Transcript
Page 1: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

crea

ting.

tech

nica

l. flu

ids.

ADDITIVES & SYSTEM CLEANERmade in Germany

Page 2: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

2

oil system. Engine Purifier Engine Care & Protect Engine Flush CeraGAT 500 TÜV approved Oil Booster Engine Oil Stop Leak NanoEngineSuperProtection Hydraulic Lifer Care & Protect

petrol system. Petrol System Clean & Protect TÜV approved Petrol System Cleaner PLUS TÜV approved Octane Booster S Octane Booster TÜV approved Air Intake Cleaner Petrol Valve&InjectionPurifier Petrol Applicator Spray

petrol & diesel. CAT Clean

diesel system. Diesel System Clean & Protect TÜV approved Diesel System Cleaner PLUS TÜV approved Air Intake Cleaner Diesel Diesel Applicator Spray Diesel Bactericide 1:1000 Diesel Winter Care 1:1000 Cetane Booster DieselAntiSmoke DPFPurifier DPF Cleaning Liquid DPF Air Jet Fluid DPF Air Jet compressed-air pistole DPF & Catalyst Cleaning Foam

LPG system. LPG Petrol System Cleaner LPG System Clean & Protect LPG Valve Protect

cooling system. RadiatorPurifier Radiator Sealant

air condition. AirCon Cleaner AirCon Refresher Spring AirCon Refresher Summer Fresh´nAIR Fluid Fresh´nAIR Device

sealant. Nano Car Glass Sealant

gear box & power steering. AutomaticTransmission Cleaner AutomaticTransmissionClean&Protect AutomaticTransmissionCleaningDevice Power Steering Care & Protect

service products. Brake Cleaner Spray Brake Cleaner Liquid ThrottleBodyCleaner MultiLube Penetrate Spray Silicone Spray MoS2 Rust Remover Electrical Contact Cleaner Silicone Sealing Compound

99

101011111212

15151616171718

21

23232424252526262727282829

313132

3535

3737383839

41

43434444

494948484949505051

Page 3: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

Fromtheinitialcontactto the sample order up to thefirstdeliveryofgoodsyouwillbecounselledandsupportedbyourexperienced team.

We increase your success with a proven training concept,marketingsupportand of course with our wide product range.

Ourdifferentbusinessmodels assure the highest possiblesuccesstailoredtoyourbusinessstrategyand your individual requirements.

Page 4: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

4

review. Created by passion, experience and visionoftheManagingDirectorDr.GabyUrban,thecompanyGATmbH&Co.KG(CorporationforFuel andAutomotiveTechnology)has started

theirbusinessactivitiesinMay2014.15 years of professional experience in this branch, a highly motivated teamand the trust in a successful businessestablishmenthavebeen theGeneralManger’smotivationtotakethisstep.

However, the beginners’ level has beenoversteppedlongtimeago.Withthefoundationof GAT we perfectly combine sales of well-establishedproductswiththedevelopmentofnewproductsandconceptsbecausedifferenteconomical and local conditions requireindividual customer solutions. If a businessis clearly focused on customer benefit, themarketpotentialisendless.Satisfiedcustomersaroundtheworldandfaircompetitionshallbethe mission statement of GAT.

Page 5: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

5

facts. Our focus is set on the development and sales of premium service and maintenance products for the automotive branch as wellas for industrial applications. Our aim is thedevelopment of next-generation-products inourownResearch&Developmentfacilities.Wecooperate with universities, industry-relatedresearch institutes and with GovernmentControlledStandardsInstitutes(e.g.TÜV).

GAT’s innovative project has already receivedapproval for governmental support by the“ThuringianMinistryforEconomy,LabourandTechnology”. Since2016wearelocatedinournewproductionandR&Dsiteandwith thatareable to realizeourvisionsquicklyandefficiently.

Page 6: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

6 inhalt.

Specificallytargetedtotherequirementsof industrial facilities,fleets,mining,etc. - invariablepackingsizesandconsumption-basedmixingratios.

OnrequestthecompleteGATproductrangecanbeofferedinthefollowingpackagesizes:

• Tin cans: 100 / 300 / 400 / 500 / 1000 ml• Canisters: 5 / 10 / 20 / 30 / 60 Liter• Barrel: 200 Liter• IBC: 1000 Liter

G AT i n d u s t r y .

10W40Engine Oil

5000 ml

creating. technical. fluids.

Page 7: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

7unternehmen.

Scan the codeand see the catalogue

Onlycleansystemsguaranteeanefficient,safeandlong-term performance of engines and aggregates.

GATHigh-performancefluids•considerablyreducerepairandmaintenanceworks•reducedowntimes• extend service intervals•increasethelifespanandfunctionalityofsystemfluids• ensure long-term maintenance of value of machines and aggregates•significantreductionofharmfulexhaustemissions(HCandCOlevels)

Page 8: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

8 oil system.

CAUSE OF FAILURE+++mechanicalabrasion+++ +++ oil aging +++ oxidation +++ fuel contamination ++++++carbonization+++lubricitydegradation+++ +++ sludge +++ harmful water in fuel +++ resin formation +++

oil s

yste

m.

GAT oil system products have a “CLEAN UP” and “KEEP CLEAN” effect. Contaminations aredissolvedandwiththatlong-termstabilityoftheengineoilsisassured.Formationofdepositsand re-contamination are avoided and wear and tear are reduced.

GAT SOLUTIONS:EnginePurifier 9Engine Care & Protect 9Engine Flush 10CeraGAT 500 TÜV approved 10Oil Booster 11 Engine Oil Stop Leak 11 NanoEngineSuperProtection 12Hydraulic Lifer Care & Protect 12

Page 9: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

9oil system.

