clitocypin, a new type of cysteine proteinase … · the protein sample was introduced at a flow...
TRANSCRIPT
![Page 1: CLITOCYPIN, A NEW TYPE OF CYSTEINE PROTEINASE … · The protein sample was introduced at a flow rate of 10 µmol/min using a syringe pump. Spectra were obtained by scanning from](https://reader030.vdocuments.us/reader030/viewer/2022041204/5d53971888c993a7588bd116/html5/thumbnails/1.jpg)
1
CLITOCYPIN, A NEW TYPE OF CYSTEINE PROTEINASE INHIBITOR FROM
FRUIT BODIES OF MUSHROOM Clitocybe nebularis *
Jože Brzin“¶**, Boris Rogelj“¶, Tatjana Popovič¶, Borut Štrukelj+¶, and Anka
Ritonja¶
From the ¶Department of Biochemistry and Molecular Biology, Jožef Stefan Institute,
Jamova 39, 1000 Ljubljana, Slovenia and +Department of Pharmaceutical Biology, Faculty
of Pharmacy, University of Ljubljana, Aškerčeva 7, 1000 Ljubljana, Slovenia
by guest on August 13, 2019
http://ww
w.jbc.org/
Dow
nloaded from
![Page 2: CLITOCYPIN, A NEW TYPE OF CYSTEINE PROTEINASE … · The protein sample was introduced at a flow rate of 10 µmol/min using a syringe pump. Spectra were obtained by scanning from](https://reader030.vdocuments.us/reader030/viewer/2022041204/5d53971888c993a7588bd116/html5/thumbnails/2.jpg)
2
Running title:
A novel inhibitor of cysteine proteinases from mushroom
by guest on August 13, 2019
http://ww
w.jbc.org/
Dow
nloaded from
![Page 3: CLITOCYPIN, A NEW TYPE OF CYSTEINE PROTEINASE … · The protein sample was introduced at a flow rate of 10 µmol/min using a syringe pump. Spectra were obtained by scanning from](https://reader030.vdocuments.us/reader030/viewer/2022041204/5d53971888c993a7588bd116/html5/thumbnails/3.jpg)
3
SUMMARY
A novel inhibitor of cysteine proteinases has been isolated from fruit bodies of a
mushroom Clitocybe nebularis. The inhibitor was purified to homogeneity by affinity
chromatography and gel filtration, followed by reverse-phase HPLC. The active inhibitor has
an apparent molecular mass of about 34 kDa by gel filtration and by SDS-PAGE without
prior boiling of the sample. Boiling in 2.5 % SDS or incubation in 6M GdmHCl resulted in a
single band of 17 kDa, indicating homodimer composition with no intersubunit disulphide
bonds. The inhibitor in nondenaturing buffer is resistant to boiling in water, retaining its
activity and dimer composition. The mushroom protein is a tight-binding inhibitor of papain
(Ki = 0.59 nM), cathepsin L (Ki = 0.41 nM), cathepsin B (Ki = 0.48 µM) and bromelain (Ki =
0.16 µM), but is inactive towards cathepsin H, trypsin and pepsin. Its isoelectric point is 4.4,
and sugar analysis indicates the absence of carbohydrate. A single protein sequence of 150
amino acids, containing no cysteine or methionine residues, was obtained by amino acid
sequencing. The calculated molecular mass of 16854 Da corresponds well with the value
obtained by mass spectrometry. A major part of this sequence was verified by molecular
cloning. The monomer sequence is clearly devoid of typical cystatin structure elements, and
has no similarity to any other known cysteine proteinase inhibitors, but bears some similarity
to a lectin-like family of proteins from mushrooms. The inhibitor, which is present in at least
two other members of Clitocybe genus, has been named clitocypin (Clitocybe cysteine
proteinase inhibitor).
by guest on August 13, 2019
http://ww
w.jbc.org/
Dow
nloaded from
![Page 4: CLITOCYPIN, A NEW TYPE OF CYSTEINE PROTEINASE … · The protein sample was introduced at a flow rate of 10 µmol/min using a syringe pump. Spectra were obtained by scanning from](https://reader030.vdocuments.us/reader030/viewer/2022041204/5d53971888c993a7588bd116/html5/thumbnails/4.jpg)
4
INTRODUCTION
Cysteine proteinases are involved in a diverse array of functions involving specific
processing or more general degradation of proteins in a wide variety of organisms, including
viruses, fungi, plants and animals. Their activity is regulated by limited proteolysis of
inactive precursors (1, 2), by pH and redox potential of the surroundings, and tight binding
with proteinaceous inhibitors (3).
Five structurally different groups of protein cysteine proteinase inhibitors have been
reported: cystatins (4), thyroglobulin type-1 domain inhibitors or thyropins (5), soybean
trypsin inhibitor-like inhibitors of cysteine proteinases from potato (6), pineapple inhibitors
of cysteine proteinases (7, 8) and very recently, inhibitors of cysteine proteinases homologous
to propeptide regions of cysteine proteinases (9). So far only the mechanism of interaction of
the cystatin superfamily of inhibitors has been elucidated (10, 11), followed recently by that
of thyropins (12), but overall there is very little information available on all other cysteine
proteinase inhibitors concerning specificity, kinetics and mode of binding.
Since cysteine proteinases in mammals have been implicated also in many
pathological events, such as tumor invasion and metastasising cancer (13), bone resorbtion
(14), periodontitis (15) and rheumatoid arthritis (16), there is a need for new specific,
efficient and accessible inhibitors of the enzymes responsible for diagnosis and treatment of
these conditions. Fungi (Mycophyta) have been used for religious, medical, and other
purposes since ancient times. To our knowledge no protein cysteine proteinase inhibitors
have been characterised in higher fungi (Basydiomyceta), popularly called mushrooms. We
report here the identification, some properties and cloning of a new proteinaceous cysteine
proteinase inhibitor from Clitocybe nebularis fruit bodies, which we have called clitocypin, a
member of what is very likely a new structural superfamily of cysteine proteinase inhibitors.
by guest on August 13, 2019
http://ww
w.jbc.org/
Dow
nloaded from
![Page 5: CLITOCYPIN, A NEW TYPE OF CYSTEINE PROTEINASE … · The protein sample was introduced at a flow rate of 10 µmol/min using a syringe pump. Spectra were obtained by scanning from](https://reader030.vdocuments.us/reader030/viewer/2022041204/5d53971888c993a7588bd116/html5/thumbnails/5.jpg)
5
EXPERIMENTAL PROCEDURES
Fungal material Edible mushrooms, Clitocybe nebularis were collected in their
natural habitat in forest in November, and frozen at –20°C or –70°C until use. A specimen is
deposited at the Department of Pharmaceutical Biology, Faculty of Pharmacy, Ljubljana.
Chemicals and Enzymes Iodoacetate, Bz-Arg-NA1 were from Sigma (Germany),
CNBr-activated Sepharose 4B, Sephacryl S-200 were from Amersham Pharmacia Biotech
(Sweden). Z-Phe-Arg-MCA and Z-Arg-Arg-MCA were from Bachem (Switzerland). Ep-475
was purchased from Peptide Research Foundation (Japan).
Stem bromelain (EC 3.4.22.32), bovine trypsin (EC 3.4.21.4) and porcine pepsin
(3.4.23.1) were from Sigma (Germany). Papain (EC 3.4.22.2) 2x crystallised, also from
Sigma, was additionally purified by affinity chromatography (17). Glycyl endopeptidase (EC
3.4.22.25) was a gift from Dr. Alan J. Barrett (The Babraham Institute, Cambridge, UK) and
was prepared as described (18). Endoproteinase Lys-C (EC 3.4.21.50) was from Boehringer
Mannheim (Germany). β-trypsin (EC 3.4.21.4) was prepared from type IX trypsin (Sigma) as
described (19). Cathepsin B (EC 3.4.22.1), cathepsin H (EC 3.4.22.16) and cathepsin L (EC
3.4.22.15) were purified from human kidney by the method already described (20).
