperation 3-pointer that fell short at the buzzer. Trent Forrest and RaiQuan Gray each scored 13 points for Florida State, which has also won 10 consecutive home games. Prentiss Hubb scored 24 points, hitting 5 of 11 3-pointers, and John Mooney had 16 points for Notre Dame. Mooney pulled down just four rebounds, halting his streak of double-doubles at 12 games. Notre Dame shot 22 of 27 (81.5%) from the free-throw line. Florida State’s Balsa Koprivica returned after missing four games due to injury. The freshman center had six points and six rebounds in the first half.

Florida State 85, Notre Dame 84Donald L. Tucker CenterJan. 25, 2020N.D. Min FG 3FG FT O-D Reb F A T B S Pts.Durham 28 5-9 0-0 6-7 2-7 9 3 0 1 2 1 16 Mooney 31 5-9 1-2 5-7 3-2 5 0 1 2 0 3 16Pflueger 33 2-4 1-3 0-0 1-3 4 2 4 7 0 1 5Hubb 39 7-16 5-11 5-5 1-3 4 2 1 3 0 2 24Gibbs 30 4-12 1-5 2-2 1-2 3 5 4 1 0 0 11Laszewski 11 0-3 0-2 0-0 0-1 1 1 0 1 0 0 0Goodwin 29 3-6 2-4 4-6 1-3 4 1 2 0 0 1 12Team 1-1 2 Totals 200 26-59 10-27 22-27 10-22 32 15 12 15 2 8 84

Fl. State Min FG 3FG FT O-D Reb F A T B S Pts.Gray 22 6-10 1-1 0-0 0-4 4 2 0 3 1 0 13Osborne 14 0-2 0-1 0-0 0-1 1 2 0 2 0 0 0Forrest 32 3-9 0-0 7-8 1-4 5 2 7 4 0 4 13Walker 24 3-8 2-3 0-0 0-1 1 2 0 3 1 0 8Vassell 28 4-8 1-1 2-2 2-5 7 1 2 2 0 1 11Olejniczak 10 2-3 0-0 0-0 2-3 5 4 0 2 0 0 4Wilkes 19 6-10 5-6 2-2 2-0 2 1 0 0 0 0 19Evans 12 1-1 0-0 0-0 0-0 0 3 0 2 0 0 2Polite 25 3-7 3-5 0-0 1-1 2 1 5 0 0 3 9Kopriovica 13 2-6 0-0 2-2 4-2 6 3 1 0 0 1 6Jack 2 0-1 0-1 0-0 0-0 0 0 0 0 0 0 0Team 0-1 1 Totals 200 30-65 12-18 13-14 12-22 34 21 15 18 2 9 85

FG% - Notre Dame, .441, Florida State, .462. 3FG% - Virginia, .370, Florida State, .667. FT% - Notre Dame, .815. Florida State, .929. Technical Fouls: Notre Dame -- Team Bench. Florida State -- None. Referees - John Gaffney, A.J. Desai, Earl Walton

Notre Dame 37 47 - 84Florida State 47 38 - 85

Game 20 -- Virginia 61, Florida State 56

CHARLOTTESVILLE, Va. – - Kihei Clark was the littlest player on the court, but he made the biggest play. The 5-foot-9 guard made the go-ahead layup with 59 seconds left, and Virginia ended No. 5 Florida State’s 10-game winning streak, 61-56. Clark drove down the left side of the lane, reached across and banked his shot in on the right side. The victory was Virginia’s first as an unranked team against a team in the Top 5 since the Cavaliers beat Duke 73-68 on Feb. 28, 2013. Mamadi Diakite had 19 points and nine rebounds for Virginia and Braxton Key added 13 points and nine rebounds. The Seminoles forced 17 turnovers while committing just seven, but were outscored 10-9 off those miscues by the Cavaliers. Virginia also won the rebounding battle 36-23. Devin Vassell led Florida State (17-3, 7-2) with 17 points. The loss was the Seminoles’ first since Dec. 3 at Indiana.

Virginia 61, Florida State 56John Paul Jones ArenaJan. 28, 2020Fl. State Min FG 3FG FT O-D Reb F A T B S Pts.Gray 16 3-4 2-2 0-0 0-3 3 4 1 2 0 0 8Osborne 25 2-7 0-2 1-1 1-3 4 2 0 0 2 1 5Forrest 31 1-4 0-1 2-2 2-1 3 3 3 1 1 3 4Walker 31 3-10 2-0 0-0 0-0 0 1 2 0 1 1 7Vassell 34 7-15 3-0 0-0 0-6 6 2 2 0 0 2 17Olejniczak 6 1-3 0-0 0-0 0-0 0 0 0 1 0 0 2Polite 22 1-4 0-4 2-4 2-1 3 3 1 0 0 1 4Koprivica 14 1-3 0-2 0-2 0-1 1 2 0 1 0 1 2Wilkes 12 2-4 1-0 0-0 0-0 0 3 0 2 0 0 5Evans 9 0-0 0-2 2-2 0-2 2 0 0 0 1 0 2Team 0-1 1 Totals 200 21-54 7-11 7-11 5-18 23 20 9 7 5 9 56