• approx. 15 minutes•beforeeveryoilchange

• 300 ml for 5 l oil • 60 ml for 1 l

all petrol and diesel engines

24 x 300 ml

Engine Purifier. Art. 62000

• dissolvesoperationallycausedcontaminationandresinformations in the complete oil system• neutralizesaggressiveresiduesfromthecombustionprocess• containshighlyeffectiveanti-frictionlubricants• considerablyimprovedandstablecompression• fuelandoilconsumptionaswellaswearand tear are reduced• less harmful exhaust emissions extend thelifespanofthecatalyticconverter

before

after

•worksduringoperation•aftereveryoilchange•easyapplicationwithoutanyextrawork

• 300 ml for 6 l oil• 50 ml for 1 l

all petrol and diesel engines

24 x 300 ml

Engine Care & Protect. Art. 62001

•highlyeffectiveadditivepackage•forincreasedwearandtearprotectionpropertiesofalltypesofengineoils•optimallubricationguaranteesminimumwearandtear• long life span of the engine and aggregates• reducesfrictionandpreventsfromwearandtear• increasestheoperationalreliabilityathightemperatures• protectsagainstoildilutioncausedbyfuelespeciallyincaseof frequent short distance travels

ECO-friendly

Product m

ovie on YouTube

Page 10: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

10 oil system.

• approx. 15 minutes•beforeeveryoilchange

• 300 ml for 5 l oil• 60 ml for 1 l

all petrol and diesel engines

24 x 300 ml

Engine Flush. Art. 62054

•reliablydissolvesoperationallycausedcontaminationandresinformations inthecompleteoilsystemwhichcantheneasilyberemovedwiththe used oil during the oil change•neutralizesaggressiveresiduesfromthecombustionprocess•containspowerfulanti-frictionlubricantsthatreliablyprotectthe engine during the cleaning process•removeslastinglydepositsandresiduesintheuppercylinderareae.g. frompistonrings,annulargaps,hydraulicvalvelifterandvalvetrain•considerablyimprovedandstablecompressioninallcylinders•fuelandoilconsumptionaswellaswearandteararereduced• less harmful exhaust emissions •extendsthelifespanofthecatalyticconverter

•worksduringoperation•aftereveryoilchange•easyapplicationwithoutanyextrawork

• 300 ml for 6 l oil • 50 ml for 1 l

all petrol and diesel engines

24 x 300 ml

CeraGAT 500 - Engine oil additive. Art. 62002

•highperformanceadditive•reducedwearandtearduetothecreationofastablewearprotectionlayer• wear and tear resistant ceramic•improvedwearprotection•compatiblewithallmineralandsyntheticengineoils• less running noise and reduced exhaust gas emissions• increasedengineperformanceandoptimizedfuelconsumption

certificate. TÜVapprovedeffectiveness

Product m

ovie on YouTube

Product m

ovie on YouTube

Page 11: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

11

•worksduringoperation•aftereveryoilchange•easyapplicationwithoutanyextrawork

• 300 ml for 5 l oil• 60 ml for 1 l

all petrol and diesel engines

24 x 300 ml

Oil Booster. Art. 62021

•highlyeffectiveadditivepackageforincreasedwearandtearprotection propertiesofalltypesofengineoils• reduces wear and tear• protects against corrosion• preventsfromdepositsintheoilandlubricationsystem• combatsharmfulengineacids• increasesreliabilityofoperationandprolongedlifespanofallcomponents• decreasedoilconsumptionandemissions• improved motor performance

•worksduringoperation• on demand

• 300 ml for 5 l oil• 50 ml for 1 l

all petrol and diesel engines

24 x 300 ml

Engine Oil Stop Leak. Art. 62077

• containsahighlyeffectiveadditivepackagetostoplossofengineoilcausedbyleakage• helpstoregenerateenginegasketsandkeepsthemsoftandsupple• reductionofoilloss• improvedreliabilityofoperation• increased engine performance• less wear and tear

Page 12: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

12

•worksduringoperation•aftereveryoilchangeorwhenrequired

• 300 ml for 5 l oil • 60 ml for 1 l

all petrol and diesel engines

24 x 300 ml

Hydraulic Lifter Care & Protect. Art. 62042

•containsahighperformancepackageofeffectiveadditives• improvedhighpressurepropertiesaswellaswearandtearprotection• for all types of engine oils• disturbingrattlesoundswillbeeliminated• reductionofwearandtear• optimizedlubrication

•worksduringoperation•aftereveryoilchange•easyapplicationwithoutanyextrawork

• 300 ml for 5 l oil• 60 ml for 1 l

all petrol and diesel engines

24 x 300 ml

Nano Engine Super Protection. Art. 62103

• formsahighlyefficientNanoanti-frictionbarrierintheoil• isrecommendedforusewithturbos,catalyticconvertersandparticulatefilter• protects all the internal surfaces of engine and equipment e.g. oil systems, automaticandmanualgearboxes,differentials,transferboxes•keepstheo-ringsandshaftsealssoftandsupple• reduces wear and tear• protects against corrosion• preventsfromdepositsintheoilandlubricationsystem• combatsharmfulengineacids,increasesreliabilityofoperationand prolongedlifespanofallcomponents,decreasedoilconsumptionandemissions, improved motor performance

oil system.

Page 13: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

Sludge and carbon depositsblock the U-rings. Oil controlrings stick together and cannotoperate reliably anymore.As a result oil enters into the combustion chamber and fuelinto the engine oil.

G AT o i l sy s t e m c l e a n i n g .

Afterthecleaningtheoilcontrolringsaresoftandsuppleandthecylinder wall is sealed again. An optimalcompressionisrestored.

Page 14: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

14 petrol system.

CAUSE OF FAILURE +++oxidation+++aging+++resindeposits++++++carbonresidues+++waterinfuel+++alcohols++++++contamination+++combustionresidues+++fuelquality++++++operatingconditions+++varnishresidues+++

petr

ol sy

stem

.

GATpetrol systemproductsworkon the“CLEANUP”and“KEEPCLEAN”effect.Theyensurecleancombustion,absorbharmfulmoistureandtakecareofoptimalserviceperformanceduetohighlyefficientprotectionandlubricationcomponents.

GAT SOLUTIONS:

Petrol System Clean & Protect TÜV approved 15Petrol System Cleaner PLUS TÜV approved 15Octane Booster S 16Octane Booster TÜV approved 16Air Intake Cleaner Petrol 17Valve & Injector Purifier 17Petrol Applicator Spray 18

Page 15: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

15

•worksduringoperation• add every 6 months or every 10.000 km•easyapplicationwithoutanyextrawork

• 300 ml for 60 l petrol •0,5%ofthefillingcontent

all petrol engines

24 x 300 ml

petrol system.

