![Page 1: © 2003 The MathWorks, Inc. MATLAB Applications in Bioinformatics Developing and Deploying Bioinformatics Applications with MATLAB © 2003 The MathWorks,](https://reader036.vdocuments.us/reader036/viewer/2022062308/56649d3f5503460f94a19511/html5/thumbnails/1.jpg)
© 2003 The MathWorks, Inc.
MATLAB Applications in BioinformaticsDeveloping and Deploying Bioinformatics
Applications with MATLAB
© 2
00
3 T
he M
ath
Work
s, Inc.
1
MATLAB for Bioinformatics
Kristen AmuzziniBiotech, Pharmaceutical, & Medical Industry
The MathWorks, Inc.
![Page 2: © 2003 The MathWorks, Inc. MATLAB Applications in Bioinformatics Developing and Deploying Bioinformatics Applications with MATLAB © 2003 The MathWorks,](https://reader036.vdocuments.us/reader036/viewer/2022062308/56649d3f5503460f94a19511/html5/thumbnails/2.jpg)
© 2003 The MathWorks, Inc.
Presentation Layout
MATLAB applications in Bioinformatics Customer success stories MATLAB & The Bioinformatics Toolbox
Sequence analysis Microarray analysis
Integrating MATLAB with other tools MATLAB as computational engine for Excel
Questions/Answers & Wrap-up
![Page 3: © 2003 The MathWorks, Inc. MATLAB Applications in Bioinformatics Developing and Deploying Bioinformatics Applications with MATLAB © 2003 The MathWorks,](https://reader036.vdocuments.us/reader036/viewer/2022062308/56649d3f5503460f94a19511/html5/thumbnails/3.jpg)
© 2003 The MathWorks, Inc.
Bioinformatics Applications
• Sequence analysis• Base calling algorithm design, sequence alignment,
sequence building algorithms
• Microarray analysis• Image processing, QA/QC, data normalization, data analysis
• Proteomics• Mass Spectrometry signal processing, protein marker
identification and classification, peptide sequence identification, 2D-Gel image analysis
• Systems Biology• Interaction network identification, simulation of metabolic
pathways, flux analysis
![Page 4: © 2003 The MathWorks, Inc. MATLAB Applications in Bioinformatics Developing and Deploying Bioinformatics Applications with MATLAB © 2003 The MathWorks,](https://reader036.vdocuments.us/reader036/viewer/2022062308/56649d3f5503460f94a19511/html5/thumbnails/4.jpg)
© 2003 The MathWorks, Inc.
Bioinformatics teams supporting multiple constituencies with multiple tools.
• C/C++, Java, Perl• VB, Excel Macros• SQL• GUI Based tools• Freeware• SPLUS, R, SAS, Mathematica• Web based tools
Research Biologists•Prefer UI/Web based tools
•Want custom analyses
Bioinformatics Team•Algorithm development•Custom one-off analyses •Programs for biologists
Software Engineers•C++, Java•Work off MATLAB prototypes
![Page 5: © 2003 The MathWorks, Inc. MATLAB Applications in Bioinformatics Developing and Deploying Bioinformatics Applications with MATLAB © 2003 The MathWorks,](https://reader036.vdocuments.us/reader036/viewer/2022062308/56649d3f5503460f94a19511/html5/thumbnails/5.jpg)
© 2003 The MathWorks, Inc.
Using MATLAB, bioinformatics teams can support multiple constituencies.
MATLAB GUI’s, analyses
Research Biologists•Prefer UI/Web based tools
•Want custom analyses
Bioinformatics Team•Algorithm development•Custom one-off analyses •Programs for biologists
Software Engineers•C++, Java•Work off MATLAB prototypes
MATLAB prototypes/Applications
![Page 6: © 2003 The MathWorks, Inc. MATLAB Applications in Bioinformatics Developing and Deploying Bioinformatics Applications with MATLAB © 2003 The MathWorks,](https://reader036.vdocuments.us/reader036/viewer/2022062308/56649d3f5503460f94a19511/html5/thumbnails/6.jpg)
© 2003 The MathWorks, Inc.
Complete draft of the human genome, accelerated by Applied Biosystems — using MATLAB algorithms.
“Having one integrated packageis a big advantage. Using MATLAB and theMATLAB Compiler reduced my development time by a factor of 4 or 5.”
“MATLAB has always been ideal as an algorithm prototyping tool,” Labrenz concludes, “but the MATLAB Compiler and C/C++ Math and Graphics Libraries add a whole new dimension, allowing rapid delivery of sophisticated solutions.”
