![Page 1: Lecture 1. BIOINFORMATICS · Lecture 1. BIOINFORMATICS Fatchiyah, M.Kes.,Ph.D Asc. Prof of Molecular Genetics Dept of Biology, Brawijaya University Email: fatchiya@ub.ac.id](https://reader035.vdocuments.us/reader035/viewer/2022081517/5ee1d033ad6a402d666c8e71/html5/thumbnails/1.jpg)
Lecture 1. BIOINFORMATICS
Fatchiyah, M.Kes.,Ph.D
Asc. Prof of Molecular Genetics
Dept of Biology, Brawijaya University
Email: [email protected]
Website: htpp://fatchiyah.lecture.ub.ac.id
2/21/2012 fatchiyah, dept bio UB
![Page 2: Lecture 1. BIOINFORMATICS · Lecture 1. BIOINFORMATICS Fatchiyah, M.Kes.,Ph.D Asc. Prof of Molecular Genetics Dept of Biology, Brawijaya University Email: fatchiya@ub.ac.id](https://reader035.vdocuments.us/reader035/viewer/2022081517/5ee1d033ad6a402d666c8e71/html5/thumbnails/2.jpg)
What is Bioinformatics
• The use of computers to collect, analyze, and interpret biological information at the molecular level.
"The mathematical, statistical and computing methods that aim to solve biological problems using DNA and amino acid sequences and related information."
• A set of software tools for molecular sequence analysis
2/21/2012 fatchiyah, dept bio UB
![Page 3: Lecture 1. BIOINFORMATICS · Lecture 1. BIOINFORMATICS Fatchiyah, M.Kes.,Ph.D Asc. Prof of Molecular Genetics Dept of Biology, Brawijaya University Email: fatchiya@ub.ac.id](https://reader035.vdocuments.us/reader035/viewer/2022081517/5ee1d033ad6a402d666c8e71/html5/thumbnails/3.jpg)
In Silico In Vivo
Analysis development
In Vitro
2/21/2012 fatchiyah, dept bio UB
![Page 4: Lecture 1. BIOINFORMATICS · Lecture 1. BIOINFORMATICS Fatchiyah, M.Kes.,Ph.D Asc. Prof of Molecular Genetics Dept of Biology, Brawijaya University Email: fatchiya@ub.ac.id](https://reader035.vdocuments.us/reader035/viewer/2022081517/5ee1d033ad6a402d666c8e71/html5/thumbnails/4.jpg)
What is bioinformatics?
• an emerging interdisciplinary research area
• deals with the computational management
and analysis of biological information: genes,
genomes, proteins, cells, ecological systems,
medical information, robots, artificial
intelligence...
2/21/2012 fatchiyah, dept bio UB
![Page 5: Lecture 1. BIOINFORMATICS · Lecture 1. BIOINFORMATICS Fatchiyah, M.Kes.,Ph.D Asc. Prof of Molecular Genetics Dept of Biology, Brawijaya University Email: fatchiya@ub.ac.id](https://reader035.vdocuments.us/reader035/viewer/2022081517/5ee1d033ad6a402d666c8e71/html5/thumbnails/5.jpg)
Basic concepts • conceptual foundations of bioinformatics:
evolution protein folding protein function
• bioinformatics builds mathematical models of these processes -
to infer relationships between components of complex biological systems
2/21/2012 fatchiyah, dept bio UB
![Page 6: Lecture 1. BIOINFORMATICS · Lecture 1. BIOINFORMATICS Fatchiyah, M.Kes.,Ph.D Asc. Prof of Molecular Genetics Dept of Biology, Brawijaya University Email: fatchiya@ub.ac.id](https://reader035.vdocuments.us/reader035/viewer/2022081517/5ee1d033ad6a402d666c8e71/html5/thumbnails/6.jpg)
Information processing in cells
coding regions
regulatory
sites
nucleic acids
transcripts
proteins
One-to-many mappings!
Context-dependence!