•worksduringoperation• every 6 months•easyapplicationwithoutanyextrawork

• 300 ml for 60 l petrol •0,5%ofthefillingcontent

all petrol engines

24 x 300 ml

Petrol System Clean & Protect. Art. 62003

•effectivecleaningoftheentirefuelsystemfromthetanktothecombustionchamber•displacesmoisture,removesoperationallycausedcontaminationandprevents formationofnewdeposits• reducesthefuelconsumption• optimizestheexhaustgasemissionvalues•protectsfromcorrosionandincreasestheoperationalreliability

certificate. TÜVapprovedeffectiveness

Petrol System Cleaner PLUS. Art. 62018

• removesoperationallycausedcontaminationintheentirefuelsystem fromthetanktothecombustionchamber• bindsmoistureandcondensedwater• dissolvesresinsandgumsinthecarburetorandinjection systemandremovescokingandunburnedcarbonresidues in the upper cylinder area• reducedfuelconsumption• improved engine performance and reduced exhaust emissions• considerablyprolongsthelifespanofthefuelsystem andcatalyticconvertercertificate. TÜVapprovedeffectiveness

with

out P

SC+

with

PSC

+

Product m

ovie on YouTube

Page 16: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

16 petrol system.

•worksduringoperation•witheveryfilling•easyapplicationwithoutanyextrawork

• 300 ml for 45 l petrol • 100 ml for 15 l petrol

all petrol engines

24 x 300 ml

Octane Booster. Art. 62005

•toincreasetheoctanenumberoflowoctanefuelsorforusein engines with higher octane requirements up to 3-8 points• dissolves and disperses deposits and residues in petrol system• protects valve seats when running on unleaded petrol• improves start and full-load performance• provides smoother idling•ensuresstablecombustionprocessandanimprovedCO-value

certificate. TÜVapprovedeffectiveness

•worksduringoperation•witheveryfilling•easyapplicationwithoutanyextrawork

• 300 ml for 60 l petrol • 50 ml for 10 l petrol

all petrol engines

24 x 300 ml

Octane Booster S. Art. 62037

•toincreasetheoctanenumberoflowoctanefuelsorforuseinengines with higher octane requirements up to 3 points•removesdepositsonvalvesandinthecombustionchamber andavoidsrecontamination• protects valve seats when running on unleaded petrol• improves start and full-load performance• provides smoother idling•ensuresstablecombustionprocessandanimprovedCO-value•improvesengineperformanceandoperationalreliability

Page 17: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

17petrol system.

• approx. 30 minutes• every 6 months

300mlfor1application

all petrol engines

24 x 300 ml

Air Intake Cleaner Petrol. Art. 62022

•forthecleaningoftheentireairintakesystemofpetrolengines•removesdepositsintheairintakesystem,combustionchamber,throttlevalves, inlet and outlet valves and valve seats•especiallyrecommendedforinsufficientthrottleresponseandcompression as well as engine knocking and dieseling•reducesfuelconsumptionandtheexhaustgasemissionvalues• ensures smooth idling

technical device. Only for use with the air intake cleaning device “GAT Stream“ and the appropriate adapters.

Product m

ovie on YouTube

•worksduringoperation• every 6 months•easyapplicationwithoutanyextrawork

• 300 ml for 60 l petrol •0,5%ofthefillingcontent

all petrol engines

24 x 300 ml

Valve & Injector Purifier. Art. 62004

•effectivecleaningofvalves,injectornozzlesandtheinletareawithoutdismantling•removesoperationallycausedcontaminationintheentirepetrolinjectionsystem• improves the engine performance•providesapowerfulandstablecombustionprocess•reducesthefuelconsumptionandoptimizes the exhaust gas emission values•considerablyprolongsthelifespanoftheengine• ensures smooth engine running

Product m

ovie on YouTube

Page 18: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

18

• approx. 15 minutes• recommended for each service interval or as needed

dependingonapplication

all petrol engines

24 x 400 ml

Petrol Applicator Spray. Art. 62036

•forcleaningandprotectionoftheentireairintakesystemofpetrolengines•removescontaminationandresindepositsintheairintakesystem, combustionchamber,Venturitubethrottlevalves,inletand outlet valves and valve seats• without dismantling of any system parts•reducesfuelconsumptionandtheexhaustgasemissionvalues• ensures smooth idling and powerful and even motor running

G AT f u e l sy s t e m c l e a n i n g .

Page 19: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

19

with

out P

LUS

prod

uct

with

PLU

S pr

oduc

t

Engine knockingCorrosionandcontaminationofvalves which do not seal properly

Spark plug burnedpoorfuelquality,combustionresiduesinthecombustionchamber

Removes deposits in the entire fuel system

binds water in the fuel tank

before after before after

Page 20: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

20 petrol. & diesel.

Only a clean fuel system guarantees clean and powerful combustion and efficient engineperformance! Easy application without any extra effort. Reduces the fuel consumption and optimizestheexhaustgasemissionvalues.

GAT SOLUTION:

CAT Clean 21

dies

el.

petr

ol. &

Page 21: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

21petrol. & diesel.

•worksduringoperation•addevery3monthstothefueltankbeforefillingup•easyapplicationwithoutanyextrawork

• 300 ml for 60 - 80 l fuel •0,5%ofthefillingcontent

• petrol,dieselandhybridengines• ideal for 4-stroke engines

24 x 300 ml

CAT Clean - Catalytic Converter & Oxygen Sensor Cleaner. Art. 62073

•newdecarbonizingtechnology• specially developed to exceed the latest environmental standards•dissolvesresin,gumandcarbondepositsintheentirefuelsystem oxygensensor/lambdaprobeandcatalyticconverter•regularusehelpstopreventheavycontamination•increasesfuelefficiency•optimizedengineperformance•ensurestheproperfunctionofthecatalyticconverter/oxygensensor

Emission measurementHyundai Accent 2007

beforeapplication afterapplication

Page 22: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

22 diesel system.