Virginia Min FG 3FG FT O-D Reb F A T B S Pts.Diakite 37 6-10 3-3 4-4 2-7 9 3 1 2 1 0 19Clark 38 4-12 0-4 7-7 1-3 4 1 4 4 0 1 15Key 38 4-9 0-0 5-7 0-9 9 1 1 3 1 0 13Morsell 21 1-2 0-0 1-1 0-1 1 2 0 1 0 0 3Woldetensae 28 2-4 2-4 2-2 0-1 1 3 3 4 0 0 8Huff 26 1-2 0-1 1-2 1-5 6 4 2 0 2 0 3Coleman 4 0-1 0-0 0-0 0-1 1 1 0 2 0 0 0Caffaro 7 0-1 0-0 0-0 0-2 2 0 0 0 0 0 0Team 2-1 3 1 Totals 200 18-41 5-12 20-23 6-30 36 15 11 17 4 1 61

FG% - Florida State, .389, Virginia, .439. 3FG% - Florida State, .350, Virginia, .417. FT% - Florida State, .636. Virginia, .588 Technical Fouls: Florida State -- Koprivica (ejection). Virginia -- None. Referees - Bill Covington, Jr.,Kipp Kissinger, James Breeding

Florida State 28 28 - 56Virginia 27 34 - 61

Game 21 -- Florida State 74, Virginia Tech 63

BLACKSBURG, Va. – Devin Vassell was too ramped up trying to help No. 5 Florida State beat Virginia Tech to real-ize he was earning himself a place in the ACC record book. Vassell tied an ACC mark by shooting 7 for 7 from 3-point range and scored 27 points to lift the No. 5 Seminoles to a 74-63 victory over the Hokies. Vassell and the Seminoles rebounded from Tuesday night’s loss at Virginia that snapped a 10-game winning streak. Florida State remained a game out of first place in the ACC standings. The Seminoles led for much of the first half, were ahead 34-29 at the break and held the lead the rest of the way. Florida State grabbed a 60-44 advantage on a free throw by Trent Forrest with 9:25 remaining before the Hokies scored the next nine points. They cut the lead to 60-53 on a dunk by Nahiem Alleyne with 6:23 left, but got no closer. Tyrece Radford paced the Hokies with 18 points. Virginia Tech lost its third consecutive game. Vassell connected on his first six shots from the floor -- five 3-pointers -- and made 8 of 10 for the game. He was the lone Florida State player in double figures, but 10 different Seminoles scored and seven scored at least seven points.

Florida State 74, Virginia Tech 63Cassell ColiseumFeb. 1, 2020Fl. State Min FG 3FG FT O-D Reb F A T B S Pts.Gray 20 3-5 1-1 0-0 1-0 1 0 0 0 0 2 7Osborne 10 0-0 0-0 1-2 0-2 2 0 0 0 0 0 1Polite 26 3-9 0-5 1-3 1-3 4 3 2 2 1 0 7Forrest 34 3-7 0-2 1-1 1-8 9 0 5 1 1 1 7Vassell 33 8-10 7-7 4-4 0-3 3 2 3 0 1 0 27Williams 24 3-10 0-2 1-1 1-3 4 1 1 1 0 0 7Olejniczak 16 2-5 0-0 0-0 0-2 2 0 0 2 2 1 4Evans 18 2-3 0-1 0-0 0-1 1 0 2 1 0 0 4Koprivica 10 1-3 0-0 0-0 0-0 0 0 1 0 0 0 2Wilkes 10 3-5 2-4 0-0 0-1 1 0 2 1 0 0 8Team 2-4 6 1 Totals 200 28-57 10-22 8-11 6-27 33 8 16 9 5 4 74

Va. Tech Min FG 3FG FT O-D Reb F A T B S Pts.Nolley, II 29 5-16 2-8 2-2 1-6 7 2 2 3 0 0 14Horne 26 0-6 0-6 0-0 0-3 3 0 0 0 2 0 0Bede 32 2-6 0-2 0-0 0-5 5 2 6 2 0 1 4Alleyne 22 2-6 1-4 2-2 0-0 0 3 1 1 0 0 7Radford 30 8-10 0-1 2-2 2-4 6 3 1 2 0 1 18Cattoor 24 4-7 2-5 0-0 0-2 2 2 2 1 0 2 10Wilkins 15 3-4 1-2 0-0 0-1 1 0 0 1 0 0 7Cone 12 1-3 1-2 0-0 0-1 1 0 0 0 0 0 3Ojiako 10 0-0 0-0 0-0 1-0 1 0 0 0 0 0 0Team 2-2 4 Totals 200 25-58 7-30 6-6 6-24 30 12 12 10 2 4 63