2/21/2012 fatchiyah, dept bio UB
![Page 7: Lecture 1. BIOINFORMATICS · Lecture 1. BIOINFORMATICS Fatchiyah, M.Kes.,Ph.D Asc. Prof of Molecular Genetics Dept of Biology, Brawijaya University Email: fatchiya@ub.ac.id](https://reader035.vdocuments.us/reader035/viewer/2022081517/5ee1d033ad6a402d666c8e71/html5/thumbnails/7.jpg)
Global cell state
Genome activation patterns: transcriptomics
Protein population: proteomics
Organisation:
tissue imaging EM X-ray, NMR
cells
molecular complexes
Global approaches: Toward a new Systems Biology
•How does the spatial and temporal organisation of living matter give rise to biological processes?
Genome
2/21/2012 fatchiyah, dept bio UB
![Page 8: Lecture 1. BIOINFORMATICS · Lecture 1. BIOINFORMATICS Fatchiyah, M.Kes.,Ph.D Asc. Prof of Molecular Genetics Dept of Biology, Brawijaya University Email: fatchiya@ub.ac.id](https://reader035.vdocuments.us/reader035/viewer/2022081517/5ee1d033ad6a402d666c8e71/html5/thumbnails/8.jpg)
Living cell
“Virtual cell”
Perturbation Dynamic response
Biological knowledge (computerised)
Sequence information
Structural information
•Basic principles
•Practical applications
Global approaches: Toward a new Systems Biology
Bioinformatics
Mathematical modelling
Simulation
2/21/2012 fatchiyah, dept bio UB
![Page 9: Lecture 1. BIOINFORMATICS · Lecture 1. BIOINFORMATICS Fatchiyah, M.Kes.,Ph.D Asc. Prof of Molecular Genetics Dept of Biology, Brawijaya University Email: fatchiya@ub.ac.id](https://reader035.vdocuments.us/reader035/viewer/2022081517/5ee1d033ad6a402d666c8e71/html5/thumbnails/9.jpg)
External environment
Internal environment
Metabolic net
Genetic networks
DNA hRNA mRNAs proteins
To explore the pathway networking inside and/or among cells or tissues to communicate in between.
2/21/2012 fatchiyah, dept bio UB
![Page 10: Lecture 1. BIOINFORMATICS · Lecture 1. BIOINFORMATICS Fatchiyah, M.Kes.,Ph.D Asc. Prof of Molecular Genetics Dept of Biology, Brawijaya University Email: fatchiya@ub.ac.id](https://reader035.vdocuments.us/reader035/viewer/2022081517/5ee1d033ad6a402d666c8e71/html5/thumbnails/10.jpg)
Bioinformatics in context
Genomics
Molecular
evolution
Biophysics Molecular
biology
Ethical, legal, and
social implications
Bioinformatics
Mathematics/com
puter science
2/21/2012 fatchiyah, dept bio UB
![Page 11: Lecture 1. BIOINFORMATICS · Lecture 1. BIOINFORMATICS Fatchiyah, M.Kes.,Ph.D Asc. Prof of Molecular Genetics Dept of Biology, Brawijaya University Email: fatchiya@ub.ac.id](https://reader035.vdocuments.us/reader035/viewer/2022081517/5ee1d033ad6a402d666c8e71/html5/thumbnails/11.jpg)
•Relationships between
sequence 3D structure protein functions
•Properties and evolution of genes, genomes, proteins, metabolic
pathways in cells
•Use of this knowledge for prediction, modelling, and design
The Core of Bioinformatics to date
TDQAAFDTNIVTLTRFVMEQGRKARGTGEMTQLLNSLCTAVKAISTAVRKAGIAHLYGIAGSTNVTGDQVKKLDVLSNDLVINVLKSSFATCVLVTEEDKNAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSIGTIFGIYRKNSTDEPSEKDALQPGRNLVAAGYALYGSATMLV
2/21/2012 fatchiyah, dept bio UB
![Page 12: Lecture 1. BIOINFORMATICS · Lecture 1. BIOINFORMATICS Fatchiyah, M.Kes.,Ph.D Asc. Prof of Molecular Genetics Dept of Biology, Brawijaya University Email: fatchiya@ub.ac.id](https://reader035.vdocuments.us/reader035/viewer/2022081517/5ee1d033ad6a402d666c8e71/html5/thumbnails/12.jpg)
MESDAMESETMESSRSMYN
AMEISWALTERYALLKINCAL
LMEWALLYIPREFERDREVIL
MYSELFIMACENTERDIRATV
ANDYINTENNESSEEILIKENM
RANDDYNAMICSRPADNAPRI
MASERADCALCYCLINNDRKI
NASEMRPCALTRACTINKAR
KICIPCDPKIQDENVSDETAVS
WILLWINITALL
3D
structure
Cell
System Dynamics
Cell
Structures
Complexes
Sequence
Structural Scales
Organism
2/21/2012 fatchiyah, dept bio UB
![Page 13: Lecture 1. BIOINFORMATICS · Lecture 1. BIOINFORMATICS Fatchiyah, M.Kes.,Ph.D Asc. Prof of Molecular Genetics Dept of Biology, Brawijaya University Email: fatchiya@ub.ac.id](https://reader035.vdocuments.us/reader035/viewer/2022081517/5ee1d033ad6a402d666c8e71/html5/thumbnails/13.jpg)
Blue print of gene
• Genome sequence: for the first time there is a blueprint of the activity of a cell
• Gene expression, in the form of cDNA array, and proteomic studies: how these genes interact, interfacing with each other, and how they form networks.