Inhibitor purification Frozen fruit bodies of Clitocybe nebularis (500 g fresh
weight) were homogenised in 1000 ml of Tris/HCl buffer, pH 7.5, containing 0.5 M NaCl
(Buffer A). The homogenate was centrifuged at 8000 x g, for 30 min. The supernatant was
applied in aliquots of 300 ml to a column of CM-papain Sepharose (2.5 x 15 cm) prepared
according to manufacturer’s instructions, carboxymethylated as described in (21) and
equilibrated with Buffer A. Bound inhibitory fractions were eluted with 0.01 M NaOH,
pooled, neutralised with dilute HCl, concentrated on an Amicon UM-10 membrane and
chromatographed on a Sephacryl S-200 column (4 x 110 cm) washed with buffer A. For the
by guest on August 13, 2019
http://ww
w.jbc.org/
Dow
nloaded from
![Page 6: CLITOCYPIN, A NEW TYPE OF CYSTEINE PROTEINASE … · The protein sample was introduced at a flow rate of 10 µmol/min using a syringe pump. Spectra were obtained by scanning from](https://reader030.vdocuments.us/reader030/viewer/2022041204/5d53971888c993a7588bd116/html5/thumbnails/6.jpg)
6
purpose of amino acid composition and sequence analysis the inhibitor was additionally
purified on a reverse-phase HPLC (Milton Roy LCD, UK) on a Vydac C8 column (Alltech
4.6 x 250 mm), using a gradient of 0-80 % (v/v) acetonitrile in water containing 0.1 % (v/v)
of trifluoroacetic acid, over 25 min.
Isolation of RNA, RT-PCR and sequencing of the cDNA clone Total RNA was
isolated from the fungal material stored at -70°C according to the method of Puissant and
Houdebine (22). The quality of the RNA was checked by electrophoresis in a
formaldehyde/formamide system (23) followed by the downward alkaline transfer procedure
of Chomczynski (24). The RNA was transferred to Hybond-N nylon membranes and dyed
with 0.04 % methylene blue. Degenerate primers were constructed with a linker restriction
site on the 5’ end. Forward primer CnF (5’GCGAATTCCCIGGIGTIGGIGGIGARTAYGC)
was constructed from the Pro18-Ala25 region of the protein sequence with the EcoRI
restriction site on the 5’ end and the reverse primer CnR
(5’CGGGATCCTGICKYTCRAAICKCCAIGCNGG) was constructed from the Pro142-
Arg148 region of the protein sequence with BamHI restriction site on its 5’ end. Both primers
contained inosine (I) in the place of 4-nucleotide degeneration. Reverse transcription was
performed in a reaction-mix containing 1 x PCR buffer II, 5 mM MgCl2, 1 mM of each
dNTP, 1 U/µl RNasin, 0.5 µg of CnR primer, and 2.5 U/µl of MuLV reverse transcriptase.
The reaction mixture was incubated for 10 min at 23°C, 15 min at 42°C and 5 min at 99°C.
30 cycles of PCR were performed by adding 1 x PCR buffer II, 5 mM MgCl2, 0.83 µg CnF
primer, 0.33 µg CnR primer, and 2.5 U AmpliTaq DNA polymerase (Perkin Elmer, USA) to
the final volume of 100 µl. After electrophoresis on 1.7 % agarose gel a band at about 400 bp
was excised, inserted into EcoRI/BamHI digested pUC19, and sequenced using the
Pharmacia T7 sequencing kit following the appropriate manufacturer’s protocol.
by guest on August 13, 2019
http://ww
w.jbc.org/
Dow
nloaded from
![Page 7: CLITOCYPIN, A NEW TYPE OF CYSTEINE PROTEINASE … · The protein sample was introduced at a flow rate of 10 µmol/min using a syringe pump. Spectra were obtained by scanning from](https://reader030.vdocuments.us/reader030/viewer/2022041204/5d53971888c993a7588bd116/html5/thumbnails/7.jpg)
7
Protein and Sugar Determination Protein concentration of the purified inhibitor
was determined by absorbance at 280 nm using a Perkin Elmer UV/VIS Spectrometer
Lambda 18. A molar absorbance coefficient of 22900 M-1cm-1 was calculated from the amino
acid sequence (25).
Clitocypin was assayed for potential glycosylation with incubation with N-
glycosidase F (Boehringer Mannheim), according to the manufacturer′s instructions. The
reaction was incubated overnight at 37°C and the products followed by SDS-PAGE. The
inhibitor was also tested with a phenol-sulfuric acid assay for hexoses and pentoses as
described (26).
SDS-PAGE Pharmacia Phast System unit and 8 – 25 % gradient gels were used,
following the instructions of the manufacturer. Samples were prepared by mixing with equal
volumes of 80 mM Tris/HCl buffer, pH 8.0, containing 5 % SDS and were applied to the gel
with or without previous boiling at 100oC for 5 min. For sample reduction, 2-
mercaptoethanol in final concentration of 5 % (v/v) was included in the mixture before
boiling. Molecular masses were determined using LMW markers of 14.4 - 94 kDa
(Pharmacia). Gels were stained with 0.1 % (w/v) Coomassie Briliant Blue R 250.
Isoelectric focusing Samples were run on a Pharmacia Phast System using
commercial precast pH 3-9 gradient gels following instructions provided. pI values were
determined using the Pharmacia broad-pI calibration kit (pI range 3.65 - 9.30)
Electrospray-Ionisation Mass Spectrometry HPLC purified protein was dissolved
in water/methanol 1 : 1 (v/v) solution containing 1 % acetic acid and analysed on a high
resolution magnetic sector Autopsied Q mass spectrometer (Micromass, Manchester, UK).
The protein sample was introduced at a flow rate of 10 µmol/min using a syringe pump.
Spectra were obtained by scanning from mass/charge ratio of 2000 to 400 at 10 s/scan.
Sodium iodide ions were used for calibration. Each molecular species produced a series of
by guest on August 13, 2019
http://ww
w.jbc.org/
Dow
nloaded from
![Page 8: CLITOCYPIN, A NEW TYPE OF CYSTEINE PROTEINASE … · The protein sample was introduced at a flow rate of 10 µmol/min using a syringe pump. Spectra were obtained by scanning from](https://reader030.vdocuments.us/reader030/viewer/2022041204/5d53971888c993a7588bd116/html5/thumbnails/8.jpg)
8
multiply charged protonated ions from which the molecular mass was determined by simple
calculation.
Protein Sequence Analysis Chemical cleavage of 100 pmol of the inhibitor was
performed by boiling it in 0.1 % (v/v) TFA for 20 min. For enzymatic cleavages 350 pmol of
native inhibitor was dissolved in 0.1 M phosphate buffer, pH 6.5, and 6 M GdmHCl and
incubated for 48 h at 37°C. After removal of GdmHCl by HPLC, 100 pmol of sample was
first fragmented using 2 % (w/w) glycyl endopeptidase as described (6). Hydrolysis of 100
pmol of sample by β-trypsin was carried out at 37oC in 0.5 M N-methyl morpholine, pH 8.2,
for 30 min at an enzyme to substrate ratio of 1 : 100 (w/w). Endoproteinase Lys-C at an
enzyme to substrate molar ratio of 1 : 30 was used for proteolytic digestion of 100 pmol of
the inhibitor for 10 h at room temperature in 0.3 M Tris buffer, pH 8.6, containing 0.1 mM
CaCl2 and 5 M urea. All three enzyme hydrolyses were performed in a final volume of 200
µl. Reactions were stopped by the addition of trifluoroacetic acid. The peptide mixtures
obtained were separated by HPLC (Milton Roy Co.) using a reverse phase Vydac C18
column equilibrated with 0.1 % (v/v) trifluoroacetic acid and eluted with a linear gradient of
acetonitrile from 0-80 % in 0.1 % aqueous trifluoroacetic acid over 60 min. The absorbance
of the eluant was monitored at 215 nm. Amino acid composition was determined by
hydrolysis of samples in 6.0 M HCl at 110oC for 24 h and analysis of the obtained
hydrolysates on an Applied Biosystems 421 amino acid analyser with precolumn PTH
derivatisation. Automated Edman degradation and sequence analysis was carried out on an
Applied Biosystems liquid pulse sequencer 475 A connected on line to a model 120 A PTH
analyser from the same manufacturer. For sequence comparison of clitocypin with other
known protein sequences, databases were searched with ExPASy protein sequence similarity
search using the BLAST algorithm (27) and SAMBA (28).