FG% - Florida State, .491, Virginia Tech, .431. 3FG% - Florida State, .459, Virginia Tech, .233. FT% - Florida State, .727. Virginia Tech, 1.000 Technical Fouls: Florida State -- None. Virginia Tech -- None. Referees - Ron Groover, Les Jones, NathanFarrell

Florida State 34 40 - 74Virginia Tech 29 34 - 63

Page 35: NO. 8/8 FLORIDA STATE SEMINOLES (22-4, 12-3 ACC) AT NC STATE WOLFPACK (17-9, 8-7 … · 2020-02-21 · no. 8/8 florida state seminoles (22-4, 12-3 acc) at . nc state wolfpack (17-9,

Game 22 -- Florida State 65, North Carolina 59

TALLAHASSEE, Fla. – Patrick Williams had 14 points and nine rebounds, Trent Forrest also scored 14 and No. 8 Florida State beat North Carolina 65-59. RaiQuan Gray had 10 second-half points as the Seminoles moved within a win of their best-ever start in league play. Florida State opened 10-2 in ACC play in 2011-12. Florida State has won 19 straight home games -- 11 this season and the last eight in 2018-19. Cole Anthony started in his second game back from knee surgery for UNC. The freshman guard scored 16 points on 5-of-23 shooting and added seven rebounds. He shot 3 of 10 from 3-point range and 3 of 8 from the free-throw line. North Carolina went 0 for 17 during a long stretch of the second half and Florida State was able to build a comfortable lead. The Tar Heels fouled to extend the game, but Florida State finished 11 of 13 from the free-throw line.

Florida State 65, North Carolina 59Donald L. Tucker CenterFeb. 3, 2020N. Car. Min FG 3FG FT O-D Reb F A T B S Pts.Bacot 26 2-3 0-0 2-2 1-5 6 3 0 3 0 1 6Brooks 34 2-8 0-0 1-2 4-0 4 4 2 0 0 1 5Black 34 4-10 0-1 2-2 1-4 5 3 3 1 1 2 10Anthony 37 5-22 3-10 3-8 1-7 8 4 3 3 0 0 16Platek 33 2-6 1-2 0-0 2-0 2 1 2 1 0 1 5Pierce 15 1-7 1-3 0-0 3-2 5 2 0 0 0 0 3Keeling 18 5-10 1-2 3-2 0-2 2 0 0 1 1 2 14Francis 3 0-2 0-1 0-0 0-0 0 1 0 0 0 0 0Team 2-3 5 Totals 200 21-68 6-19 11-17 14-23 37 18 10 9 2 7 59

Fl. State Min FG 3FG FT O-D Reb F A T B S Pts.Gray 23 5-9 0-1 2-2 2-5 7 3 1 4 4 2 12Osborne 15 3-5 1-1 1-1 2-4 6 1 0 0 0 0 8Polite 12 0-2 0-1 0-0 0-0 0 2 0 1 0 0 0Forrest 35 5-12 1-3 3-4 0-4 4 1 3 4 2 1 14Vassell 36 3-8 0-3 0-0 2-7 9 3 2 3 2 0 6Olejniczak 10 0-3 0-0 0-0 2-2 4 2 0 0 1 0 0Williams 24 3-4 2-2 6-6 0-9 9 3 2 1 1 0 14Evans 12 2-4 0-0 3-4 0-1 1 1 1 1 0 0 7Walker 25 1-7 0-4 0-0 1-2 3 3 0 2 0 0 2Koprivica 7 1-1 0-0 0-0 0-0 0 0 0 0 0 0 2Team 0-0 0 Totals 200 23-55 4-15 15-17 9-34 43 19 9 16 10 3 65

FG% - North Carolina, .309, Florida State, .418. 3FG% - North Carolina, .316, Florida State, .267. FT% - North Carolina, .647. Florida State, .882. Technical Fouls: North Carolina -- None. Florida State -- None. Referees - Mike Roberts, Doug Shows, Jeffrey Anderson

North Carolina 28 31 - 59Florida State 29 36 - 65

Game 23 -- Florida State 99Miami 81

TALLAHASSEE, Fla. – M.J. Walker and Patrick Williams each scored 14 points as No. 8 Florida State beat Miami 99-81 for a season sweep. Devin Vassell had 13 points and Wyatt Wilkes scored 11, knocking down three 3-point-ers, for the Seminoles. Florida State connected on 13 of 26 3-point attempts. Isaiah Wong had a career-high 23 points on 8 of 12 shooting for Miami. Sam Waardenburg added 15 points, Harlond Beverly had 14 and Dejan Vasiljevic scored 12 on 5-of-13 shooting. Anthony Polite had eight rebounds for Florida State, which outrebounded Miami 46-24. The Seminoles also made 16 of 17 free-throw attempts. Five players scored in double figures and the Seminoles’ bench outscored Miami’s reserves 54-11. Thirteen players scored, including walk-ons Travis Light and Harrison Prieto.