• On structural level, the mechanism how these molecules work.
• Major impact on diagnosis, treatment, drug discovery, regulation and metabolism, biodegradation
2/21/2012 fatchiyah, dept bio UB
![Page 14: Lecture 1. BIOINFORMATICS · Lecture 1. BIOINFORMATICS Fatchiyah, M.Kes.,Ph.D Asc. Prof of Molecular Genetics Dept of Biology, Brawijaya University Email: fatchiya@ub.ac.id](https://reader035.vdocuments.us/reader035/viewer/2022081517/5ee1d033ad6a402d666c8e71/html5/thumbnails/14.jpg)
Challenges in Computational Biology
2/21/2012 fatchiyah, dept bio UB
1. Obtain the genome of an organism. 2. Identify and annotate genes. 3. Find the sequences, three dimensional
structures, and functions of proteins. 4. Find sequences of proteins that have
desired three dimensional structures. 5. Compare DNA sequences and proteins
sequences for similarity. 6. Study the evolution of sequences and
species.
![Page 15: Lecture 1. BIOINFORMATICS · Lecture 1. BIOINFORMATICS Fatchiyah, M.Kes.,Ph.D Asc. Prof of Molecular Genetics Dept of Biology, Brawijaya University Email: fatchiya@ub.ac.id](https://reader035.vdocuments.us/reader035/viewer/2022081517/5ee1d033ad6a402d666c8e71/html5/thumbnails/15.jpg)
http://gila.engr.uic.edu/bioinformatics/
Bioinformatics
• Computational analysis of high-throughput biological data
▫ Whole genome sequencing.
▫ Global genomic expression & profiling.
▫ Functional genomics.
▫ Structural genomics/proteomics
▫ Comparative genomics.
2/21/2012 fatchiyah, dept bio UB
![Page 16: Lecture 1. BIOINFORMATICS · Lecture 1. BIOINFORMATICS Fatchiyah, M.Kes.,Ph.D Asc. Prof of Molecular Genetics Dept of Biology, Brawijaya University Email: fatchiya@ub.ac.id](https://reader035.vdocuments.us/reader035/viewer/2022081517/5ee1d033ad6a402d666c8e71/html5/thumbnails/16.jpg)
I. The Human Genome Project
The genome sequence is complete - almost!
▫ approximately 3.2 billion base pairs.
2/21/2012 fatchiyah, dept bio UB
![Page 17: Lecture 1. BIOINFORMATICS · Lecture 1. BIOINFORMATICS Fatchiyah, M.Kes.,Ph.D Asc. Prof of Molecular Genetics Dept of Biology, Brawijaya University Email: fatchiya@ub.ac.id](https://reader035.vdocuments.us/reader035/viewer/2022081517/5ee1d033ad6a402d666c8e71/html5/thumbnails/17.jpg)
2/21/2012 fatchiyah, dept bio UB
In the mid-1990s, the GenBank database became part of the International Nucleotide Sequence Database Collaboration:
Internationally Networking Collaboration
NCBI investigators maintain on going collaborations with several institutes within NIH and also with numerous academic and government research laboratories
DDBJ Mishima,
Japan
GenBank NCBI USA
EMBL Europea
www.ncbi.nlm.nih.gov/
http://www.ebi.ac.uk/
![Page 18: Lecture 1. BIOINFORMATICS · Lecture 1. BIOINFORMATICS Fatchiyah, M.Kes.,Ph.D Asc. Prof of Molecular Genetics Dept of Biology, Brawijaya University Email: fatchiya@ub.ac.id](https://reader035.vdocuments.us/reader035/viewer/2022081517/5ee1d033ad6a402d666c8e71/html5/thumbnails/18.jpg)
2/21/2012 fatchiyah, dept bio UB
Nucleotide
Protein
PubMed
The original version of Entrez had just 3 nodes: nucleotides, proteins, and PubMed abstracts.