by guest on August 13, 2019
http://ww
w.jbc.org/
Dow
nloaded from
![Page 9: CLITOCYPIN, A NEW TYPE OF CYSTEINE PROTEINASE … · The protein sample was introduced at a flow rate of 10 µmol/min using a syringe pump. Spectra were obtained by scanning from](https://reader030.vdocuments.us/reader030/viewer/2022041204/5d53971888c993a7588bd116/html5/thumbnails/9.jpg)
9
Inhibitor Assay The inhibitory activities of samples and fractions during the
isolation procedure were measured against papain. A sample of 100 µl was added to 0.05 µM
papain in 0.85 ml buffer solution (0.1 M sodium phosphate, pH 6.5, containing 5 mM
cysteine and 1.5 mM EDTA). After 10 min of preincubation at room temperature the reaction
was initiated by the addition of 25 µl of 0.1 M substrate Bz-Arg-NA in DMSO and the
mixture was incubated for 10 min at 37°C. The reaction was stopped and A520 read, following
the procedure of Barrett (29).
Active Site Titrations Active concentrations of cathepsins B, L and papain were
determined by titration with Ep-475 (30). Residual activities were determined with Bz-Arg-
NA as substrate for cathepsin B and papain (29) or with Z-Phe-Arg-MCA as substrate for
cathepsin L (30). The active concentration of clitocypin was determined by the same method
using previously active-site titrated papain. All concentrations stated below refer to active
concentrations.
Determination of inhibition constants Inhibition kinetics of papain and cathepsin L
were studied under pseudo-first-order conditions with at least a 10-fold molar excess of
inhibitor over enzyme and in the presence of substrate (31) in continuous kinetic assays
followed by a Perkin Elmer LS50B fluorimeter, connected to an IBM personal computer,
running Flusys software (32). Various amounts of the inhibitor in the final concentration
range of 2.5 nM to 50 nM were mixed with 10 µM Z-Phe-Arg-MCA as substrate in the assay
buffer in a final volume of 2 ml in a fluorescence cuvette thermostated at 25°C. The assay
buffer for papain was 0.1 M sodium phosphate buffer, pH 6.5, containing 2 mM DTE and 1.5
mM EDTA, while cathepsin L was assayed in 0.4 M sodium acetate buffer, pH 5.5,
containing 2 mM DTE and 1.5 mM EDTA. To initiate the reaction, papain (final
concentration 0.2 nM) or cathepsin L (final concentration 0.1 nM) was added in a negligible
volume. Product formation was monitored continuously at excitation and emission
by guest on August 13, 2019
http://ww
w.jbc.org/
Dow
nloaded from
![Page 10: CLITOCYPIN, A NEW TYPE OF CYSTEINE PROTEINASE … · The protein sample was introduced at a flow rate of 10 µmol/min using a syringe pump. Spectra were obtained by scanning from](https://reader030.vdocuments.us/reader030/viewer/2022041204/5d53971888c993a7588bd116/html5/thumbnails/10.jpg)
10
wavelengths of 370 and 460 nm, respectively. The progress curves were fitted by nonlinear
regression analysis to the equation of Morrison for the model of slow-binding kinetics (33)
and kdiss and kass values were obtained using Km of 80 µM for papain (34) and 2 µM for
cathepsin L (35). The equilibrium constants (Ki) were calculated from kass and kdiss (Ki =
kdiss/kass).
The Ki values for the inhibition of cathepsin B and stem bromelain by the inhibitor
were determined from the linear equation of Henderson (36) derived for kinetics of tight-
binding competitive inhibitors. Each enzyme was incubated at 25°C with different amounts
of the inhibitor (0.05 µM to 1.5 µM) for 15 min in 0.3 ml of 0.1 M phosphate buffer,
containing 10 mM cysteine and 1.5 mM EDTA. Cathepsin B was assayed at pH 6.0 and
bromelain at pH 6.8. The reaction was initiated by the addition of the substrate in the final
concentration of 10 µM in a negligible volume. Z-Phe-Arg-MCA was used for cathepsin B
and Z-Arg-Arg-MCA for bromelain. After 10 min of incubation the reaction was stopped
with 5 mM iodoacetic acid. The released 7-MCA was measured on a Perkin-Elmer LS 30
fluorimeter. The apparent Ki values were obtained graphically (36) and true inhibition
constants (Ki) were obtained after correction for substrate competition using equation: Ki =
Ki,app/(1 + [So]/Km), where [So] is the initial substrate concentration and Km values of 150 µM
for cathepsin B (37) and 15 µM for bromelain (38).
Testing the inhibitory activity against other classes of enzymes — Trypsin activity
was measured using the synthetic substrate benzoyl-arginyl-p-nitroanilide as described by
Erlanger (39). Pepsin was assayed using fluorogenic biopodyl-labeled casein as described in
(40). Clitocypin inhibitory activity was determined by titrating 2 µg of trypsin or 0.1 µg of
pepsin with increasing amounts of clitocypin.
Assay of hemagglutinating activity ― Human (phenotypes A, B, 0) and rabbit red
blood cells were extensively washed and suspended in buffered saline. 50 µl samples of crude
by guest on August 13, 2019
http://ww
w.jbc.org/
Dow
nloaded from
![Page 11: CLITOCYPIN, A NEW TYPE OF CYSTEINE PROTEINASE … · The protein sample was introduced at a flow rate of 10 µmol/min using a syringe pump. Spectra were obtained by scanning from](https://reader030.vdocuments.us/reader030/viewer/2022041204/5d53971888c993a7588bd116/html5/thumbnails/11.jpg)
11
Clitocybe nebularis extract and purified clitocypin (1mg/ml) and their serial dilutions were
mixed with 1 ml of 3 % (v/v) erythrocyte suspension in test tubes and incubated for 3 hours at
room temperature. Agglutinated red blood cells formed a pellet, which was not resuspended
upon shaking.
Temperature stability Purified clitocypin was boiled in buffer A for 5 min in a
sealed microcentrifuge tube. After cooling on ice for 5 min, it was used for titration of papain
or run on calibrated gel filtration, as described above.
by guest on August 13, 2019
http://ww
w.jbc.org/
Dow
nloaded from
![Page 12: CLITOCYPIN, A NEW TYPE OF CYSTEINE PROTEINASE … · The protein sample was introduced at a flow rate of 10 µmol/min using a syringe pump. Spectra were obtained by scanning from](https://reader030.vdocuments.us/reader030/viewer/2022041204/5d53971888c993a7588bd116/html5/thumbnails/12.jpg)
12
RESULTS
Purification of 34 kDa Inhibitory Protein The purification scheme required for
purification of clitocypin was rather straightforward. Affinity chromatography proved to be
an efficient first step as it specifically removed other non-inhibitory proteins, so that after gel
filtration the inhibitor was practically homogeneous (Fig. 1, 3). In a typical preparation we
obtained 2 mg of purified inhibitor from 100 g of fresh mushrooms.
The molecular mass of clitocypin under native conditions, as estimated by calibrated
gel filtration, as well as that obtained in non-reducing SDS-PAGE without boiling of the
sample was 34 kDa. The same Mr of 34 kDa was obtained in the presence of reducing agent.