CAUSE OF FAILURE +++aging+++oxidation+++carbonresidues++++++resindeposits+++contamination+++microorganisms++++++bacteria+++temperaturedifferences+++varnishresidues++++++combustionresidues+++fuelquality+++

dies

el sy

stem

.

GATdieselsystemproductscleantheentirefuelsystemfromthetankuptothecombustionchambersandrestorefullengineperformancebyprovidingforacleancombustionprocess.Highlyefficientlubricatingagentsprotectvalvesandothersystemparts.

GAT SOLUTIONS:

Diesel System Clean & Protect TÜV approved 23Diesel System Cleaner PLUS TÜV approved 23Air Intake Cleaner Diesel 24Diesel Applicator Spray 24Diesel Bactericide 1:1000 25Diesel Winter Care 1:1000 25 Cetane Booster 26Diesel Anti Smoke 26DPF Purifier 27 DPF Cleaning Liquid 27DPF Air Jet Fluid 28DPF Air Jet compressed-air pistole 28DPF & Catalyst Cleaning Foam 29

Page 23: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

23diesel system.

•worksduringoperation•addevery6monthstothefueltankbeforefillingup•easyapplicationwithoutanyextrawork

• 300 ml for 60 l diesel •0,5%ofthefillingcontent

all diesel engines (e.g.commonrailorpumpinjectors)

24 x 300 ml

Diesel System Clean & Protect. Art. 62006

•improvedengineperformanceandfuelconsumption•increasedoperationalreliability•depositsandresiduesofcarbonoilandsootareproperlydissolvedanddispersed•ensureslastinglubricationespeciallyforlow-sulphurdieselfuels•reliablyremovesoperationallycausedcontaminationinthe wholefuelsystemfromthetanktothecombustionchamber•avoidsformationofdepositsintheinjectionsystem

certificate. TÜVapprovedeffectiveness

•worksduringoperation•addevery6monthstothefueltankbeforefillingup•easyapplicationwithoutanyextrawork

• 300 ml for 80 l diesel• 70ml per 10 l

all diesel engines (e.g.commonrailorpumpinjectors)

24 x 300 ml

Diesel System Cleaner PLUS. Art. 62019

• reliablyremovesoperationallycausedcontaminationinthewholefuelsystem fromthetanktothecombustionchamber• absorbsandefficientlyremovesmoisturefromthedieselsystem•ensureseffectiveprotectionofthehighpressurepump•providesanoptimalfuelatomization•lubricationandprotectionofallfuelcarryingparts• increased compression• improved engine performance•reducedfuelconsumptionandlessexhaustemissions• especially recommended for extended service intervalscertificate. TÜVapprovedeffectiveness

with

out D

SC+

with

DSC

+

Product m

ovie on YouTube

Page 24: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

24

dependingonapplication

all diesel engines(alsowithDPFfilters)

24 x 400 ml

Air Intake Cleaner Diesel. Art. 62034

• cleaningandprotectionoftheentireairintakesystem• removesdepositsintheairintakesystem,combustionchamber, throttlevalves,inletandoutletvalvesandvalveseats• reducesthefuelconsumptionandtheexhaustgasemissionvalues• ensures smooth, powerful and even motor running

technical device. Only for use with the air intake cleaning device “GAT Stream“ and the appropriate adapters.

Diesel Applicator Spray. Art. 62035

• cleaningandprotectionoftheentireairintakesystem• removesdepositsintheairintakesystem,combustionchamber, throttlevalves,inletandoutletvalvesandvalveseats• reducesthefuelconsumptionandtheexhaustgasemissionvalues• ensures smooth, powerful and even motor running

diesel system.

• approx. 30 minutes• every 6 months

300mlfor1application

all diesel engines (e.g.commonrailorpumpinjectors)

24 x 300 ml

• approx. 15 minutes• recommended for each service interval or as needed

Page 25: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

25diesel system.

•worksduringoperation• every 4 - 6 months•easyapplicationwithoutanyextrawork

• 150 ml for 150 L diesel• concentrate 1:1000

all diesel engines

24 x 150 ml

Diesel Bactericide 1:1000. Art. 62007

• high-performanceconcentratewithawideactionspectrum• forpreventiveuseagainstbacteria,fungiandyeasts• supportsoptimaloperationofallsystemcomponents• forcleanandpowerfulcombustionandefficientengineperformance• preventivelydisinfectsthecompletedieselsystem• existinggermsarequicklyeliminated• regularusehelpstopreventnewbacterialgrowth

•worksduringoperation• apply on demand•easyapplicationwithoutanyextrawork

• 150 ml for 150 L diesel• concentrate 1:1000

all diesel systems and diesel storage tanks

24 x 150 ml

Diesel Winter Care 1:1000. Art. 62008

• ensuresimprovedflowpropertiesofalldieselfuels• winter safe down to -28°C• reliablypreventsfromformationofparaffincrystalsatlowtemperatures• ensuresoptimaloperationofallsystemcomponentsandsafedrivingconditions• improvesthefilterabilityofthedieselfuel• preventsblockingofthefuelfilter• ensuresimprovedcoldstartpropertiesinthewinterperiod

Page 26: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

•worksduringoperation• use on demand•easyapplicationwithoutanyextrawork

• 150 ml for 80 l Diesel• 50 ml for 25 l

all diesel engines (e.g.commonrailorpumpinjectors)

24 x 150 ml

Cetane Booster. Art. 62033

• forimprovedcombustibilityofthefuel•increasesthecetanenumberofthedieselfuelbyupto5points• especially recommended for lower quality fuels•forpowerfulandcleancombustionandimprovedengineperformance• less exhaust gas and soot emissions•improvedcoldstartingpropertiesandsmootherenginerunning•reducesfuelconsumption

•worksduringoperation•addbeforeeveryfillingofthefueltank

• 150 ml for 80 l Diesel• 50 ml for 25 l

all diesel engines (e.g.commonrailorpumpinjectors)

24 x 150 ml

Diesel Anti Smoke. Art. 62094

•eliminatesdisturbingnoisesindieselenginesandreducescarbonformation• ensurescleancombustion• providesoptimumlubricationofallmovingpartsinthedieselsystem• protectsreliablyagainstcorrosion• reducedformationofsoot

26 diesel system.