Entrez has now grown to nearly 20 nodes
![Page 19: Lecture 1. BIOINFORMATICS · Lecture 1. BIOINFORMATICS Fatchiyah, M.Kes.,Ph.D Asc. Prof of Molecular Genetics Dept of Biology, Brawijaya University Email: fatchiya@ub.ac.id](https://reader035.vdocuments.us/reader035/viewer/2022081517/5ee1d033ad6a402d666c8e71/html5/thumbnails/19.jpg)
2/21/2012 fatchiyah, dept bio UB
The future of genomic rests on the foundation of the Human Genome
Project
![Page 20: Lecture 1. BIOINFORMATICS · Lecture 1. BIOINFORMATICS Fatchiyah, M.Kes.,Ph.D Asc. Prof of Molecular Genetics Dept of Biology, Brawijaya University Email: fatchiya@ub.ac.id](https://reader035.vdocuments.us/reader035/viewer/2022081517/5ee1d033ad6a402d666c8e71/html5/thumbnails/20.jpg)
2/21/2012 fatchiyah, dept bio UB
The Wellcome Trust
Free unrestricted access for all
The door to discovery is wide open
Genome browsers
Ensembl www.ensembl.org
University of California Santa Cruz http://genome.cse.ucsc.edu
European Bioinformatics Institutes www.ebi.ac.uk
MGD the Jackson Laboratory www.informatics.jax.org
GenBank www.ncbi.nlm.nih.gov
DNA Data Bank of Japan www.ddbj.nig.ac.jp
Genome Databases
![Page 21: Lecture 1. BIOINFORMATICS · Lecture 1. BIOINFORMATICS Fatchiyah, M.Kes.,Ph.D Asc. Prof of Molecular Genetics Dept of Biology, Brawijaya University Email: fatchiya@ub.ac.id](https://reader035.vdocuments.us/reader035/viewer/2022081517/5ee1d033ad6a402d666c8e71/html5/thumbnails/21.jpg)
2/21/2012 fatchiyah, dept bio UB
The Flow of Biotechnology Information
Gene > DNA sequence AATTCATGAAAATCGTATACTGGTCTGGTACCGGCAACAC
TGAGAAAATGGCAGAGCTCATCGCTAAAGGTATCATCGAA
TCTGGTAAAGACGTCAACACCATCAACGTGTCTGACGTTA
ACATCGATGAACTGCTGAACGAAGATATCCTGATCCTGGG
TTGCTCTGCCATGGGCGATGAAGTTCTCGAGGAAAGCGAA
TTTGAACCGTTCATCGAAGAGATCTCTACCAAAATCTCTG
GTAAGAAGGTTGCGCTGTTCGGTTCTTACGGTTGGGGCGA
CGGTAAGTGGATGCGTGACTTCGAAGAACGTATGAACGGC
TACGGTTGCGTTGTTGTTGAGACCCCGCTGATCGTTCAGA
ACGAGCCGGACGAAGCTGAGCAGGACTGCATCGAATTTGG
TAAGAAGATCGCGAACATCTAGTAGA
> Protein sequence
MKIVYWSGTGNTEKMAELIAKGIIESGKDVNTINVSDVNI DELLNEDILILGCSAMGDEVLEESEFEPFIEEISTKISGK KVALFGSYGWGDGKWMRDFEERMNGYGCVVVETPLIVQNE PDEAEQDCIEFGKKIANI
> 500, 000 genes
sequenced to date
Expected number of
unique protein
structures:
~ 700-1, 000
![Page 22: Lecture 1. BIOINFORMATICS · Lecture 1. BIOINFORMATICS Fatchiyah, M.Kes.,Ph.D Asc. Prof of Molecular Genetics Dept of Biology, Brawijaya University Email: fatchiya@ub.ac.id](https://reader035.vdocuments.us/reader035/viewer/2022081517/5ee1d033ad6a402d666c8e71/html5/thumbnails/22.jpg)
fatchiyah, dept bio UB
Proteins: Molecular Machines
Proteins in your muscles allows you to move: myosin and actin
2/21/2012
![Page 23: Lecture 1. BIOINFORMATICS · Lecture 1. BIOINFORMATICS Fatchiyah, M.Kes.,Ph.D Asc. Prof of Molecular Genetics Dept of Biology, Brawijaya University Email: fatchiya@ub.ac.id](https://reader035.vdocuments.us/reader035/viewer/2022081517/5ee1d033ad6a402d666c8e71/html5/thumbnails/23.jpg)
fatchiyah, dept bio UB
Proteins: Molecular Machines