Reduced and nonreduced samples, boiled in the presence of SDS, gave only a single band of
17 kDa (Fig. 1).
Subsequent purification by RP HPLC resulted in two peaks Cn1 and Cn2, both
showing inhibitory activity. Cn1 gave a single band of 34 kDa and Cn2 two bands of 34 and
17 kDa on SDS-PAGE without boiling (Fig. 2). Fraction Cn1 is thus composed solely of
dimers (about 2/3 of the total) and Cn2 a mixture of dimers and monomers (about 1/3 of the
total ).
By ES mass spectrometry a single mass of 16863 Da was obtained for clitocypin from
gel filtration and from both HPLC peaks.
Isoelectric Focusing On IEF the inhibitory protein ran as a single band at pH value
of 4.4 (Fig. 3) which agrees well with the value of 4.42 calculated from the amino acid
composition.
Subunit Composition Analysis and Stability of Clitocypin Clitocypin proved to be
an extremely stable protein. When boiled in non-denaturing buffer (see details in the
Experimental procedures) it remained, as judged by inhibitory activity, elution volume in gel
by guest on August 13, 2019
http://ww
w.jbc.org/
Dow
nloaded from
![Page 13: CLITOCYPIN, A NEW TYPE OF CYSTEINE PROTEINASE … · The protein sample was introduced at a flow rate of 10 µmol/min using a syringe pump. Spectra were obtained by scanning from](https://reader030.vdocuments.us/reader030/viewer/2022041204/5d53971888c993a7588bd116/html5/thumbnails/13.jpg)
13
filtration and behaviour on SDS-PAGE, indistinguishable from the initial inhibitor (Fig. 1).
Incubation in denaturing buffer with GdmHCl however resulted in only the 17-kDa band on
SDS-PAGE with and without boiling (Fig. 1) and complete loss of inhibitory activity.
Sequence Analysis of Clitocypin The position of peptides and overall strategy used
for the complete amino acid sequence determination of clitocypin is shown in Fig. 4. The N-
terminal sequence analysis of clitocypin established the initial 11 N-terminal residues with a
sequence yield in the range of 10 %. Five peptides were obtained by acid hydrolysis (A1 to
A5) and sequenced through to their C-termini. Glycyl endopeptidase yielded the second set of
peptides. G1 filled the gap between A2 and A3 and together with G2 established the order
and overlaps of A2, A3, and A4. Tryptic peptide T1 contributed to the alignment and
overlapping of the A1 and A2 peptides on the N-terminal part of the molecule. Based on the
low content of Lys the final set of peptides was obtained by endoproteinase Lys-C digestion.
Peptide L1 filled the remaining gap between A3 and A4 and together with L2 provided the
order of the peptides A3, A4 and A5 on the C-terminus of the protein. From the sequence
data we conclude that 17-kDa monomeric clitocypin is composed of 150 amino acids with a
calculated molecular mass of 16854 Da. The molecule contains no cysteinyl residues, only
one histidine and two tryptophanes, and is rich in proline and glycine. Amino acid
composition analysis of undegraded clitocypin and its fragments provided the same 150
amino acid residues (results not shown). No sequence polymorphism was observed.
Clitocypin contained no inhibitor consensus sequences characteristic of the cystatin
superfamily members. No attachment site for oligosacharide chains was present, which is
compatible with the observed absence of sugars by both methods used.
A primer pair designed to span from the previously determined N-terminus to the
apparent C-terminus was used for the RT-PCR amplification of mRNA isolated from
Clitocybe nebularis fruit bodies. A product of approximately 400 base pairs termed Cn c1
by guest on August 13, 2019
http://ww
w.jbc.org/
Dow
nloaded from
![Page 14: CLITOCYPIN, A NEW TYPE OF CYSTEINE PROTEINASE … · The protein sample was introduced at a flow rate of 10 µmol/min using a syringe pump. Spectra were obtained by scanning from](https://reader030.vdocuments.us/reader030/viewer/2022041204/5d53971888c993a7588bd116/html5/thumbnails/14.jpg)
14
was isolated, subcloned and sequenced (Fig. 5B). Analysis of the deduced amino acid
sequence and comparison with the directly determined protein sequence showed 95 %
identity (Fig. 5A). All 7 amino acid residues that differ between the cDNA derived and
protein sequences are located in the C-terminal region of the protein.
Amino Acid Sequence Comparison In a search for homologous proteins in
databases no protein showing high similarity with clitocypin was found. However, three
protein sequences with some degree of similarity to clitocypin were disclosed. Relatively
high similarity, restricted just to two regions of clitocypin (34 and 35 % identity) for residues
47-89 and 95-136, respectively, was found for two parts of the minor tail 43.0-kDa protein
from Mycobacterium phage L5 (Swiss-Prot accession no. O05278). Clitocypin was also
found to share significant similarity (26 % identity, 41 % conservative residues throughout
the aligned sequences) with a 16.5-kDa lectin-related protein (PC-LRP) from a lectin-
deficient strain of mushroom Pleurotus cornucopiae (PIR accession no. JC 2102) (41).
Higher levels of similarity were found in the N-terminal regions of the molecules as shown in
Fig. 5A. Finally, when applying SAMBA computation of alignments, clitocypin was found to
share considerable sequence similarity (35% amino acid identity) with 37 amino acids in C-
terminal region of Rhesus macaque cystatin C precursor protein (Swiss-Prot accession no.
O19092) (42). In other parts of the sequences the relatedness is not apparent. No cystatin C
consensus sequences are observed in clitocypin.
Kinetics of inhibition Titration, together with the determination of the
concentration of the inhibitor, led to a value of 0.89 mol of clitocypin dimer needed to abolish
enzymatic activity of 1 mol papain (active concentration).
The pseudo-first-order rate constant, k, for binding of clitocypin to papain and
cathepsin L increased linearly with inhibitor concentration. The association, (kass), and
dissociation, (kdiss), rate constants and equilibrium constants (Ki) are presented in Table I.
by guest on August 13, 2019
http://ww
w.jbc.org/
Dow
nloaded from
![Page 15: CLITOCYPIN, A NEW TYPE OF CYSTEINE PROTEINASE … · The protein sample was introduced at a flow rate of 10 µmol/min using a syringe pump. Spectra were obtained by scanning from](https://reader030.vdocuments.us/reader030/viewer/2022041204/5d53971888c993a7588bd116/html5/thumbnails/15.jpg)
15
Both kass and kdiss are 2- and 3-fold lower, respectively, for cathepsin L than for papain, thus
resulting in similar equilibrium constants (Ki) for these two enzymes. Ki for the inhibition of
cathepsin B and bromelain are substantially higher, in the µM range. Under the same
conditions no inhibition of cathepsin H was observed, even at 100-fold excess of the
inhibitor.
The ability of clitocypin to inhibit serine and aspartic proteinases was tested by
titration with trypsin and pepsin. No inhibition was observed in either case.
Titration assays showed that among the red blood cells tested only human
erythrocytes of type B were weakly and rabbit erythrocytes strongly agglutinated by
Clitocybe nebularis raw extract. Purified clitocypin in final concentrations up to 50 µg/ml had
no effect under the same conditions.
by guest on August 13, 2019
http://ww
w.jbc.org/
Dow
nloaded from
![Page 16: CLITOCYPIN, A NEW TYPE OF CYSTEINE PROTEINASE … · The protein sample was introduced at a flow rate of 10 µmol/min using a syringe pump. Spectra were obtained by scanning from](https://reader030.vdocuments.us/reader030/viewer/2022041204/5d53971888c993a7588bd116/html5/thumbnails/16.jpg)
16
DISCUSSION
Basidiomycete mushroom Clitocybe nebularis contains a specific inhibitor of cysteine
proteinases - clitocypin. It was obtained in high amount from fruit bodies and shows marked
stability at high temperatures. To our knowledge no protein proteinase inhibitors of any class
have been reported from this or similar sources.