Page 27: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

27diesel system.

•worksduringoperation•addtothefueltankbeforefillingupapprox.every5000km•easyapplicationwithoutanyextrawork

• 300 ml for 60 L diesel•0,5%ofthefillingcontent

alldieselparticulatefilters

24 x 300 ml

DPF Purifier. Art. 62009

• high-performanceadditivetoreducesootformation• reductionofexhaustgasemissions• increased engine performance• compatiblewithalldieselengines• foroptimaloperationofallsystemcomponentsandefficientengineperformance• supportstheregenerationofthedieselparticulatefilter• improvesthestoragestabilityofthedieselfuel• increasedcoldstartproperties

•reactiontimeapprox.8-10hours• on demand

•dependingonfiltersize 3-5 L

alldieselparticulatefilters

12 x 1000 ml

DPF Cleaning Liquid. Art. 62010

• highlyefficientcleaningcombination• forcleaningofdismantleddieselparticulatefilters• dissolvescontaminationinthedieselparticulatefilterand regeneratesitsfullfunctionality• forcleancombustionandefficientengineperformance• minimizesexhaustemissions• clearcostbenefitcomparedtoinstallationofanewdieselparticulatefilter

Product m

ovie on YouTube

Page 28: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

28

•worksduringoperation•recommendedforpreventiveuse

min. 500 ml

alldieselparticulatefilters

1 Piece

DPF Air Jet Fluid. Art. 62030

• for use with compressed-air pistole• dissolvescontaminationintheDPFandregeneratesitsfunctionality• highlyefficientcleaningfluid• dissolvesalloperationallycausedresiduesandcontamination• readilybiodegradable• providesaclearcostbenefitcomparedtoinstallationofanewdieselparticulatefilter

technical device. bestresultswithGATAir-Jetcompressed-airpistole

DPF Air Jet compressed-air pistole. Art. 62901

•Noneedtodismantlethedieselparticulatefilter• easy to use•quickandeffectiveapplicationwithoutlongexposuretime • gentle cleaning process•incl.detailedinstructionmanual

diesel system.

• for use with compressed-air pistole

• approx. 500 ml per cleaning• depending on the degree ofcontamination

alldieselparticulatefilters

12 x 1000 ml

Product m

ovie on YouTube

Product m

ovie on YouTube

Page 29: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

G AT DPF S ta r te r-K i t .

content.1 x GAT DPF Air Jet - compressed air gun2 x GAT DPF Air Jet Fluid2xGATDPFPurifier

Art. 62950

Product m

ovie on YouTube

• approx. 15 minutes•ondemandorwitheachserviceaspreventiveuse

400mlfor1application

alldieselparticulatefilters

12 x 400 ml

DPF & Catalyst Cleaning Foam. Art. 62099

• effectivecleanerforfastandefficientcleaningofthedieselparticulatefilterand catalyst of passenger cars without dismantling• impuritiesinthedieselparticulatefilteraredissolvedquicklyespeciallyvehiclesdriving shortdistancesareoftenconcernedbycloggedparticulatefilters(citydriving)• preventiveuseoftheproductwitheachservicecanhelptoavoidfutureproblemswiththe particulatefilterandwillthereforesignificantlyreduceoperatingcost• dissolvessootindieselparticulatefilter,catalystandEGR-valves• reducesoperatingcostsandensuresoptimumengineperformanceandlowerfuelconsumption

Page 30: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

30 LPG system.

LPG

syst

em.

Only a clean fuel system guarantees clean and powerful combustion and efficient engineperformance!Optimizesthefuelconsumptionandexhaustgasemissionvalues.Improvestheoperationalliabilityandincreasesthelifespanoftheengine.Protectsagainstvalveimpact.

GAT SOLUTIONS:

LPG Petrol System Cleaner 31LPG System Clean & Protect 31LPG Valve Protect 32

CAUSE OF FAILURE +++oxidation+++aging+++resindeposits++++++carbonresidues+++waterinfuel+++alcohols++++++contamination+++combustionresidues+++fuelquality++++++operatingconditions+++varnishresidues+++

Page 31: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

31

•worksduringoperation•addwiththesuitableadapterevery3-4monthsorevery10.000km tothegastankbeforefillingup

• 120 ml for 50 L fuel• 60 ml per 25 L

allbivalent(LPG/petrol)systems

24 x 120 ml

LPG system.

•worksduringoperation•addevery3monthstothefueltankbeforefillingup•easyapplicationwithoutanyextrawork

• 300 ml for 60 L petrol•0,5%ofthefillingcontent

allbivalent(LPG/petrol)systems

24 x 300 ml

LPG Petrol System Cleaner. Art. 62038

• high-performanceproductforliquefiedpetroleumgas(LPG)poweredengines• removesalloperationallycausedcontaminationintheentirecombustionsystem• highlyeffectivelubricatingcomponents• protects valves against wear, tear and corrosion• optimizesthefuelconsumptionandexhaustgasemissionvalues• improvestheoperationalliability• increases the life span of the engine• protects against valve impact

LPG System Clean & Protect. Art. 62040

• high-performance product• protects the complete gas system against corrosion• ensuresoptimalprotectionagainstvalveimpact• absorbsharmfulmoisture• effectivelypreventstheformationofcombustionresidues• long-termprotectionofvalvesandvaleseats• optimizedfuelconsumptionandreducedexhaustgasemission• extends the life span of the engine

Page 32: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

32

•worksduringoperation•Attention:strictlyfollowthecorrespondinginstructions of the manufacturer!

• 50 ml for 50 L fuel• 25 ml per 25 L

Foruseincommerciallyavailableautomaticdispensersforbivalentvehicles(gas/petrolpowered).

12 x 1000 ml

LPG Valve Protect. Art. 62039

• highlyefficientfueladditive• considerablyreduceswearandtearofvalvesandvalveseats• reliablyandlastinglyremovesevensmallestparticlesof contaminationintheentirecombustionsystem• long-termprotection• permanentlubricationofvalves• optimizedfuelconsumptionandreducedexhaustgasemission• protects against valve impact• extends the life span of the engine

Page 33: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

3333

G AT v e r t i s i n g .