Enzymes
(digestion, catalysis)
Structure (collagen)
2/21/2012
![Page 24: Lecture 1. BIOINFORMATICS · Lecture 1. BIOINFORMATICS Fatchiyah, M.Kes.,Ph.D Asc. Prof of Molecular Genetics Dept of Biology, Brawijaya University Email: fatchiya@ub.ac.id](https://reader035.vdocuments.us/reader035/viewer/2022081517/5ee1d033ad6a402d666c8e71/html5/thumbnails/24.jpg)
Central Dogma of Molecular Biology
• DNA RNA Protein Phenotype
• Transcription : DNA RNA
• Translation : RNA Protein
DNA
tRNA
rRNA
snRNA
mRNA
transcription translation
POLYPEPTIDE
2/21/2012 fatchiyah, dept bio UB
![Page 25: Lecture 1. BIOINFORMATICS · Lecture 1. BIOINFORMATICS Fatchiyah, M.Kes.,Ph.D Asc. Prof of Molecular Genetics Dept of Biology, Brawijaya University Email: fatchiya@ub.ac.id](https://reader035.vdocuments.us/reader035/viewer/2022081517/5ee1d033ad6a402d666c8e71/html5/thumbnails/25.jpg)
Transcription – key steps
• Initiation
• Elongation
• Termination
+
DNA
RNA
DNA
2/21/2012 fatchiyah, dept bio UB
![Page 26: Lecture 1. BIOINFORMATICS · Lecture 1. BIOINFORMATICS Fatchiyah, M.Kes.,Ph.D Asc. Prof of Molecular Genetics Dept of Biology, Brawijaya University Email: fatchiya@ub.ac.id](https://reader035.vdocuments.us/reader035/viewer/2022081517/5ee1d033ad6a402d666c8e71/html5/thumbnails/26.jpg)
Transcription – key steps
• Initiation
• Elongation
• Termination
DNA
2/21/2012 fatchiyah, dept bio UB
![Page 27: Lecture 1. BIOINFORMATICS · Lecture 1. BIOINFORMATICS Fatchiyah, M.Kes.,Ph.D Asc. Prof of Molecular Genetics Dept of Biology, Brawijaya University Email: fatchiya@ub.ac.id](https://reader035.vdocuments.us/reader035/viewer/2022081517/5ee1d033ad6a402d666c8e71/html5/thumbnails/27.jpg)
Transcription – key steps
• Initiation
• Elongation
• Termination
DNA
2/21/2012 fatchiyah, dept bio UB
![Page 28: Lecture 1. BIOINFORMATICS · Lecture 1. BIOINFORMATICS Fatchiyah, M.Kes.,Ph.D Asc. Prof of Molecular Genetics Dept of Biology, Brawijaya University Email: fatchiya@ub.ac.id](https://reader035.vdocuments.us/reader035/viewer/2022081517/5ee1d033ad6a402d666c8e71/html5/thumbnails/28.jpg)
Transcription – key steps
• Initiation
• Elongation
• Termination
DNA
2/21/2012 fatchiyah, dept bio UB
![Page 29: Lecture 1. BIOINFORMATICS · Lecture 1. BIOINFORMATICS Fatchiyah, M.Kes.,Ph.D Asc. Prof of Molecular Genetics Dept of Biology, Brawijaya University Email: fatchiya@ub.ac.id](https://reader035.vdocuments.us/reader035/viewer/2022081517/5ee1d033ad6a402d666c8e71/html5/thumbnails/29.jpg)
Transcription – key steps
• Initiation
• Elongation
• Termination
+
DNA
RNA
DNA
2/21/2012 fatchiyah, dept bio UB
![Page 30: Lecture 1. BIOINFORMATICS · Lecture 1. BIOINFORMATICS Fatchiyah, M.Kes.,Ph.D Asc. Prof of Molecular Genetics Dept of Biology, Brawijaya University Email: fatchiya@ub.ac.id](https://reader035.vdocuments.us/reader035/viewer/2022081517/5ee1d033ad6a402d666c8e71/html5/thumbnails/30.jpg)
Promoters
• Promoters are sequences in the DNA just upstream of transcripts that define the sites of initiation.