Florida State 99, Miami 81Donald L. Tucker CenterFeb. 8, 2020Miami Min FG 3FG FT O-D Reb F A T B S Pts.Stone 29 2-5 1-3 1-2 2-1 3 2 0 2 0 2 6Waardenburg 30 4-4 1-1 6-6 1-2 3 2 1 0 0 1 15Vasiljevic 30 5-13 2-8 9-0 2-1 3 3 2 0 0 0 12Wong 29 8-12 2-2 5-6 0-1 1 3 1 6 0 0 23Beverly 28 3-13 0-2 8-10 1-1 2 1 1 3 0 1 14Lykes 21 3-9 2-3 0-0 0-1 1 4 0 1 0 0 8McGHusty 8 0-2 0-2 0-0 0-2 2 0 1 1 0 0 0Walker 21 0-3 0-2 0-0 1-4 5 2 2 0 1 1 0Gkogkos 2 0-1 0-0 0-0 1-0 1 0 0 0 0 0 0Herenton 2 1-2 0-1 1-1 0-0 0 0 0 0 0 1 3Team 1-2 3 Totals 200 26-64 8-24 21-25 9-15 24 17 8 13 1 6 81

Fl. State Min FG 3FG FT O-D Reb F A T B S Pts.Gray 12 1-3 0-0 0-0 0-4 4 1 1 0 0 0 2Osborne 12 2-3 2-2 0-0 1-2 3 2 0 0 0 0 6Forrest 23 3-6 0-1 4-4 2-4 6 1 6 3 0 2 10Walker 30 4-10 2-4 4-4 0-1 1 4 2 2 0 1 14Vassell 24 5-9 1-4 2-2 2-3 5 1 3 1 1 0 13Williams 19 5-9 2-3 2-2 3-2 5 4 1 3 1 1 14Olejniczak 13 3-4 0-0 2-2 2-0 2 1 0 3 2 0 8Evans 17 3-5 1-1 1-2 2-2 4 0 3 0 0 0 8Polite 17 1-2 0-1 0-0 1-7 8 1 0 3 0 1 2Wilkes 15 4-7 3-6 0-0 1-0 1 2 0 1 0 0 11Koprivica 9 1-3 0-0 1-1 1-4 5 1 0 2 0 0 3Jack 3 0-2 0-2 0-0 0-0 0 1 0 0 0 0 0Lindner 2 0-0 0-0 0-0 0-1 1 1 2 1 0 0 0Prieto 2 1-1 0-0 0-0 1-0 1 0 0 0 0 0 2Light 1 2-2 2-2 0-0 0-0 0 0 0 0 0 0 6Miles 1 0-0 0-0 0-0 0-0 0 0 0 0 0 0 0Team 0-0 0 Totals 200 35-66 13-26 16-17 16-30 46 20 18 19 4 5 99

FG% - Miami, .406, Florida State, .530. 3FG% - Miami, .333, Florida State, .500. FT% - Miami, .840. Florida State, .941. Technical Fouls: Miami -- None. Florida State -- None. Referees - Raymond Styons, Brent Hampton, Mark Schnur

Miami 47 34 - 81Florida State 50 49 - 99

Game 24 -- Duke 70, Florida State 65

DURHAM, N.C. – Tre Jones had 13 points for the Blue Devils, who shot 45 percent and hit seven of 17 3-pointers to over-come 21 turnovers to defeat Florida State, 70-65. Duke’s defense also gave FSU tough looks and forced Trent Forrest to carry the offensive burden for much of the night for the Seminoles. Forrest finished with 18 points, nine rebounds and eight steals to lead the Seminoles, who shot just 38 percent form the field. Contributions came from throughout the Duke lineup on a quiet night for big man Vernon Carey Jr. Junior guard Jordan Goldwire matched his career high with 13 points on 5-for-5 shooting -- including three 3s -- after coming in averaging 4.0 points. Alex O’Connell had five straight points during a key second-half sequence after FSU had gone up 52-50, then freshman Matthew Hurt went 4 for 4 at the line in the final 11.7 seconds as a clincher.

