Upload File

cladogram

12

Upload: gary-dickens

Post on 27-Jan-2017

124 views

Category:

Science


0 download

Report

TRANSCRIPT

Page 1: Cladogram
Page 2: Cladogram
Page 3: Cladogram
Page 4: Cladogram
Page 5: Cladogram
Page 6: Cladogram
Page 7: Cladogram
Page 8: Cladogram
Page 9: Cladogram
Page 10: Cladogram
Page 11: Cladogram
Page 12: Cladogram

The Cladogram of Animals

Tree of Life (Fetal Pig) Cladogram Bailey and Will

Evolution. Change in a population of organisms over time. Cladogram – a chart that shows an organism’s evolutionary history

Complete cladogram with annotated classification. The tree …currents.plos.org/treeoflife/files/2013/04/Fig_S1_Complete_tree... · Syngnathidae_Corythoichthys_schultzi Gadidae_Pollachius_virens

3/15/19 Chapter 15 · Broughton High School 23 | P a g e Academic Biology Chapter 15 – Evolution Carson /Davis Reading a Cladogram A cladogram is a diagram used in cladistics which

Do Now - Weeblyupegui.weebly.com/uploads/5/0/7/0/5070642/evolution1.pdf · •A cladogram –Is a depiction of patterns of shared characteristics among taxa •A clade within a cladogram

CLADOGRAM QUESTIONS · 2021. 1. 8. · Curly Antennae 13. 14. Wings 6 legs Segmented Body Double set Of wings Circle the correct answer for the cladogram question below. Circle the

mundyapscience.weebly.commundyapscience.weebly.com/.../ap_bio_evolution_review.docx · Web viewDraw a cladogram that shows the evolution of heart chambers in these five types of animals

Classification of Living Things Eubacteria Archaebacteria Protista Plantae Fungi Animalia DOMAIN BACTERIA DOMAIN ARCHAEA DOMAIN EUKARYA Cladogram of Six

Vertebrates Hagfish Lampreys Sharks Bony fish Land vertebrates Coelacanth Many groups known only from fossils Cladogram of vertebrates, stressing early

What is a synapomorphy?. Terms systematics [taxonomy, phylogenetics] phylogeny/phylogenetic tree cladogram tips, branches, nodes homology apomorphy synapomorhy

EVOLUTION REVIEW Do Now: Turn in cladogram labs from yesterday

Reading and Making a Cladogram

Laois Fitzpatrick Cladogram* v.LFP1a 20170201 Fitzpatrick Cladogram 22... · see 28 YSTR haplotypes with 33 FTDNA loci; ... (1995) when using RM, or Bandelt et al. (1999) when using

Lab Investigation 3: BLASTharenberg.weebly.com/uploads/4/7/5/4/47544635/2017... · Lab Investigation 3: BLAST ... You will use the information to construct a cladogram. A cladogram

A Cladistic Analysis of Phenotypic Associations …sented by the cladogram. Obviously, the power of the cladistic approach de- pends upon the confidence one has in the cladogram and

Supplementary figure 1: Bayesian cladogram of MT … · pksr mt acp (ks14) dh acp ks15 acp te mlntedilckmlfaqlqsigfftesksqpvlenfygrwfeesqsilerhqflkrtenghvptrsigtmse

Cladograms. What does a cladogram show us? A cladogram shows evolutionary relationships between groups of living things. It is like a family tree for

Weeblymarunden.weebly.com/uploads/5/9/7/0/59704741/cladogram.pdf · CLADOGRAM ANALYSIS Date: Hour: What is a cladogram? It is a diagram that depicts evolutionary relationships among

Molecular Systematics & Ethnobotany Case Study: …herbarium.millersville.edu/class-web/325/lec-breadfruit.pdfA. tamaran A. treculianus Portion of most parsimonious cladogram Conclusions:

Phenetic, cladistic, cladogram, phylogenetics

How Languages Work - Cambridge University Pressassets.cambridge.org/97805217/67446/frontmatter/... · A cladogram showing similarity among some Indo-European languages 279 ... Santa

Biology Essentials - 006waterworthapbiology.weebly.com/uploads/2/2/2/1/...Biology Essentials - 006 bozemanscience.com. Phylogenetics Phylogenetic! Tree Cladogram Speciation Morphological

Supplementary Figure S1. Cladogram for the …...Supplementary Figure S1. Cladogram for the Poaceae. Based on the combined Bayesian phylogenetic analysis of molecular and morphological

SULCOMANIA 2018 · 2018-12-29 · Click on Cladogram and the cladogram is calculated. Click with the left mouse button on a field number in the cladogram. The mouse icon changes into

3 CoMParING DNa SeQUeNCeS to UNDerStaND eVoLUtIoNarY ... · farther apart on a cladogram. Can you draw a cladogram that depicts the evolutionary relationship among humans, chimpanzees,

A Cladogram and Taxonomy for Emotionsscholarpublishing.org/Repository/ASSRJ-16-2204.pdf · A Cladogram and Taxonomy for Emotions Lawrence J. Cookson LJ Cookson Consulting, Warrandyte,

Tree of Life (Fetal Pig) Cladogram

Natural Selection and Evolution - Edgenuity Inc.€¦ · evolutionary relationships displayed between organisms on a cladogram and explain how understanding evolutionary history impacts

Branches, splits, bipartitions In a rooted tree: clades Mono-, Para-, polyphyletic groups, cladists and a natural taxonomy Terminology The term cladogram

A Cladogram of Plant Groups – shows evolutionary relationships of plants

What ´s a cladogram

Guided Notes: Classification - Weeblytelfort.weebly.com/.../guided_notes_classification.doc · Web viewTypes of Cladograms Building a Cladogram Using the information above complete

Reading and Making a Cladogram. Cladogram – What is it? An evolutionary family tree Used to be based on physical appearance Now based on similar DNA sequences,

Dispatch—Explain this cladogram Practice Evolution Quiz