Weoffertoourcustomersanextensivemarketingsupport.

•multilinguallabelsandadvertisingmaterials• merchandising / POS• giveaways•customizedprintingmaterials

Scan the codeand see the catalogue

Page 34: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

34 cooling system.

cool

ing

syst

em.

GAT radiator products provide for clean systems and protect against corrosion. The long-termfunctionality of the system fluids is ensured.

GAT SOLUTIONS:

Radiator Purifier 35Radiator Sealant 35

CAUSE OF FAILURE +++ deposits +++ flow +++ +++ heating performance +++ leakage +++ corrosion +++ +++ cooling performance +++ oil contamination

Page 35: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

35cooling system.

• approx. 30 minutes• with every change of the coolant

• 300 ml for up to 10 L• 30 ml for 1 L coolant

all cooling systems

24 x 300 ml

Radiator Purifier. Art. 62012

• containsquick-reactingcomponentsforremovalofoperationally causedcontaminationintheentirecoolingcircuit• dissolves and removes scale• improves the performance of valves, thermostats and water pumps• fortheoperationalliabilityofengines• improvedheatingandcoolingperformance• extends the life span of all aggregates

Radiator Sealant. Art. 62011

• reliablysealscriticalhairlinecracksandsmallleaks• alsoforpreventiveusage• fortheoperationalliabilityofengines• avoids expensive repair works• prevents from loss of cooling liquid• protects against engine damage

• approx. 10 minutes• on demand

• 300 ml for up to 12 L• 25 ml for 1 L coolant

all cooling systems

24 x 300 ml

Product m

ovie on YouTube

Product m

ovie on YouTube

Page 36: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

36 air condition.

air c

ondi

tion.

GATairconditioningproductsensureanhealthyroomclimate,eliminatefungus,bacteriaandunpleasant odours and clean the inner and outer A/C system parts.

GAT SOLUTIONS:

AirCon Cleaner 37AirCon Refresher Spring 37AirCon Refresher Summer 38Fresh´nAIR Fluid 38Fresh´nAIR Device 39

CAUSE OF FAILURE +++ microorganisms +++ +++badodours+++healthrisks+++ +++ allergenes +++ corrosion +++

Page 37: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

37

CAUSE OF FAILURE +++ microorganisms +++ +++badodours+++healthrisks+++ +++ allergenes +++ corrosion +++

allair-conditioningsystems

• approx. 2 minutes• every 6 months

•150mlfor1application

allair-conditioningsystems

12 x 150 ml

air condition.

• approx. 15 minutes• every 6 months

•400mlfor1-2applications 12 x 400 ml

AirCon Cleaner. Art. 62013

•forprofessionalandefficientcleaninganddisinfectionofair-conditioningsystems•killsmicroorganismssuchasbacteriasandfungiquickly• provides clean and fresh air•simpleapplication• gives a pleasant and fresh odour in the vehicle interior•noneedfordismantlingoftheair-conditioningsystem

AirCon Refresher Spring. Art. 62014

• cleans and disinfects A/C systems and the interior of the vehicle• eliminates unpleasant odours• killseffectivelybacteriaandothermicroorganisms• provides clean and fresh air• gives a pleasant “Spring“ odour to the vehicle interior

Product m

ovie on YouTube

Page 38: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

38 air condition.

• approx. 15 minutes• every 6 months

•125mlfor1application

allair-conditioningsystems

24 x 250 ml

Fresh´nAIR Fluid. Art. 62032

• freshens the air of the complete vehicle interior• eliminates malodors• provideslong-lastingfreshandhealthycarcabinclimate• disinfictsthevehicleinterior• applicationinallcommerciallyavailablenebulizerdevices

technical devices. bestresultswithGATFresh´nAIRmachine(Art.62900)

• approx. 2 minutes• every 6 months

•150mlfor1application

allair-conditioningsystems

12 x 150 ml

AirCon Refresher Summer. Art. 62085

• cleansanddisinfectsairconditionandtheinteriorofthevehicle• eliminates unpleasant odours• killseffectivelybacteriaandothermicroorganisms• provides clean and fresh air• gives a pleasant “Summer“ odour to the vehicle interior

Page 39: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

39

• approx. 15 minutes• every 6 months

-

allair-conditioningsystems

1 Piece

Fresh´nAIR Device. Art. 62900

• electronicultrasonicdeviceforatomizing• liquidisdistributedoverthecirculationsystemoftheA/C-sytem• dropletsdonotsticktothesurfaceandwiththatarecompletely spreadintheentireA/Candtheventilationsystemofthevehicle •incl.detailedinstructionmanual

Scan the code and go directly to the manual

Page 40: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

40 sealant.

seal

ant.

The GAT Nano Sealants protect surfaces from contamination, are water-repellent and UV-resistant.Dirtandresiduescanberemovedquicklyandeasily.GATNanoSealantsareresistantto mechanical or chemical influences and have a long-term effect.

GAT PRODUCTS:

Nano Car Glass Sealant 41

Page 41: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

41

all glass surfaces

sealant.

• approx. 30 minutes• every 12 months or 10.000 km

•suitablefor1car(wind-screen,headlights,mirrors) 1 Set

Nano Car Glass Sealant. Art. 62951

• 1 set contains: 75 ml cleaning milk 2 x 15 ml sealant components 3 polishing clothes•easyapplicationforbestresults•withlong-termprotectionagainstdirtandinsects•water-repellentwithlotuseffect•increasedsafetythroughoptimizedvisibility at night and in the rain

Smoothens the surface andsealsfinestpores

Reducesreflectionandimprovesvisibilityduringrainandatnight.

Watersimplyrunsoff,dirtandinsectresiduesdonotsticktothesurfaceandicecanberemovedeasily.

Page 42: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

42 gear box & power steering.

gear

box

&

p

ower

stee

ring.

GAT gear products reduce friction, actively protect against foaming and oxidation and protect all system parts with the help of high-performance additives.