Duke 70, Florida State 65Cameron Indoor StadiumFeb. 10, 2020Fl. State Min FG 3FG FT O-D Reb F A T B S Pts.Gray 17 2-4 0-2 2-2 1-1 2 5 3 1 0 2 6Osbrone 23 6-13 2-6 0-0 4-1 5 3 0 2 2 0 14Forrest 32 6-13 0-3 6-6 3-6 9 1 4 2 1 1 18Walker 25 1-5 0-3 1-2 1-0 1 1 0 1 0 8 3Vassell 34 5-14 1-2 0-2 1-5 6 2 0 0 2 2 11Williams 22 2-9 0-1 3-5 1-1 2 0 0 1 1 3 7Olejniczak 11 1-3 0-0 0-0 3-1 4 1 0 3 1 0 2Polite 17 0-1 0-1 0-0 0-1 1 1 0 0 0 0 0Evans 8 1-2 0-0 0-2 0-0 0 1 0 2 0 0 2Koprivica 7 1-2 0-0 0-1 1-1 2 1 0 0 0 0 2Wilkes 5 0-0 0-0 0-0 0-0 0 2 0 0 0 0 0Team 2-2 Totals 200 25-66 3-18 12-20 17-19 36 18 7 12 7 16 65

Duke Min FG 3FG FT O-D Reb F A T B S Pts.Moore 25 2-6 0-1 0-0 1-2 3 2 2 4 1 0 4Carey 20 3-5 0-0 4-5 3-7 10 2 1 3 0 2 10Stanley 32 3-8 1-4 2-4 3-4 7 3 2 3 0 0 9Jones 38 5-16 0-2 3-5 0-3 3 1 6 5 0 1 13Goldwire 25 5-5 3-3 0-0 0-0 0 3 0 2 0 0 13DeLaurier 20 0-0 0-0 2-2 0-6 6 2 0 1 2 1 2Baker 7 0-2 0-1 0-0 0-1 1 2 2 1 1 1 0Hurt 18 2-4 2-3 6-6 1-1 2 1 0 0 1 0 12O’Connell 13 3-5 1-3 0-0 1-3 4 0 0 1 0 0 7White 3 0-0 0-0 0-0 0-0 0 1 0 1 0 1 0Team 2-1 3 Totals 200 23-51 7-17 17-22 11-28 39 17 13 21 5 6 70

FG% - Florida State, .379, Duke, .451. 3FG% - Florida State, .167, Duke, .412. FT% - Florida State, .600. Duke, .773 Technical Fouls: Florida State -- None. Duke -- None. Referees - Doug Simons, Keith Kimble, Kip Kissinger

Florida State 32 33 - 65Virginia Tech 33 37 - 70

Game 25 -- Florida State 80, Syracuse 70

TALLAHASSEE, Fla. – Patrick Williams scored 17 points and pulled down seven rebounds as No. 8 Florida State defeated Syracuse 80-77. M.J. Walker scored 16 points, including five 3-pointers, as the Seminoles won their 20th straight home game. Elijah Hughes added 25 points and four rebounds, playing all 40 minutes as he returned from a groin injury that limited him to three minutes earlier this week against NC State. Hughes missed a 25-footer that went off the rim and would have tied the game in the final seconds. Trent Forrest scored 13 points, making two free-throw attempts with 8.5 seconds to go for Florida State. RaiQuan Gray also had 10 rebounds as the Seminoles has a 47-29 edge on the boards. Led by Williams’ 17 points, Florida State’s bench outscored Syracuse’s reserves 41-13.

Florida State 80, Syracuse 70Donald L. Tucker CenterFeb. 15, 2020Syracuse Min FG 3FG FT O-D Reb F A T B S Pts.Dolezaj 32 4-5 0-0 0-0 3-3 6 3 2 3 2 0 8Hughes 39 10-20 2-8 3-6 0-4 4 3 2 3 0 2 25Sidibe 27 3-3 0-0 3-3 3-7 5 4 0 0 1 0 9Girard III 40 7-22 5-12 3-3 0-2 7 3 5 1 0 1 22Boeheim 33 0-7 0-5 0-0 1-0 3 1 1 3 2 1 0Guerrier 21 4-5 0-0 5-6 2-0 2 3 1 1 2 1 13Goodine 7 0-1 0-0 0-0 0-0 0 3 0 0 0 0 0Team 1-1 2 Totals 200 28-63 7-25 14-18 10-19 29 20 11 11 7 5 77

Fl. State Min FG 3FG FT O-D Reb F A T B S Pts.Gray 21 0-8 0-3 2-2 5-5 10 4 3 3 0 0 2Osborne 17 1-4 0-0 2-2 2-1 3 1 0 0 0 2 4Polite 24 1-5 0-2 2-3 3-2 5 4 1 1 1 0 4Forrest 37 5-7 1-1 2-5 1-4 5 1 6 6 0 2 13Walker 18 5-11 5-9 1-1 0-0 0 1 1 1 0 0 16Williams 32 7-14 1-2 2-2 2-5 7 3 1 2 1 2 17Evans 17 2-4 2-3 0-0 0-2 2 1 4 0 0 0 6Olejniczak 14 2-3 0-0 2-2 1-3 4 5 0 2 0 0 6Wilkes 23 3-6 2-5 0-0 1-2 3 2 1 1 0 1 8Koprivica 6 2-3 0-0 0-0 3-0 3 0 0 1 1 0 4Team 2-3 5 1 Totals 200 28-65 11-25 13-17 20-27 47 22 17 18 3 7 80