Jim Labrenz, Applied Biosystems
User example: Genetic Sequence Base Calling
![Page 7: © 2003 The MathWorks, Inc. MATLAB Applications in Bioinformatics Developing and Deploying Bioinformatics Applications with MATLAB © 2003 The MathWorks,](https://reader036.vdocuments.us/reader036/viewer/2022062308/56649d3f5503460f94a19511/html5/thumbnails/7.jpg)
© 2003 The MathWorks, Inc.
User example: Breast Cancer Prognosis
Rosetta Inpharmatics recently developed a tool that enables clinicians to determine a breast cancer patient’s prognosis based on the gene expression profile of the primary tumor.
“Since MATLAB and the Image Processing Toolbox are fully integrated and the MATLAB platform is very good for matrix calculation, we did not have to spend time writing the low level image processing and the basic data analysis routines like vector and matrix calculations”
“Our research scientists are happy with the quick feedback,” Dr. Dai says. “Using MathWorks tools, we can respond to their requests very fast, and it’s easy for the scientists to use these tools. Using the GUIs that we develop in MATLAB, they can access functions without having to remember the underlying code.”
Dr. Hongyue Dai,Rosetta Inpharmatics/Merck & Company
![Page 8: © 2003 The MathWorks, Inc. MATLAB Applications in Bioinformatics Developing and Deploying Bioinformatics Applications with MATLAB © 2003 The MathWorks,](https://reader036.vdocuments.us/reader036/viewer/2022062308/56649d3f5503460f94a19511/html5/thumbnails/8.jpg)
© 2003 The MathWorks, Inc.
Academic users
• Bioinformatics Teaching• MIT, Stanford, Cornell, Carnegie Mellon, …
• Research• Sequencing
• Base calling algorithm design• Sequence analysis
• Computational biolinguistics • Microarray analysis
• Statistical modeling of microarrays• Proteomics
• Statistical modeling of protein-protein interaction• Systems Biology
• Flux Analysis
![Page 9: © 2003 The MathWorks, Inc. MATLAB Applications in Bioinformatics Developing and Deploying Bioinformatics Applications with MATLAB © 2003 The MathWorks,](https://reader036.vdocuments.us/reader036/viewer/2022062308/56649d3f5503460f94a19511/html5/thumbnails/9.jpg)
© 2003 The MathWorks, Inc.
More than 600 textbooks for education and professional use, in 19 languages
– Biosciences
– Controls
– Signal Processing
– Image Processing
– Mechanical Engineering– Mathematics– Natural Sciences– Environmental Sciences
Thousands of universities teach students using MathWorks products.
![Page 10: © 2003 The MathWorks, Inc. MATLAB Applications in Bioinformatics Developing and Deploying Bioinformatics Applications with MATLAB © 2003 The MathWorks,](https://reader036.vdocuments.us/reader036/viewer/2022062308/56649d3f5503460f94a19511/html5/thumbnails/10.jpg)
© 2003 The MathWorks, Inc.
Industry Issues & Solutions
•Integrating tools from various programming languages is difficult, closed source tools are not customizable, and freeware is often not supported.
•There is no standard biological data format.
•Applications must be easily deployable within organizations.
•MATLAB is a supported, open architecture, user-friendly environment for data analysis across applications, algorithm development, and deployment.
•MATLAB and the Bioinformatics Toolbox provides file format support for common data sources (web-based, sequences, microarray, etc.).
•MATLAB’s deployment tools and user-interface design environment allow easy deployment of MATLAB based applications.
![Page 11: © 2003 The MathWorks, Inc. MATLAB Applications in Bioinformatics Developing and Deploying Bioinformatics Applications with MATLAB © 2003 The MathWorks,](https://reader036.vdocuments.us/reader036/viewer/2022062308/56649d3f5503460f94a19511/html5/thumbnails/11.jpg)
© 2003 The MathWorks, Inc.
The Bioinformatics Toolbox
Robert Henson
The MathWorks, Inc.
Developing and Deploying Bioinformatics Applications with MATLAB
© 2
00
3 T
he M
ath
Work
s, Inc.
11
MATLAB & The Bioinformatics Toolbox
![Page 12: © 2003 The MathWorks, Inc. MATLAB Applications in Bioinformatics Developing and Deploying Bioinformatics Applications with MATLAB © 2003 The MathWorks,](https://reader036.vdocuments.us/reader036/viewer/2022062308/56649d3f5503460f94a19511/html5/thumbnails/12.jpg)
© 2003 The MathWorks, Inc.