GAT SOLUTIONS:

Automatic Transmission Cleaner 43Automatic Transmission Care & Protect 43Automatic Transmission Cleaning Device 44Power Steering Care & Protect 44

CAUSE OF FAILURE +++abrasion+++ +++ aging +++ oxidation +++ wear and tear +++ +++ noise generation +++

Page 43: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

CAUSE OF FAILURE +++abrasion+++ +++ aging +++ oxidation +++ wear and tear +++ +++ noise generation +++

43gear box & power steering.

• approx. 15 minutes•beforeeveryexchangingofthetransmissionfluid

• 300 ml for up to 8 L•40mlfor1Ltransmissionfluid

allautomaticgearboxes

24 x 300 ml

Automatic Transmission Cleaner. Art. 62023

• highperformancecleanerforautomaticgearboxes• removesoperationallycausedcontaminationanddeposits• protects from corrosion and early wear• ensuressoftshiftingwithdirectresponse• for smooth engine running

technical device. Forbestresultswerecommendapplicationwiththe “AutomaticTransmissionCleaningDevice“(page44)

Automatic Transmission Care & Protect. Art. 62024

• maintains the performance of transmission gear systems• ensuressoftshifting• fordirectresponseandpromptacceleration• supportsthecleaningeffectofthetransmissionfluid• protects from corrosion and early wear• ensures smooth engine running

technical device. Forbestresultswerecommendapplicationwiththe “AutomaticTransmissionCleaningDevice“(page44)

•worksduringoperation•aftereveryexchangingofthetransmissionfluid

• 300 ml for up to 5 L•60mlfor1Ltransmissionfluid

allautomaticgearboxes

24 x 300 ml

Page 44: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

44

Power Steering Care & Protect. Art. 62031

• protects all parts of the power steering system from wear, tear and rust• protectsfromoxidationandfoamformation• noise-reducingeffect• guaranteessafeandsmoothoperation

•worksduringoperation•aftereverychangeofpowersteeringoil

• 100 ml for 2 L• 50 ml for 1 L

powersteeringanddifferentialgearboxes

24 x 100 ml

Automatic Transmission Cleaning Device. • cleaningoftheentireautomatictransmissionsystem• easy, quick and complete change of the gear oil• manyautomaticfunctions• LCD display and individual design for easy use• multilingual• fillingandcleaningofautomatictransmissions• oil temperature gauge and monitoring of the oil pressure • intelligentregulationandcontrolofoilchange• special adapters for cars from: Europe, America and AsiaExclusivedistributionbyGATItalias.r.l.

Products. WerecommenduseofGAT“ATFproducts“(page43)

•exchangeintervalaccordingtomanufacturerspecifications•applicationifnecessary

-

allautomaticgearboxes

1 Piece

gear box & power steering.

Page 45: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

ü Cleaning and maintenance of the entire transmission system: easily and quickly with just one deviceü Oil exchange and level adjustmentü Print out the procedure and the vehicle dataü Monitoring of oil temperatureü Monitoring of oil pressureü Emptyfluidtankwithoutdisassembling

GAT ITALIA S.R.L. offerstheofferstheLAUNCHAutomaticTransmissionCleaningDeviceexclusively for the Italian Market

AT F c l e a n i n g .

45

Page 46: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

TheonlyofficialLAUNCHdistributorthatguaranteestechnical assistance for CAT-501+ providing spare parts when needed.

service products.

serv

ice

prod

ucts

.

Effective combination of active substances for quick and easy application. The GAT serviceproductsareparticularlysuitableforrepairs,installationandmaintenanceworksforvehiclesand industrial applications.

GAT SOLUTIONS:

Brake Cleaner Spray 47Brake Cleaner Liquid 47Throttle Body Cleaner 48MultiLube 48Penetrate Spray 49Silicone Spray 49MoS2 Rust Remover 50Electrical Contact Cleaner 50Silicone Sealing Compound 51

46

CAUSE OF FAILURE +++ aging +++ oxidation +++ corrosion ++++++deposits+++abrasion+++residues+++

Page 47: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

47service products.

-

dependingonapplication

universal

12 x 500 ml

Brake Cleaner. Art. 62015

• acetone-free• basedonaspecialtypeofwhitespirits• forquickandeasycleaningofdrumandwheeldiscbrakes, clutchparts,brakeliningsandblocks• removes oil, dirt and greasy deposits• for cleaning of heavily contaminated machine parts• freeofCFC,HFCaswellasofanycorrosivesubstances• evaporates residue-free

-

dependingonapplication

universal

1 x 5000 ml

Brake Cleaner. Art. 62027

• acetone-free• basedonaspecialtypeofwhitespirits•forquickandeasycleaningofdrumandwheeldiscbrakes, clutchparts,brakeliningsandblocks • removes oil, dirt and greasy deposits • for cleaning of heavily contaminated machine parts•freeofCFC,HFCaswellasofanycorrosivesubstances • evaporates residue-free

Page 48: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

-

dependingonapplication

universal

12 x 500 ml

Throttle Body Cleaner. Art. 62016

• specialcompositionofcleaningagents• alsosuitableforexternalandinternalcleaningofcarburetors• forrepair,assemblyandroutinemaintenanceworks• quickremovalofoperationallycauseddeposits(fuel,oil,grease)intheinletarea, atthethrottlebodyandidlingcontrolvalveswithoutdismantling• lubricationofthecleanedparts• regularcleaningimprovestheenginestartingpropertiesandreduces thefuelconsumption

service products.48

-

dependingonapplication

universal

12 x 400 ml

Multi Lube. Art. 62017

• highlyactivecomponentsforreductionoffriction,wearandtear• water-repellent and displaces moisture• helps to loosen corroded metal parts• lubricatesandeliminatessqueakingnoises• protects against rust and corrosion• reducedtimeandeffortformounting/demounting• perfectlysuitableforlong-termuse• extends the life span of the system components

Page 49: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

-

dependingonapplication

universal

12 x 400 ml

Penetrate Spray. Art. 62086

•throughhigh-intensitycomponentsaquickeffectisachievedparticularly for corroded metal compounds•eventhesmallestcracksandgapsarereachedduetoahighcapillaryeffectandexcellent creepingproperties• lubricatesandpreventsfromrenewedrustingbycorrosion-repellentcomponents• excellent removal support for rusted metal compounds• protectsagainstcorrosionandoxidation,therebypreventingseizureofthreadedconnections• suitabletofacilitateasanaidintheassemblyofpartstothesubsequentdismantling• treats squeaking and creaking sounds

-

dependingonapplication

universal

12 x 400 ml

Silicone Spray. Art. 62087

• especially developed product, oil and fat free• protective,lubricating,partingandcareagentforplastic,wood, rubberaswellasmetalparts• spotfreeandinvisiblelubrication• offersexcellentheatresistance• verygoodadhesionproperties• water-repellent• anti-static• protectsagainstoxidationandcorrosion

49service products.