The molecular mass and sequence data show that purified clitocypin is a dimer
stabilised by non-covalent interactions. The absence of effect of reducing agent confirms the
lack of cysteine residues in the sequence. The 34 kDa clitocypin band was also obtained
following a modified purification procedure, not including affinity chromatography, which
indicates that the dimer is present in mushroom juice and is not introduced during the affinity
chromatography step (results not shown). The molecular mass of clitocypin calculated from
aminoacid sequence agrees well with that obtained by ES mass spectrometry, indicating that
no post-translational modification occurs. Taken together, this data show that this inhibitor
consists of only one kind of polypeptide chain of 16854 Da, having no sugar moieties. One
unanswered question is the nature of the second peak from HPLC, a proportion of which
runs, on SDS-PAGE (without boiling), as a monomer. It may reflect subtle differences in the
hydrophobicity of a partially denatured form following slow denaturation on hydrophobic
surfaces in the presence of organic phase in HPLC, with decreased tendency to form dimers.
The inhibition spectrum of clitocypin is similar but not identical to that of other
classes of cysteine proteinase inhibitors. Among the cysteine endopeptidases tested,
clitocypin inhibits most strongly papain and cathepsin L, as do cystatins (4), thyropins (5) and
potato cysteine proteinase inhibitors (43). Clitocypin differs significantly from them however,
in that it is a relatively poor inhibitor of cathepsin B and completely ineffective against
cathepsin H. Interestingly, it inhibits bromelain reasonably well, as has been found for potato
cysteine proteinase inhibitor (PCPI 8.3), but not for cystatins and thyropins. Whether this
by guest on August 13, 2019
http://ww
w.jbc.org/
Dow
nloaded from
![Page 17: CLITOCYPIN, A NEW TYPE OF CYSTEINE PROTEINASE … · The protein sample was introduced at a flow rate of 10 µmol/min using a syringe pump. Spectra were obtained by scanning from](https://reader030.vdocuments.us/reader030/viewer/2022041204/5d53971888c993a7588bd116/html5/thumbnails/17.jpg)
17
apparent specificity for endopeptidases is general will be shown in future experiments. Since
clitocypin is a dimer, with the potential of binding two molecules of proteinase
simultaneously, the inhibitor dimer to enzyme binding stoichiometry of 1 : 1.1 could be
explained in two different ways. Either, the inhibitor domains bind independently to protease
but only 55 % of them are active monomers, or only one monomer binds to the enzyme active
site while binding of the other domain is sterically hindered. Further studies will be needed to
clarify the inhibitory mechanism and to elucidate the structure of the complex of clitocypin
with a cysteine proteinase.
Our data base search disclosed no highly related proteins, just a few limited sequence
similarities. A relatively high value of identity was found (using only one search engine)
between short regions of residues in the C-terminal region of a cystatin C precursor protein
from monkey (but not, apparently, other species) and the N-terminal region of clitocypin.
Together with the absence of any structurally or functionally significant sequence similarities,
this similarity cannot be considered as significant. The local similarity observed for the
mycobacterial tail protein is, on the same grounds, not significant.
None of the three critical elements involved in the inhibitory mechanism
characteristic for the cystatin superfamily of CPIs was identified in clitocypin sequence.
These are the N-terminally conserved Gly-9 residue, the central Gln-Xaa-Val-Xaa-Gly motif
(first hairpin loop) and the C-terminally located Pro-Trp element (second hairpin loop), all
forming the wedge-shaped hydrophobic edge which inserts into the active-site cleft of the
proteinase (10, 11). It is possible that the inhibitory edge of cystatins could be reproduced by
other structural elements as a result of convergent evolution similar to that recently shown for
thyropins (12).
In the search for related proteins, the significance threshold of about 26 % identity
was however reached with a lectin-like protein from a lectin deficient strain of Pleurotus
by guest on August 13, 2019
http://ww
w.jbc.org/
Dow
nloaded from
![Page 18: CLITOCYPIN, A NEW TYPE OF CYSTEINE PROTEINASE … · The protein sample was introduced at a flow rate of 10 µmol/min using a syringe pump. Spectra were obtained by scanning from](https://reader030.vdocuments.us/reader030/viewer/2022041204/5d53971888c993a7588bd116/html5/thumbnails/18.jpg)
18
cornucopiae mushroom. The physiological function of this protein in mushroom is not
known. Structurally, it appears to be related to a lectin family of proteins with agglutination
activity that have been extensively characterised in several basidiomycete and parasitic
deuteromycete fungi such as Ganoderma lucidium (44, 45), Agaricus bisporus (46) and
Arthrobotrys oligospora (47) where they presumably play a role in fungal growth,
morphogenesis and mycorrhization (48). In contrast to the alignment with cystatin C
precursor, the level of identity applies over the entire primary structures. In addition, there are
some additional common structural traits between this lectin-like group of proteins and
clitocypin that appear to be meaningful: the lack of cysteine and methionine residues, closely
similar acidic isoelectric points, similar molecular masses and almost exclusively
homodimeric structure under nondenaturing conditions. An early report (49) describes
Clitocybe nebularis lectin as an oligomeric protein, with subunit molecular mass in the range
of 15 to 20 kDa, isoelectric point around pH 4.4, no cysteines, lacking or containing only
trace amounts of methionine and histidine, and similar percentage composition of another 9
amino acids to that reported here for clitocypin. As expected therefore, our experiments
showed that Clitocybe nebularis juice contains lectin activity agglutinating rabbit and human
type B, but not A and O, erythrocytes. In contrast, purified clitocypin showed no activity
against these red blood cells. At this stage the conclusion that the inhibitor is not a lectin is
premature, since the existence of highly specific and also nonagglutinating lectins in fungi
has been demonstrated (48). Evidently, a group of structurally related proteins is present in
fungi, some lectin related but with yet unknown functions, others as inhibitors of cysteine
proteinases described in this paper, and most of them as lectins with differing specificities.
Although tentative until homology has been confirmed by 3-D structure determination, it is
our proposal that the members of this structurally related family that are, like clitocypin,
inhibitors, should be classed as belonging to a new superfamily of inhibitors of cysteine
by guest on August 13, 2019
http://ww
w.jbc.org/
Dow
nloaded from
![Page 19: CLITOCYPIN, A NEW TYPE OF CYSTEINE PROTEINASE … · The protein sample was introduced at a flow rate of 10 µmol/min using a syringe pump. Spectra were obtained by scanning from](https://reader030.vdocuments.us/reader030/viewer/2022041204/5d53971888c993a7588bd116/html5/thumbnails/19.jpg)
19
proteinases, named mycocypins. In this context, biochemical and genetic studies of
mushroom inhibitors are in progress.
The observed differences between the protein and nucleotide derived sequence could
point to the presence of several homologous clitocypin encoding genes, the apparent absence
of fragments encoding homologous proteins in the protein sequence determination reflecting
difference in the levels of expressed proteins at the different developmental or environmental
conditions.
The physiological target of clitocypin in Clitocybe nebularis is not known. The
inhibitor is expressed at very high levels, characteristic of proteins with roles that are more
structural, as opposed to signalling, catalysis or control. In relation to the control, although
no cysteine proteinase activity has been detected in mushroom juice, it may well be localised
in separate discrete structures, or masked with excess inhibitor. Besides an endogenous
physiological role, the other possible function may be protection of the mushroom from
pathogen infection or predation by insects, as shown for several plants (50).