FG% - Syracuse, .444, Florida State, .431. 3FG% - Syracuse, .280, Florida State, .440. FT% - Syracuse, .778. Florida State, .765. Technical Fouls: Syracuse -- None. Florida State -- None. Referees - Bert Smith, John Gaffney, Jeffrey Anderson

Syracuse 33 44 - 77Florida State 41 39 - 80

Game 26 -- Florida State 82,Pittsburgh 67

TALLAHASSEE, Fla. – Patrick Williams scored 16 points, Anthony Polite had 10 points and six rebounds and No. 8 Florida State pulled away in the second half, beating Pittsburgh 82-67. Williams, a freshman forward, scored in double figures for the 10th time this season as the Seminoles improved to 14-0 at home. Au’Diese Toney had 15 points and seven rebounds, and Xavier Johnson added 12 points and seven assists for Pittsburgh. Balsa Koprivica had seven rebounds, helping Florida State gain a 40-27 edge on the boards. The victory helped the Seminoles avenge a 63-61 loss at Pittsburgh in the season opener on Nov. 6.

Florida State 82, Pittsburgh 67Donald L. Tucker CenterFeb. 18, 2020Pitt Min FG 3FG FT O-D Reb F A T B S Pts.Champagnie 28 2-8 1-5 6-6 1-2 3 2 1 0 0 1 11Brown 24 5-6 0-0 1-2 0-3 3 1 0 0 1 0 11Johnson 31 3-14 0-5 6-8 3-1 4 2 7 4 0 5 12McGowens 34 0-7 0-3 3-4 1-1 2 1 0 4 0 5 3Toney 33 5-10 2-4 3-4 3-4 7 3 2 4 0 1 15Drumgoole, Jr. 19 0-2 0-2 2-2 0-2 2 1 1 1 0 0 2Coulibaly 16 3-3 0-0 0-0 2-1 3 1 0 0 0 0 6Murphy 9 1-4 0-2 0-0 0-0 0 1 0 1 0 0 2Starzynski 4 1-1 1-1 0-0 0-0 0 1 1 0 0 1 3Aiken, Jr. 1 0-0 0-0 0-0 0-0 0 0 1 0 0 0 0Marshall 1 1-1 0-0 0-0 0-0 0 0 0 0 0 0 2Team 2-1 3 Totals 200 21-56 4-22 12-15 12-15 27 13 13 14 1 13 67

Fl. State Min FG 3FG FT O-D Reb F A T B S Pts.Gray 14 1-3 0-0 2-2 1-1 2 1 1 1 1 1 4Osborne 11 2-4 0-2 1-1 1-0 1 0 1 1 1 1 5Forrest 25 3-9 2-4 0-0 0-2 2 1 3 4 0 2 10Walker 24 1-7 1-4 4-6 1-3 4 4 4 2 0 0 7Vassell 20 1-5 1-4 0-0 1-3 4 3 2 0 0 0 3Polite 19 4-6 2-3 0-0 1-5 6 1 0 1 0 2 10Williams 22 7-12 1-4 1-1 4-1 5 2 0 1 1 0 16Olejniczak 11 4-4 0-1 0-0 1-1 2 2 0 1 2 0 8Koprivica 17 3-4 0-0 1-2 4-3 7 4 3 0 0 0 7Evans 14 1-2 0-0 0-0 0-1 1 1 3 1 0 0 2Wilkes 15 2-6 1-3 0-0 0-1 1 1 2 2 1 0 5Jack 4 2-2 1-1 0-0 0-2 2 1 0 1 0 0 5Lindner 1 0-0 0-0 0-0 0-0 0 0 0 1 0 0 0Light 1 0-0 0-0 0-0 0-0 0 0 0 0 0 0 0Prieto 1 0-0 0-0 0-0 0-0 0 0 1 0 0 0 0Miles 1 0-0 0-0 0-0 0-0 0 0 0 0 0 0 0Team 3-0 3 Totals 200 32-64 9-22 9-12 17-23 40 21 20 16 6 6 82

FG% - Pitt, .375, Florida State, .500. 3FG% - Pitt, .182, Florida State, .409. FT% - Pitt, .808. Florida State, .750. Technical Fouls: Pitt -- None. Florida State -- M.J. Walker. . Referees - Ron Groover, Tim Clougherty, Clarence Armstrong