Page 50: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

-

dependingonapplication

universal

12 x 500 ml

MoS2 Rust Remover. Art. 62095

• containsselectedrawmaterialsforfastandeffectiveresultsatcorrodedmetalcompounds• highcapillaryeffectandgoodcreepingpropertiesensurethateventhesmallest crackscanbereached• anti-corrosionadditivesprovidelong-termprotectionofthemetalparts• perfectlysuitableaslubricant• disassemblyaidforrustedmetalcompounds• loosenscorrodedconnectionssuchasnutsandbolts• infiltratesandpenetratesrust• permanentlubricationofscrewconnections,guidesandalltypesofslidingsurfaces

-

dependingonapplication

universal

12 x 400 ml

Electrical Contact Cleaner. Art. 62088

• specially developed product for cleaning of electrical terminals, switching and plugcontactsandotherelectricalconnections• takes care of thorough cleaning of terminals • controlsoxidationatthevariouscontactpoints• improved contactness• reductionofreoxidationandpollution• reduces the voltage drop and removes oil and grease permanently• removeheavydirtfromthepartstobetreated• stronglyoxidizedcontactsshouldbecleanedmechanically

service products.50

Page 51: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

-

dependingonapplication

engineandbodyconstruction,heatingandplumbing,airconditioningetc.

12 x 200 ml

Silicone Sealing Compound. black Art. 62096 grey Art. 62097

• one component• permanentlyelasticsiliconesealbasedonpolysiloxaneforuseinareasofhightemperature• readytousealternativetoconventionalsolidgasket.• sealsmetalparts(aluminum,castiron,steel,etc.),plastics,glass,ceramicsandwood, oilpans,valvecovers,waterandoilpumps,timingcoverandgear,differentialseals, batteryboxes,headlights,taillights,casings,thermostat,transmissionoilpans,gearbox, driveshaftandaxlecovers,etc.• seals permanently even large gaps• no loss of clamping• UV-resistant• climate resistant• resistanttowater,saltwater,oil,grease,detergent,hydrocarbons,etc.

• theoreticalbasictraining• productpresentation• sales training• practicaltrainingatthevehicle

Ourcustomersandprospectbusinesspartnerscanbenefitfromtheknow-howoftheGATAcadamyin our training centers in Germany and Sweden. Experiencedtrainersteachimportantbasicsforthe successful sale and are ready to assistforanyquestions.

Page 52: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

52

“made in germany“. We have pointedly taken the decision to establish our R&D and production sitein Germany. In the automotive branch aswell as in the chemical industry Germany is worldwide leading. Excellent know-how, strict government controlled rules and regulations as well as highly motivated employees ensure our products’ quality.

world wide web. Within the scope of globalization we arepresent at international exhibitions andsymposiums. We source raw materials and know-howworld-wideviaourtransnationalnetwork.

business concepts. Threedifferentbusinessconceptsofferourpartnerstheirindividualchancetobecomepartof the internationalGATcommunityandwiththattoactivelycreateourcommonprospectivebusinesscooperation.

MADE IN GERMANY

Page 53: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

53

area distributors. Our self-employed Area Distributors areresponsible for distribution of our GATpremium products in their individual sales area.This business concept is the perfect solutionto integrateourGATproducts intoanexistingsales structure.

general importers. Thisbusinessconceptgives theopportunitytoexclusivelydistributeourGATpremiumbrandin a defined sales area. The resulting UniqueSelling Proposition (USP) allows the exclusiveand independent development of the market with our proven GAT premium products.

joint venture. The establishment of a Joint Venture offersour partners to profit from the completeknowhowoftheGATcorporationandwiththattobenefitfromdifferentlevelsoftheGATvaluechain. Our JV partners have the clear advantage oftheircloseconnectiontotheGATGermany.

own brand. Our complete company structure - from the in-housemarketing department through to themanufacturing - ensures premium service also forestablishedbrands.Asabottlingpartnerweproduceyourproductandoffersupportfromthedesignofthelabelstotheready-to-sellproducts.

Page 54: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

54

contract research. Our team of scientists and technicians develops products according to our customers’ individually desired properties and parameters. We support our customers intheprocesstogettheproductscertifiedbyrecognized institutions like TÜV or researchprojects. Our core competences are system cleaners and additives for the automotive branch.We are also contact partner for chemical and technical development of products

beyond these matters, as we appreciateany challenge. We support our customers in developing solutions from the initial product idea up to individual marketing strategies.

Page 55: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

55

product development. With our longtimemarket experience andscientific know-how we ensure a continuousproduct development process. Our focus is set on the improvement in fossil fuel efficiencyby innovative high-performance additives.Reduced fuel consumption, lower exhaustemissions and an increased endurance of the system components are the result of these developments.

research projects. We are participating in research projectsand profit from a network of universities,industry-related research institutes andGovernment Controlled Standards Institutes.We are fully aware that the development of innovationsrequiresnewandunconventionalthinking. We are also enthusiastic aboutcompletelynew ideasbeyondourusualfieldofactivities.

Page 56: fluids. technical creating.German... · 2018. 11. 6. · • protects against corrosion • prevents from deposits in the oil and lubrication system • combats harmful engine acids,

www.facebook.com/gat.germany

GAT - GesellschaftforKraftstoff-und AutomobiltechnologiembH&Co.KGAlt Saale 2 l D-07407Uhlstädt-KirchhaselPhone:+49(0)3672-8244666Fax: +49(0)3672-8244622eMail: [email protected]: www.gat-international.de


Top Related