In conclusion, we have isolated a novel proteinase inhibitor designated clitocypin, and
characterised its activity and primary and oligomeric structure. The present study clearly
establishes clitocypin as a new and potent inhibitor that shares no structural or functional
features with previously known cysteine proteinase inhibitors, but instead appears to be
related to a group of fungal lectins. Further studies are needed to establish the precise
physiological functions of this new inhibitor in mushrooms. Finally, the discovery of
clitocypin should broaden the spectrum of specific cysteine proteinase inhibitors available for
potential use in human and veterinary medicine, and in agricultural crop protection to fight
the remarkable adaptation of insects to plant endogenous inhibitors (51).
by guest on August 13, 2019
http://ww
w.jbc.org/
Dow
nloaded from
![Page 20: CLITOCYPIN, A NEW TYPE OF CYSTEINE PROTEINASE … · The protein sample was introduced at a flow rate of 10 µmol/min using a syringe pump. Spectra were obtained by scanning from](https://reader030.vdocuments.us/reader030/viewer/2022041204/5d53971888c993a7588bd116/html5/thumbnails/20.jpg)
20
Aknowledgements We are grateful to Dr. Roger Pain for his advice regarding the
manuscript and Dr. Bogdan Kralj for his invaluable help with ES mass spectrometry
measurements.
by guest on August 13, 2019
http://ww
w.jbc.org/
Dow
nloaded from
![Page 21: CLITOCYPIN, A NEW TYPE OF CYSTEINE PROTEINASE … · The protein sample was introduced at a flow rate of 10 µmol/min using a syringe pump. Spectra were obtained by scanning from](https://reader030.vdocuments.us/reader030/viewer/2022041204/5d53971888c993a7588bd116/html5/thumbnails/21.jpg)
21
REFERENCES
1. Turk, D., Podobnik, M., Kuhelj, R., Dolinar, M., and Turk, V. (1996) FEBS Lett. 384,
211-214
2. Cygler, M., Sivaraman, J., Grochulski, P., Coulombe, R., Storer, A. C., and Mort, J. S.
(1996) Structure 4, 405-416
3. Turk, V., Podobnik, M., Lenarčič, B., Bevec, T., Stoka, V., Turk, B, and Turk, D. (1997)
in Medical Aspects of Proteinases and Proteinase Inhibitors (Katunuma, N., Kido, H.,
Fritz, H., and Travis, J. eds) pp. 3-14, IOS Press, Amsterdam
4. Turk, V., and Bode, W. (1991) FEBS Lett. 285, 213-219
5. Lenarčič, B., and Bevec, T. (1998) Biol. Chem. 379, 105-111
6. Križaj, I., Drobnič-Košorok, M., Brzin, J., Jerala, R., and Turk, V. (1993) FEBS Lett. 333,
15-20
7. Lenarčič, B., Ritonja, A., Turk, B., Dolenc, I., and Turk, V. (1992) Biol. Chem. Hoppe-
Seyler 373, 459-464
8. Reddy, M. N., Keim, P. S., Heinrikson, R. L., and Kezdy, F. J. (1975) J. Biol. Chem. 230,
1741-1750
9. Yamamoto, Y., Watabe, S., Kageyama, T., Takahashi, S. Y. (1999) FEBS Lett. 448, 257-
260
10. Bode, W., Engh, R., Musil, D., Thiele, U., Huber, R., Karshikov, A., Brzin, J., Kos, J.,
and Turk, V. (1988) EMBO J. 7, 2593-2599
11. Stubbs, M., Laber, B., Bode W., Huber, R., Jerala, R., Lenarčič, B., and Turk, V. (1990)
EMBO J. 9, 1939-1947
12. Gunčar, G., Pungerčič, G., Klemenčič, I., Turk, V., and Turk, D. (1999) EMBO J. 18,
793-803
by guest on August 13, 2019
http://ww
w.jbc.org/
Dow
nloaded from
![Page 22: CLITOCYPIN, A NEW TYPE OF CYSTEINE PROTEINASE … · The protein sample was introduced at a flow rate of 10 µmol/min using a syringe pump. Spectra were obtained by scanning from](https://reader030.vdocuments.us/reader030/viewer/2022041204/5d53971888c993a7588bd116/html5/thumbnails/22.jpg)
22
13. Sloane, B. F., Moin, K., and Lah, T. (1994) in Biochemical and Molecular Aspects of
Selected Cancers, Vol. 2. (Pretlow, T.G., and Pretlow, T. P. eds) pp. 411-466, Academic
Press, San Diego
14. Delaissé, J. M., Ledent, P., and Vaes, G. (1991) Bichem. J. 279, 167-174
15. Cox, S. W., and Eley, B. M. (1989) J. Periodont. Res. 24, 353-361
16. Esser, R. E., Angelo, R. A., Murphey, M. D., Watts, L. M., Thornburg, L. P., Palmer, J.
T., Talhouk, J. W., and Smith, R. E. (1994) Arthritis Rheum. 37, 236-247
17. Blumberg, S., Schechter, I., and Berger, A. (1970) Eur. J. Biochem. 15, 97-102
18. Buttle, D. J., Ritonja, A., Pearl, L. H., Turk, V., and Barrett, A. J. (1990) FEBS Lett. 260,
195-197
19. Strop, P, and Cechova, D. (1981) J. Chromatogr. 207, 55-62
20. Popovič, T., Puizdar, V., Ritonja, A., and Brzin, J. (1996) J. Chromatogr. B 681, 251-262
21. Brzin, J., Popovič, T., Turk, V., Borchart, U., Machleidt, W. (1984) Biochem. Biophys.
Res. Commun. 118, 103-109
22. Puissant, C., and Houdebine, L. M. (1990) Bio Techniques, 8, 148-149
23. Sambrook, J., Fritsch, E. F., and Maniatis, T. (1989) in Molecular cloning, A Laboratory
Manual, 2nd edn., Cold Spring Laboratory Press, Cold Spring Harbor, NY
24. Chomczynski, P. (1992) Anal. Biochem. 201, 134-139
25. Pace, C. N., Vajdos, F., Fee, L., Grimsley, G., and Gray, T. (1995) Protein Sci. 4, 2411-
2423
26. Manzi, A. E., and Esko, J. (1995) in Current Protocols in Molecular Biology, Vol 3
(Ausubel, F. M., Brent, R., Kingston, R. E., Moore, D.D., Seidman, J. G., Smith, J.A.,
and Stehul, K., eds) pp.17.9.1-17.9.11, John Wiley & Sons, Inc, USA
27. Altschul, S. F., Gish, W., Miller, W., Myers, E. W., and Lipman, D. J. (1990) J. Mol.
Biol. 215, 403-410
by guest on August 13, 2019
http://ww
w.jbc.org/
Dow
nloaded from
![Page 23: CLITOCYPIN, A NEW TYPE OF CYSTEINE PROTEINASE … · The protein sample was introduced at a flow rate of 10 µmol/min using a syringe pump. Spectra were obtained by scanning from](https://reader030.vdocuments.us/reader030/viewer/2022041204/5d53971888c993a7588bd116/html5/thumbnails/23.jpg)