The MathWorks Product Family
Code Generation
Blocksets
Integrated for: technical computing, data analysis and visualization system modeling and simulation implementation of real-time embedded software
PC-based real-time systems
StateflowStateflowStateflowToolboxes
DAQ cardsInstruments
Databases and filesFinancial Datafeeds
Desktop ApplicationsAutomated Reports
![Page 13: © 2003 The MathWorks, Inc. MATLAB Applications in Bioinformatics Developing and Deploying Bioinformatics Applications with MATLAB © 2003 The MathWorks,](https://reader036.vdocuments.us/reader036/viewer/2022062308/56649d3f5503460f94a19511/html5/thumbnails/13.jpg)
© 2003 The MathWorks, Inc.
• File I/O
• FASTA, PDB, SCF, GPR, GAL
• Web Connectivity
• GenBank, EMBL, PIR, PDB
• Sequence Analysis & Alignment
• Needleman-Wunsch, Smith-Waterman
• DNA/RNA/AA conversions, pattern searching
• Microarray Normalization & Visualization
• Lowess, global mean, MAD (median absolute deviation)
• Protein Visualization
• Atomic composition, molecular weight, hydrophobicity profile
Bioinformatics Toolbox 1.0
212 PYESFTFPELMRKGSYNPVTHIYTAQDVKEVIEYARLRGIR | | | : | | | : | : | : : : | : | | | : | | | : | : : | : :
321 PYISRYYPELAVHGAYSE -SETYSEQDVREVAEFAKIYGVQ
![Page 14: © 2003 The MathWorks, Inc. MATLAB Applications in Bioinformatics Developing and Deploying Bioinformatics Applications with MATLAB © 2003 The MathWorks,](https://reader036.vdocuments.us/reader036/viewer/2022062308/56649d3f5503460f94a19511/html5/thumbnails/14.jpg)
© 2003 The MathWorks, Inc.
CommandHistory
MATLAB Desktop Tools
Launchpad:Start other tools and
demos
WorkspaceBrowser:
See your data
Command Window
![Page 15: © 2003 The MathWorks, Inc. MATLAB Applications in Bioinformatics Developing and Deploying Bioinformatics Applications with MATLAB © 2003 The MathWorks,](https://reader036.vdocuments.us/reader036/viewer/2022062308/56649d3f5503460f94a19511/html5/thumbnails/15.jpg)
© 2003 The MathWorks, Inc.
Sequence Alignment Tutorial Example
• Get human and mouse genes from GenBank• Look for open reading frames (ORFs)• Convert DNA sequences to amino acid sequences• Create a dotplot of the two sequences• Perform global alignment• Perform local alignment
![Page 16: © 2003 The MathWorks, Inc. MATLAB Applications in Bioinformatics Developing and Deploying Bioinformatics Applications with MATLAB © 2003 The MathWorks,](https://reader036.vdocuments.us/reader036/viewer/2022062308/56649d3f5503460f94a19511/html5/thumbnails/16.jpg)
© 2003 The MathWorks, Inc.
Microarray Data Analysis Tutorial Example
• Plot expression profiles for genes• Filter genes based on information content of profile• Perform hierarchical clustering• Perform K-means clustering• Perform Principal Component Analysis
Reference:
DeRisi, JL, Iyer, VR, Brown, PO. "Exploring the metabolic and genetic control of gene expression on a genomic scale." Science. 1997 Oct 24;278(5338):680-6.
![Page 17: © 2003 The MathWorks, Inc. MATLAB Applications in Bioinformatics Developing and Deploying Bioinformatics Applications with MATLAB © 2003 The MathWorks,](https://reader036.vdocuments.us/reader036/viewer/2022062308/56649d3f5503460f94a19511/html5/thumbnails/17.jpg)
© 2003 The MathWorks, Inc.
Integrating and Deploying Bioinformatics Tools with MATLAB
Robert Henson
The MathWorks, Inc.
Developing and Deploying Bioinformatics Applications with MATLAB
© 2
00
3 T
he M
ath
Work
s, Inc.
17
Integrating and Deploying Bioinformatics Tools with MATLAB
![Page 18: © 2003 The MathWorks, Inc. MATLAB Applications in Bioinformatics Developing and Deploying Bioinformatics Applications with MATLAB © 2003 The MathWorks,](https://reader036.vdocuments.us/reader036/viewer/2022062308/56649d3f5503460f94a19511/html5/thumbnails/18.jpg)
© 2003 The MathWorks, Inc.