• The role of the promoter is to attract RNA polymerase to the correct start site so transcription can be initiated.
5’ Promoter
3’
2/21/2012 fatchiyah, dept bio UB
![Page 31: Lecture 1. BIOINFORMATICS · Lecture 1. BIOINFORMATICS Fatchiyah, M.Kes.,Ph.D Asc. Prof of Molecular Genetics Dept of Biology, Brawijaya University Email: fatchiya@ub.ac.id](https://reader035.vdocuments.us/reader035/viewer/2022081517/5ee1d033ad6a402d666c8e71/html5/thumbnails/31.jpg)
Promoters
• Promoters are sequences in the DNA just upstream of transcripts that define the sites of initiation.
• The role of the promoter is to attract RNA polymerase to the correct start site so transcription can be initiated.
5’ Promoter
3’
2/21/2012 fatchiyah, dept bio UB
![Page 32: Lecture 1. BIOINFORMATICS · Lecture 1. BIOINFORMATICS Fatchiyah, M.Kes.,Ph.D Asc. Prof of Molecular Genetics Dept of Biology, Brawijaya University Email: fatchiya@ub.ac.id](https://reader035.vdocuments.us/reader035/viewer/2022081517/5ee1d033ad6a402d666c8e71/html5/thumbnails/32.jpg)
Chemoinformatics
Kombinasi dari sintesis kimia, penyaringan biologis, dan pendekatan data-mining yang digunakan untuk penemuan dan pengembangan obat
Ruang lingkup akademis dari cheminformatics ini sangat luas. Contoh bidang minatnya antara lain: Synthesis Planning, Reaction and Structure Retrieval, 3-DStructure Retrieval, Modelling, Computational Chemistry, Visualisation Tools and Utilities.
2/21/2012 fatchiyah, dept bio UB
![Page 33: Lecture 1. BIOINFORMATICS · Lecture 1. BIOINFORMATICS Fatchiyah, M.Kes.,Ph.D Asc. Prof of Molecular Genetics Dept of Biology, Brawijaya University Email: fatchiya@ub.ac.id](https://reader035.vdocuments.us/reader035/viewer/2022081517/5ee1d033ad6a402d666c8e71/html5/thumbnails/33.jpg)
Integration of Chemoinformatics and
Bioinformatics
Computational chemistry
Small Molecules
Large Molecule Targets
Genomic Biology
Bioinformatics Cheminformatics
In silico
High Throughput Screening
Assays
2/21/2012 fatchiyah, dept bio UB
![Page 34: Lecture 1. BIOINFORMATICS · Lecture 1. BIOINFORMATICS Fatchiyah, M.Kes.,Ph.D Asc. Prof of Molecular Genetics Dept of Biology, Brawijaya University Email: fatchiya@ub.ac.id](https://reader035.vdocuments.us/reader035/viewer/2022081517/5ee1d033ad6a402d666c8e71/html5/thumbnails/34.jpg)
"proteome"
• Definisi : "The PROTEin complement of the genOME".
• Dan mendefinisikan proteomics berkaitan dengan: "studi kuantitatif dan kualitatif dari ekspresi gen di level dari protein-protein fungsional itu sendiri".
• Yaitu: "sebuah antarmuka antara biokimia protein dengan biologi molekul".