23
28. Lavenier, D. (1996) IRISA Report PI 988, INRIA Report RR 2845
29. Barrett, A. J. (1972) Anal. Biochem. 47, 280-293
30. Barrett, A. J., and Kirschke, H. (1981) Methods Enzymol. 80, 535-562
31. Turk, B., Križaj, I., Kralj, B., Dolenc, I., Popovič, T., Bieth, J. G., and Turk, V. (1993) J.
Biol. Chem. 268, 7323-7329
32. Rawlings, N. D., and Barrett, A. J. (1990) CABIOS 6, 118-119
33. Morrison, J. F. (1982) Trends Biochem. Sci. 7, 102-105
34. Tchoupe, J. R., Moreau, T., Gauthier, F., and Bieth, J. G. (1991) Biochim. Biophys. Acta
1076, 149-151
35. Mason, R. W. (1986) Biochem. J. 240, 285-288
36. Henderson, P. J. F. (1972) Biochem. J. 127, 321-333
37. Turk, B., Ritonja, A., Björk, I., Stoka, V., Dolenc, I., and Turk, V. (1995) FEBS Lett.,
360, 101-105
38. Rowan, A. D., and Buttle D. J. (1994) Methods Enzymol. 244, 555-568
39. Erlager, B. F., Kokowsky, N., and Cohen, W. (1961) Arch. Biochem. Biophys. 95, 271-
281
40. Christeller J. T., Farley, P. C., Ramsay, R. J., Sullivan, P. A., Laing, W. A. (1998) Eur. J.
Biochem. 254, 160-167
41. Oguri, S., and Nagata, Y (1994) Biosci. Biotech. Biochem. 58, 507-511
42. Weil, L. H., Walker, L. C., and Levy, E. (1996) Stroke 27, 2080-2085
43. Rowan, A. D., Brzin, J., Buttle, D. J., and Barrett, A. J. (1990) FEBS Lett. 269, 328-330
44. Kino, K., Yamashita, A., Yamaoka, K., Watanabe, J., Tanaka, S., Shimizu, K. K., and
Tsunoo, H. (1989) J. Biol. Chem. 264, 472-478
45. Kawagishi, H., Mitsunaga, S.-I, Yamawaki, M., Ido, M., Shimada, A., Kinoshita, T.,
Murata, T., Usui, T., Kimura, A., and Chiba, S. (1997) Phytochem. 44, 7-10
by guest on August 13, 2019
http://ww
w.jbc.org/
Dow
nloaded from
![Page 24: CLITOCYPIN, A NEW TYPE OF CYSTEINE PROTEINASE … · The protein sample was introduced at a flow rate of 10 µmol/min using a syringe pump. Spectra were obtained by scanning from](https://reader030.vdocuments.us/reader030/viewer/2022041204/5d53971888c993a7588bd116/html5/thumbnails/24.jpg)
24
46. Sueyoshi, S., Tsuji, T., and Osawa, T. (1985) Biol. Chem. Hoppe-Seyler 366, 213-221
47. Rosen, S., Kata, M., Persson, Y., Lipniunas, P. H., Wikstrom, M., van den Hondel, C. A.
M. J. J., van den Brink, J. M., Rask, L., Heden, L.-O., and Tunlid, A. (1996) Eur. J.
Biochem. 238, 822-829
48. Guillot, J., and Konska, G. (1997) Bichem. Systematics Ecol. 25, 203-230
49. Horejsi, V., and Kocourek, J. (1978) Biochim. Biophys. Acta 538, 299-315
50. Ryan, C. A. (1978) Trends Biochem. Sci. 5, 148-150
51. Gruden, K., Štrukelj, B., Popovič, T., Lenarčič, B., Bevec, T., Brzin, J., Kregar, I.,
Herzog-Velikonja, J., Stiekema, W. J., Bosch, D., Jongsma, M. A. (1998) Insect Biochem.
Mol. Biol. 28, 549-560
by guest on August 13, 2019
http://ww
w.jbc.org/
Dow
nloaded from
![Page 25: CLITOCYPIN, A NEW TYPE OF CYSTEINE PROTEINASE … · The protein sample was introduced at a flow rate of 10 µmol/min using a syringe pump. Spectra were obtained by scanning from](https://reader030.vdocuments.us/reader030/viewer/2022041204/5d53971888c993a7588bd116/html5/thumbnails/25.jpg)
25
FOOTNOTES
This work was supported by the Ministry of Science and Technology of the Republic
of Slovenia and by INCO-Copernicus grant (ERBIC 15CT960921). The costs of publication
were defrayed in part by the payment of page charges. This article must therefore be hereby
marked “advertisement” in accordance with 18 U.S.C. Section 1734, solely to indicate this
fact.
“ The first two authors contributed equally to this work.
** To whom correspondence should be addressed: Tel. 386 61 1773474; Fax: 386 61
273594; E-mail: [email protected]
The protein sequence reported in this paper has been submitted to the Swiss Protein
Database under Swiss-Prot accession number P82314 and the nucleotide sequence in the
GenBank under accession number AF230360.
1 The abbreviations used are: Bz, benzoyl; CM, carboxymethyl; DTE, dithioerythritol;
Ep-475, L-3-carboxy-trans-2,3-epoxypropylleucylamido-(3-guanidino)butane; GdmHCl,
guanidine hydrochloride; MCA, 7(4-methyl)-coumarylamide; NA, 2-naphthylamide; PAGE,
polyacrylamide gel electrophoresis; SDS, sodium dodecyl-sulphate; TFA, trifluoroacetic
acid; Z, benzyloxycarbonyl;
by guest on August 13, 2019
http://ww
w.jbc.org/
Dow
nloaded from
![Page 26: CLITOCYPIN, A NEW TYPE OF CYSTEINE PROTEINASE … · The protein sample was introduced at a flow rate of 10 µmol/min using a syringe pump. Spectra were obtained by scanning from](https://reader030.vdocuments.us/reader030/viewer/2022041204/5d53971888c993a7588bd116/html5/thumbnails/26.jpg)
26
FIGURE LEGENDS
FIG. 1. Analysis of the purification of clitocypin from Clitocybe nebularis by SDS-
PAGE. Samples were run as follows: Clitocybe nebularis extract (lane 1), purified clitocypin
after gel filtration (lanes 2-5), the first (lane 6) and the second (lane 7) peak after HPLC,
clitocypin boiled in non-denaturing buffer and eluted from gel filtration (lane 9) and GdmHCl
denatured clitocypin (lane 10). MW indicates molecular markers (lane 8), where sizes in kDa
are indicated. Samples were treated in 2.5 % SDS at room temperature (rt) before application
to wells, or boiled in 2.5 % SDS for 5 min (bt). Samples analysed in the presence of 5 % 2-
mercaptoethanol are indicated as ME. The gel was Coomassie stained.
FIG. 2. HPLC chromatography of clytocypin. The elution profile of clitocypin
obtained from gel filtration (solid line). Linear gradient from 0-80 % of acetonitrile in 0.1 %
TFA (dashed line).
FIG. 3. Isoelectric focusing. Samples were loaded onto Phast Gel IEF with a gradient
ranging from pH 3 to 9. Isoelectric point markers (lane 1), purified clitocypin (lane 2), and
Clitocybe nebularis extract (lane 3).
FIG. 4. Summary of the determination of the complete amino acid sequence of
clitocypin. The sequenced regions are marked by solid line. N represents the N-terminal
sequence of the inhibitor and the origins of the peptides are designated by A for acid, T for
tryptic, G for glycyl endopeptidase and L for endopeptidase Lys-C hydrolysis.
FIG. 5.A. Comparison of clitocypin protein sequence aligned with the cDNA
derived clitocypin sequence Cn c1 and with the lectin-related 16.5-kDa protein sequence
by guest on August 13, 2019
http://ww
w.jbc.org/
Dow
nloaded from
![Page 27: CLITOCYPIN, A NEW TYPE OF CYSTEINE PROTEINASE … · The protein sample was introduced at a flow rate of 10 µmol/min using a syringe pump. Spectra were obtained by scanning from](https://reader030.vdocuments.us/reader030/viewer/2022041204/5d53971888c993a7588bd116/html5/thumbnails/27.jpg)
27
PC-LRP reported by Oguri and Nagata (41). Dashed lines represent a sequence identical
to the clitocypin protein sequence. Periods represent the frameshifting of proteins for
maximal alignment between sequences. Numbering is according to the clitocypin sequence.