Connecting to MATLAB
WebWeb
Instrument ControlInstrument ControlData AcquisitionData AcquisitionImage AcquisitionImage Acquisition
Excel / COM
File I/O
Database Database ToolboxToolbox
C/C++Java Perl
![Page 19: © 2003 The MathWorks, Inc. MATLAB Applications in Bioinformatics Developing and Deploying Bioinformatics Applications with MATLAB © 2003 The MathWorks,](https://reader036.vdocuments.us/reader036/viewer/2022062308/56649d3f5503460f94a19511/html5/thumbnails/19.jpg)
© 2003 The MathWorks, Inc.
C/C++ C/C++
WebWebStand-aloneStand-alone
ExcelCOM
Deploying with MATLAB
![Page 20: © 2003 The MathWorks, Inc. MATLAB Applications in Bioinformatics Developing and Deploying Bioinformatics Applications with MATLAB © 2003 The MathWorks,](https://reader036.vdocuments.us/reader036/viewer/2022062308/56649d3f5503460f94a19511/html5/thumbnails/20.jpg)
© 2003 The MathWorks, Inc.
Push Data into MATLAB
Data I/O• Import Excel ranges
into MATLAB• Export MATLAB data into
Excel ranges• Evaluate MATLAB Statements in
Excel
![Page 21: © 2003 The MathWorks, Inc. MATLAB Applications in Bioinformatics Developing and Deploying Bioinformatics Applications with MATLAB © 2003 The MathWorks,](https://reader036.vdocuments.us/reader036/viewer/2022062308/56649d3f5503460f94a19511/html5/thumbnails/21.jpg)
© 2003 The MathWorks, Inc.
Computational Engine for Excel
Spread Sheet Applications
• MATLAB Excel Link can be the computational engine behind your Excel applications
• Fast scalable solutionMLPutMatrix("data",B2:H43)
MLPutMatrix("Genes",A2:A43)
MLPutMatrix("TimeSteps",B1:H1)
MLEvalString("clustergram(data,'RowLabels',…
Genes,'ColLabels',TimeSteps)")
![Page 22: © 2003 The MathWorks, Inc. MATLAB Applications in Bioinformatics Developing and Deploying Bioinformatics Applications with MATLAB © 2003 The MathWorks,](https://reader036.vdocuments.us/reader036/viewer/2022062308/56649d3f5503460f94a19511/html5/thumbnails/22.jpg)
© 2003 The MathWorks, Inc.
Image ProcessingSignal Processing
Neural Networks OptimizationStatistics
What else could you do?
Bioinformatics
![Page 23: © 2003 The MathWorks, Inc. MATLAB Applications in Bioinformatics Developing and Deploying Bioinformatics Applications with MATLAB © 2003 The MathWorks,](https://reader036.vdocuments.us/reader036/viewer/2022062308/56649d3f5503460f94a19511/html5/thumbnails/23.jpg)
© 2003 The MathWorks, Inc.
Integrating and Deploying Bioinformatics Tools with MATLAB
Robert Henson
The MathWorks, Inc.
Developing and Deploying Bioinformatics Applications with MATLAB
© 2
00
3 T
he M
ath
Work
s, Inc.
23
Summary
![Page 24: © 2003 The MathWorks, Inc. MATLAB Applications in Bioinformatics Developing and Deploying Bioinformatics Applications with MATLAB © 2003 The MathWorks,](https://reader036.vdocuments.us/reader036/viewer/2022062308/56649d3f5503460f94a19511/html5/thumbnails/24.jpg)
© 2003 The MathWorks, Inc.
Industry Issues & Solutions
•Integrating tools from various programming languages is difficult, closed source tools are not customizable, and freeware is often not supported.
•There is no standard biological data format.
•Applications must be easily deployable within organizations.
•MATLAB is a supported, open architecture, user-friendly environment for data analysis across applications, algorithm development, and deployment.
•MATLAB and the Bioinformatics Toolbox provides file format support for common data sources (web-based, sequences, microarray, etc.).
•MATLAB’s deployment tools and user-interface design environment allow easy deployment of MATLAB based applications.
![Page 25: © 2003 The MathWorks, Inc. MATLAB Applications in Bioinformatics Developing and Deploying Bioinformatics Applications with MATLAB © 2003 The MathWorks,](https://reader036.vdocuments.us/reader036/viewer/2022062308/56649d3f5503460f94a19511/html5/thumbnails/25.jpg)
© 2003 The MathWorks, Inc.
Further Information
• Bioinformatics Toolbox Product page–Demos, technical literature, trial information–www.mathworks.com/products/bioinfo
• MATLAB Central– File exchange and newsgroup access for MATLAB and
Simulink users– www.mathworks.com/matlabcentral– Access to comp.soft-sys.matlab
file exchange and newsgroup access forthe MATLAB & Simulink user community