Pitt 33 34 - 67Florida State 38 44 - 82

Page 36: NO. 8/8 FLORIDA STATE SEMINOLES (22-4, 12-3 ACC) AT NC STATE WOLFPACK (17-9, 8-7 … · 2020-02-21 · no. 8/8 florida state seminoles (22-4, 12-3 acc) at . nc state wolfpack (17-9,

Patrick Williams Developing At Both Ends Of The Court For Florida State By Curt Weiler Tallahassee Democrat February 18, 2020 Why Florida State is a question Patrick Williams grew used to hearing. Plenty of people questioned why the five-star small forward from Charlotte, North Carolina was leaving a basketball-rich state to play for a school known more traditionally as a football school in Tallahassee. Williams held more regional offers from the likes of NC State, Wake Forest and Clemson and held offers from national powers such as Virginia, Texas Tech, Louisville and Arizona, but chose instead to play at FSU. The constant questions surrounding his decision only added to the chip on his shoulder. "Coming here, Florida State, I got a lot of questions about why Florida State, why this school," Williams said. "There are a lot of schools around Charlotte, around the North Carolina area that were recruiting me, but why Florida State? I was ready to get down here and prove to them why I came here." Williams has lived up to the hype, playing a significant role in the eighth-ranked Seminoles' success this season. FSU (21-4, 11-3 in ACC) plays host to Pittsburgh (15-11, 6-9 in ACC) Tuesday at 8 p.m. on the ACC Network. Ranked as the No. 26 overall prospect in the 2019 recruiting class by the 247Sports composite rankings, Williams was viewed as an instant-impact player who arrived at FSU this season with decent odds of being a one-and-done player destined for the 2020 NBA Draft. Because of this and the assumptions that come with this type of player, his reasoning behind why FSU and the areas he hoped to find improvement came as something of a surprise. "A lot of schools during my recruitment, they talked about offense, what I can do on offense. Florida State was different. (FSU head coach Leonard Hamilton) and the rest of the coaching staff as well as the players while I was getting recruited, they were talking to me about defense," Williams said. "I feel like that really stood out to me. Everybody can play offense, but it's only a select few guys who can really lock up defensively...Coming here, defense was my mindset, what I wanted to grow at." Ask his teammates at FSU and they'll speak wonders about his personality and how he fits right into the culture head coach Leonard Hamilton has built. “He’s so humble that I have to sometimes remind him who he is and how good he really is," FSU point guard Trent Forrest said. "He doesn’t love people talking about him but I tell him all the time. The more he plays, the better and better he’s going to be.” Williams scored 14 points in the win over UNC after failing to score more than seven points in any of the previous five games. He followed that up by posting 14 points in the next game vs. Miami and then putting up 17 points in Saturday's win over Syracuse. After scoring in double-digits in just one of his first eight ACC games this season, Williams has scored 10-plus points in three of the Seminoles' last four games.

Page 37: NO. 8/8 FLORIDA STATE SEMINOLES (22-4, 12-3 ACC) AT NC STATE WOLFPACK (17-9, 8-7 … · 2020-02-21 · no. 8/8 florida state seminoles (22-4, 12-3 acc) at . nc state wolfpack (17-9,

"As a freshman, you can't just come into the ACC and just do what you did in high school. I tried to focus on defense first," Williams said. "My teammates and coaches, they kept giving me confidence because they know I'm talented. They just kept giving me confidence and as the season goes on, I think I just get more comfortable." On the season, Williams is now averaging 8.9 points per game, solidly the fourth-most on the team. He's also averaging 3.7 rebounds per game and is one of only two FSU players, along with Devin Vassell, who is averaging a steal and a block per game this season. "Patrick came here wanting to become a better defender and to increase his intensity for the amount of time he's on the floor," Hamilton said. "He really worked hard at learning how not to take possessions off, accepting his strengths as well as weaknesses, working on his weaknesses and trying to enhance his strengths...He's gifted with physical offensive skills and athleticism and now I think you're seeing the mental emerging with the physical and we're getting a freshman who's more consistent... I think the best still is yet to come. I think he's only scratching the surface of his potential."

Page 38: NO. 8/8 FLORIDA STATE SEMINOLES (22-4, 12-3 ACC) AT NC STATE WOLFPACK (17-9, 8-7 … · 2020-02-21 · no. 8/8 florida state seminoles (22-4, 12-3 acc) at . nc state wolfpack (17-9,