(Michael J. Dunn [2004], Pemimpin Redaksi dari Proteomics )
2/21/2012 fatchiyah, dept bio UB
![Page 35: Lecture 1. BIOINFORMATICS · Lecture 1. BIOINFORMATICS Fatchiyah, M.Kes.,Ph.D Asc. Prof of Molecular Genetics Dept of Biology, Brawijaya University Email: fatchiya@ub.ac.id](https://reader035.vdocuments.us/reader035/viewer/2022081517/5ee1d033ad6a402d666c8e71/html5/thumbnails/35.jpg)
Structural proteomics 2/21/2012 fatchiyah, dept bio UB
Atlas of Topographic Surfaces of All Known Protein Structures Automatic identification of binding pockets. Measurement size of surface binding pockets.
Drug Discovery Quantifying ligand accessibility. Constructing precise negative imprint or cast of binding site.
![Page 36: Lecture 1. BIOINFORMATICS · Lecture 1. BIOINFORMATICS Fatchiyah, M.Kes.,Ph.D Asc. Prof of Molecular Genetics Dept of Biology, Brawijaya University Email: fatchiya@ub.ac.id](https://reader035.vdocuments.us/reader035/viewer/2022081517/5ee1d033ad6a402d666c8e71/html5/thumbnails/36.jpg)
Pharmacogenomics
• The use of DNA sequence information to measure and predict the reaction of individuals to drugs.
• Personalized drugs
• Faster clinical trials
▫ Selected trail populations
• Less drug side effects
▫ Toxicogenomics
2/21/2012 fatchiyah, dept bio UB
![Page 37: Lecture 1. BIOINFORMATICS · Lecture 1. BIOINFORMATICS Fatchiyah, M.Kes.,Ph.D Asc. Prof of Molecular Genetics Dept of Biology, Brawijaya University Email: fatchiya@ub.ac.id](https://reader035.vdocuments.us/reader035/viewer/2022081517/5ee1d033ad6a402d666c8e71/html5/thumbnails/37.jpg)
Drug Design
Structure based Ligand based
2/21/2012 fatchiyah, dept bio UB
![Page 38: Lecture 1. BIOINFORMATICS · Lecture 1. BIOINFORMATICS Fatchiyah, M.Kes.,Ph.D Asc. Prof of Molecular Genetics Dept of Biology, Brawijaya University Email: fatchiya@ub.ac.id](https://reader035.vdocuments.us/reader035/viewer/2022081517/5ee1d033ad6a402d666c8e71/html5/thumbnails/38.jpg)
Biologists vs Computer scientists
Biologists
• (Almost) Nothing is ever completely true or false
• Biologists strive to understand the very complicated, very messy natural world.
• more data driven
• obsessed with being the first to discover something
Computer scientists
• Everything is either true or false
• Computer scientists seek to build their own clean and organized virtual worlds
• more algorithm driven
• obsessed with being the first to invent or prove something
2/21/2012 fatchiyah, dept bio UB
![Page 39: Lecture 1. BIOINFORMATICS · Lecture 1. BIOINFORMATICS Fatchiyah, M.Kes.,Ph.D Asc. Prof of Molecular Genetics Dept of Biology, Brawijaya University Email: fatchiya@ub.ac.id](https://reader035.vdocuments.us/reader035/viewer/2022081517/5ee1d033ad6a402d666c8e71/html5/thumbnails/39.jpg)
Prof Edgar Wagener President & CEO of BioBase, wolfenbuttel german
Prof of Endocrinology of Medical School of Gouttingen
University, German
2/21/2012 fatchiyah, dept bio UB
2009/06/10 2009/06/10
![Page 40: Lecture 1. BIOINFORMATICS · Lecture 1. BIOINFORMATICS Fatchiyah, M.Kes.,Ph.D Asc. Prof of Molecular Genetics Dept of Biology, Brawijaya University Email: fatchiya@ub.ac.id](https://reader035.vdocuments.us/reader035/viewer/2022081517/5ee1d033ad6a402d666c8e71/html5/thumbnails/40.jpg)
2/21/2012 fatchiyah, dept bio UB
Ground rules for bioinformatics
Don't always believe what programs tell you
Don't always believe what databases tell you
In short, don't be a naive user
computers don’t do biology Be yourself