B, the cDNA and deduced amino acid sequences of the clitocypin amino acid residues 18-
146.
by guest on August 13, 2019
http://ww
w.jbc.org/
Dow
nloaded from
![Page 28: CLITOCYPIN, A NEW TYPE OF CYSTEINE PROTEINASE … · The protein sample was introduced at a flow rate of 10 µmol/min using a syringe pump. Spectra were obtained by scanning from](https://reader030.vdocuments.us/reader030/viewer/2022041204/5d53971888c993a7588bd116/html5/thumbnails/28.jpg)
28
bt rt rt bt bt rt rt bt rt rt
1 2 3 4 5 6 7 8 9 10
94
67
30
14.4
ME MEMW
43
20.1
8
btbt
by guest on August 13, 2019
http://ww
w.jbc.org/
Dow
nloaded from
![Page 29: CLITOCYPIN, A NEW TYPE OF CYSTEINE PROTEINASE … · The protein sample was introduced at a flow rate of 10 µmol/min using a syringe pump. Spectra were obtained by scanning from](https://reader030.vdocuments.us/reader030/viewer/2022041204/5d53971888c993a7588bd116/html5/thumbnails/29.jpg)
29
Cn2
Cn1
0
0.2
0.4
0.6
0.8
1
1.2
1.4
-5 0 5 10 15 20 25
time (min)
abs
orba
nce
(215
nm)
0
20
40
60
80
acet
onitr
ile (%
)
by guest on August 13, 2019
http://ww
w.jbc.org/
Dow
nloaded from
![Page 30: CLITOCYPIN, A NEW TYPE OF CYSTEINE PROTEINASE … · The protein sample was introduced at a flow rate of 10 µmol/min using a syringe pump. Spectra were obtained by scanning from](https://reader030.vdocuments.us/reader030/viewer/2022041204/5d53971888c993a7588bd116/html5/thumbnails/30.jpg)
30
8.658.45
8.15
7.35
6.856.55
5.85
5.20
4.55
3.50
1 2 3
by guest on August 13, 2019
http://ww
w.jbc.org/
Dow
nloaded from
![Page 31: CLITOCYPIN, A NEW TYPE OF CYSTEINE PROTEINASE … · The protein sample was introduced at a flow rate of 10 µmol/min using a syringe pump. Spectra were obtained by scanning from](https://reader030.vdocuments.us/reader030/viewer/2022041204/5d53971888c993a7588bd116/html5/thumbnails/31.jpg)
31
10 20 30 40LEDGIYRLRAVTTHNPDPGVGGEYATVEGARRPVKAEPNT
N ----------------------------------------A ----------------------------------------T ----------------------------------------G ----------------------------------------L ----------------------------------------
50 60 70 80PPFFEQQIWQVTRNADGQYTIKYQGLNTPFEYGFSYDELE
N ----------------------------------------A ----------------------------------------T ----------------------------------------G ----------------------------------------L ----------------------------------------
90 100 110 120PNAPVIAGDPKEYILQLVPSTADVYIIRAPIQRIGVDVEE
N ----------------------------------------A ----------------------------------------T ----------------------------------------G ----------------------------------------L ----------------------------------------
130 140 150GGQQNTLTYKFFPVDGSGGDRPAWRFTREE
N ------------------------------A ------------------------------T ------------------------------G ------------------------------L ------------------------------
A1 A2
T1
G1
N1
G1
L1
L1
G2
A4A3
L2
A5A4
A3A2
by guest on August 13, 2019
http://ww
w.jbc.org/
Dow
nloaded from
![Page 32: CLITOCYPIN, A NEW TYPE OF CYSTEINE PROTEINASE … · The protein sample was introduced at a flow rate of 10 µmol/min using a syringe pump. Spectra were obtained by scanning from](https://reader030.vdocuments.us/reader030/viewer/2022041204/5d53971888c993a7588bd116/html5/thumbnails/32.jpg)
32
A1
11
21
31
41
51
61
71
clitocypin
LEDGIYRLRA
VTTHNPDPGV
GGEYATVEGA
RRPVKAEPNT
PPFFEQQIW.Q
VTRNA.DGQYT
IKYQGLNTPF
EYGFSYDELE
Cn
c1
---
----------
----------
---------.-
-----.-----
----------
----------
PC-LRP
SDAFMLRAS-FV--
--M---GQ-Q
GN-IIVARLG
...MQ--L-VE
AQP-KIG-DDA
VAIFSKDARL
TWK-T....-
81
91
101
111
121
131
141
clitocypin
PNAPVIAGDP
KE....YILQLV.PS
TA.DVYIIRAP
IQRIGVD.VEE
GGQQNTLTYK
FFPVDGSGGD
RPAWRFTREE
Cn
c1
----------
--....------.--
--.--------
-------.-VV
–V-G---V--
-------S--
----S-
PC-LRP
-GR--TLTES
EQPSLW--RRV-K-E
DGQE-VQ-V-K
TDLL-ATWYAD
V-PD-MIVI-
SI--APPFTP
G-V-Q
BP
GV
GG
EY
AT
VE
GA
RR
PV
KA
ECCGGGGGTGGGGGGGGAGTACGCTACCGTAGAAGGAGCTCGCCGACCCGTCAAGGCCGAA
60
PN
TP
PF
FE
IW
QV
TR
NA
DG
CCTAACACACCTCCCTTCTTTGAGCAACAAATCTGGCAGGTCACTCGGAATGCCGACGGC
120
QY
TI
KY
QG
LN
TP
FE
YG
FS
YD
CAATACACCATCAAATATCAAGGGTTGAACACCCCTTTTGAGTACGGATTTTCTTACGAT
180
EL
EP
NA
PV
IA
GD
PK
EY
IL
QL
GAGCTTGAGCCGAATGCACCCGTCATCGCTGGAGACCCAAAGGAATACATTCTTCAGCTT
240
VP
ST
AD
VY
II
RA
PI
QR
IG
VD
GTCCCTTCTACTGCTGATGTTTACATCATCAGGGCCCCTATACAGCGTATTGGCGTAGAC
300
VV
VG
VQ
GN
TL
VY
KF
FP
VD
GS
GTTGTCGTTGGTGTACAGGGGAACACTCTTGTTTATAAATTTTTCCCTGTTGATGGTTCT
360
by guest on August 13, 2019
http://ww
w.jbc.org/
Dow
nloaded from
![Page 33: CLITOCYPIN, A NEW TYPE OF CYSTEINE PROTEINASE … · The protein sample was introduced at a flow rate of 10 µmol/min using a syringe pump. Spectra were obtained by scanning from](https://reader030.vdocuments.us/reader030/viewer/2022041204/5d53971888c993a7588bd116/html5/thumbnails/33.jpg)
33
TABLE I
Kinetic data for the interaction of clitocypin with different cysteine proteinases
Kinetic and equilibrium constants for the inhibition of papain and cathespin L were
determined under pseudo first-order conditions in continous kinetic assays and calculated as
described under “Experimental Procedures”. Equilibrium constants for the inhibition of
cathepsin B and bromelain were determined in stopped assays as described in “Experimental
Procedures”. Interactions were performed at 25oC.
Enzyme 10-6 x kass 104 x kdiss Ki
M-1s-1 s-1 nM
Papain 1.6 ± 0.20 9.5 ±1.71 0.59 ± 0.15
Cathepsin L 0.8 ± 0.15 3.3 ± 0.79 0.41 ± 0.14
Cathepsin B ND ND 480 ± 90
Bromelain ND ND 160 ± 70
a ND is not determined.
by guest on August 13, 2019
http://ww
w.jbc.org/
Dow
nloaded from
![Page 34: CLITOCYPIN, A NEW TYPE OF CYSTEINE PROTEINASE … · The protein sample was introduced at a flow rate of 10 µmol/min using a syringe pump. Spectra were obtained by scanning from](https://reader030.vdocuments.us/reader030/viewer/2022041204/5d53971888c993a7588bd116/html5/thumbnails/34.jpg)
Joze Brzin, Boris Rogelj, Tatjana Popovic, Borut Strukelj and Anka RitonjaFROM FRUIT BODIES OF MUSHROOM Clitocybe nebularis
CLITOCYPIN, A NEW TYPE OF CYSTEINE PROTEINASE INHIBITOR
published online March 23, 2000J. Biol. Chem.
10.1074/jbc.M001392200Access the most updated version of this article at doi:
Alerts:
When a correction for this article is posted•
When this article is cited•
to choose from all of JBC's e-mail alertsClick here
by guest on August 13, 2019
http://ww
w.jbc.org/
Dow
nloaded from