Savor The Humility, Development, Athleticism of Williams By Bob Ferrante The Osceola February 20, 2020 The recruiting pitch seems to contradict what a four- and five-star basketball prospect wants to hear. Great weather, a winning program and a family atmosphere. Sure, that resonates. Focus on defense, come off the bench, play with unselfishness. That doesn’t always resonate. Florida State wins with depth and if you’ve watched the ACC this year it’s one area where many of the established coaches just don’t have it. Notre Dame, Syracuse and Miami typically use about eight players. FSU coaches willingly go 12 deep. Patrick Williams was one of those five-star prospects and could have gone elsewhere. Just about anywhere he would have started from day 1. Not at Florida State, not under coach Leonard Hamilton. Williams said Hamilton’s pitch of learning defense and making the most of minutes hit home with him as he was choosing a school. There was a development plan for Williams. Learn the defensive principles. Work hard. Come off the bench. “I thank coach Ham for that a lot,” Williams said. “He could definitely have put pressure on me. So could everybody else, my teammates, put a lot of pressure on me to come in and score. They let me find my face. They kept feeding me confidence. They kept telling me, ‘Focus on defense first. Offense will find itself.’” Offense has certainly been found. Williams has been at his best in FSU’s last five games, averaging 13.6 points and 5.6 rebounds. While his season high was an 18-point game in November against Western Carolina, Williams’ best two ACC games have been his last two as he scored 17 points on 7 of 14 shooting in the win over Syracuse and then 16 points on 7 of 12 shooting vs. Pittsburgh. It’s of little coincidence that FSU is 4-1 in that stretch. Williams has been incredibly efficient, shooting 50 percent or more from the floor in the majority of his games. And his 87.5 percent free-throw percentage leads the team. Williams has typically played between 17 and 26 minutes in an ACC game, coming off the bench in all 24 games. He did play a season-high 32 minutes against Syracuse, mostly out of necessity as Devin Vassell did not play by coach’s decision and M.J. Walker took an elbow to the mouth and missed large portions of the game. FSU is ranked No. 8 in the nation and has all of the ingredients to make a deep run in March. Williams had been an important piece of the team all along, but his role has become more significant in the last five games. “Patrick Williams is a big-time NBA prospect,” FSU assistant coach Charlton Young said. “Not a ball-dominant guy. You almost have to make him be aggressive, score. Because he wants to play the game the right way.” Young saw that in Williams from the start. The phone calls came early, from friends in the coaching community in Charlotte, N.C. High school coaches could see the talent and the NBA potential. When Young was able to visit and watch the high school freshman he had made up his mind in just five minutes: Williams would be offered a scholarship. “I could not believe the blue bloods weren’t in on him,” Young said. “I could not believe that Kentucky was not in on him.”

Page 39: NO. 8/8 FLORIDA STATE SEMINOLES (22-4, 12-3 ACC) AT NC STATE WOLFPACK (17-9, 8-7 … · 2020-02-21 · no. 8/8 florida state seminoles (22-4, 12-3 acc) at . nc state wolfpack (17-9,

Young kept in contact frequently after that offer. As Williams got older, he didn’t listen to the hype about him being one of his state’s top players. He asked Young instead, “Coach, How can I get better?” “He has a tremendous amount of humility,” Young said. FSU had to hold off a number of schools. NC State, who FSU will play on Saturday, was one. Louisville and Ohio State were pursuing Williams, too. (Duke and North Carolina didn’t put as much of a priority on Williams a point that to his credit he has tried to downplay.) But Williams is typical of the personality that FSU coaches are looking for. Young calls them high-character gym rats. They have the skill set, the height and length. But also the work ethic, desire to play defense at a high level and the unselfishness to share minutes and not be just a scorer. And Williams shows that on the defensive end, with pressure, blocks and steals. On the offensive end, there is the athleticism, skying for rebounds and dunks. “He’s a superior athlete,” Hamilton said. “He has the ability to go get rebounds in crowds. He has such fast-twich muscles that he can spring up in an instant and get a nice, uncontested shot. He made a big difference in getting his hand up and changing shots.” Opposing coaches see it, too. They come into the interview room after losses at the Donald L. Tucker Center and are often asked about Williams. There is much more than coachspeak. Pittsburgh’s Jeff Capel on Williams’ improvement in February: “He’s more poised. He understands college basketball better now. He understands what’s needed of him. He’s shooting the ball better; he’s handling the ball better. He’s a big-time prospect.” Miami’s Jim Larranaga: “He’s a pro. Everything about him says he’s an NBA player. His height, his athletic ability, his shooting ability. … He stays in college, he’s going to be a tremendous college player. If he goes pro, I think he’s a first-round draft choice.” Williams has a big decision to make. If you think he may be a one-and-done, mark FSU’s final two home games on your calendar: Monday against Louisville and March 7 vs. Boston College. But even if you can’t make it to see him in Tallahassee, or if his performance simply keeps you waiting to watch him again on TV, know that Williams and FSU still have more than a month of basketball to go. FSU (22-4, 12-3) is poised to make a run in the ACC Tournament (March 10-14) and the NCAA Tournament because of its guards, depth and defense. And because of Williams, the humble kid whose basketball maturity and athleticism is on display each night.


Top Related