Upload File

cladogram

12

Upload: gary-dickens

Post on 27-Jan-2017

124 views

Category:

Science


0 download

Report

TRANSCRIPT

Page 1: Cladogram
Page 2: Cladogram
Page 3: Cladogram
Page 4: Cladogram
Page 5: Cladogram
Page 6: Cladogram
Page 7: Cladogram
Page 8: Cladogram
Page 9: Cladogram
Page 10: Cladogram
Page 11: Cladogram
Page 12: Cladogram

Branches, splits, bipartitions In a rooted tree: clades Mono-, Para-, polyphyletic groups, cladists and a natural taxonomy Terminology The term cladogram

Cladogram Building - 1

Weeblymarunden.weebly.com/uploads/5/9/7/0/59704741/cladogram.pdf · CLADOGRAM ANALYSIS Date: Hour: What is a cladogram? It is a diagram that depicts evolutionary relationships among

ACTIVITY: Telephone Cladograms Telephone Cladogram Activity.pdf2. Good! Now, let’s consider a more complex cladogram that traces the evolution of telephones from Alexander Graham

A Cladistic Analysis of Phenotypic Associations …sented by the cladogram. Obviously, the power of the cladistic approach de- pends upon the confidence one has in the cladogram and

Tree of Life (Fetal Pig) Cladogram Bailey and Will

The Cladogram The cladogram is used to show evolutionary relationships between organisms, NOT ancestry. The human shares more DNA with the Chimpanzee than

Classification of Living Things Eubacteria Archaebacteria Protista Plantae Fungi Animalia DOMAIN BACTERIA DOMAIN ARCHAEA DOMAIN EUKARYA Cladogram of Six

Cladogram of Animals

Phylum Chordata. Section 30-1 Nonvertebrate chordates Fishes Amphibians Reptiles Birds Mammals Invertebrate ancestor Chordate Cladogram

INVERTEBRATE CLADOGRAM PHYLYM MOLLUSCAblogs.ubc.ca/mrpletsch/files/2019/07/karenyeung_invertebrate-cladogram.pdf · PHYLYM PORIFERA Appeared ~700 million years ago. Is sessile and

Reading and Making a Cladogram

How Languages Work - Cambridge University Pressassets.cambridge.org/97805217/67446/frontmatter/... · A cladogram showing similarity among some Indo-European languages 279 ... Santa

Complete cladogram with annotated classification. The tree …currents.plos.org/treeoflife/files/2013/04/Fig_S1_Complete_tree... · Syngnathidae_Corythoichthys_schultzi Gadidae_Pollachius_virens

Cladograms. What does a cladogram show us? A cladogram shows evolutionary relationships between groups of living things. It is like a family tree for

Maximum parsimony Kai Müller. Phylogenetic trees Cladogram – Branch lenghts without meaning – Slanted/rectangular – Network/unrooted Parenthetical notation

mrdoddswebsite.weebly.com · A cladogram shows evolutionary relationships between species. You can think of a cladogram as a type of family tree. Follow the directions to draw a cladogram

Supplementary figure 1: Bayesian cladogram of MT … · pksr mt acp (ks14) dh acp ks15 acp te mlntedilckmlfaqlqsigfftesksqpvlenfygrwfeesqsilerhqflkrtenghvptrsigtmse

PHYLOGENY SYSTEMATICS HYPOTHESIS CLADISTICS DERIVED CHARACTER CLADOGRAM DICHOTOMOUS KEY

Reading and Making a Cladogram. Cladogram – What is it? An evolutionary family tree Used to be based on physical appearance Now based on similar DNA sequences,

Evolution. Change in a population of organisms over time. Cladogram – a chart that shows an organism’s evolutionary history

Guided Notes: Classification - Weeblytelfort.weebly.com/.../guided_notes_classification.doc · Web viewTypes of Cladograms Building a Cladogram Using the information above complete

3 CoMParING DNa SeQUeNCeS to UNDerStaND eVoLUtIoNarY ... · farther apart on a cladogram. Can you draw a cladogram that depicts the evolutionary relationship among humans, chimpanzees,

The Cladogram of Animals

What ´s a cladogram

Evolution. Definition: Change in a population of organisms over time. Modern Humans Human evolution illustrated on a cladogram

Vertebrates Hagfish Lampreys Sharks Bony fish Land vertebrates Coelacanth Many groups known only from fossils Cladogram of vertebrates, stressing early

Do Now - Weeblyupegui.weebly.com/uploads/5/0/7/0/5070642/evolution1.pdf · •A cladogram –Is a depiction of patterns of shared characteristics among taxa •A clade within a cladogram

spider.art.coocan.jpspider.art.coocan.jp/tokyoss2/spiderphylogeny2013.pdf · phylogenetic context, a phylogenetic cladogram of spiders is given here. However, ... Roth V (eds) Spiders

Dispatch—Explain this cladogram Practice Evolution Quiz

SULCOMANIA 2018 · 2018-12-29 · Click on Cladogram and the cladogram is calculated. Click with the left mouse button on a field number in the cladogram. The mouse icon changes into

Laois Fitzpatrick Cladogram* v.LFP1a 20170201 Fitzpatrick Cladogram 22... · see 28 YSTR haplotypes with 33 FTDNA loci; ... (1995) when using RM, or Bandelt et al. (1999) when using

3/15/19 Chapter 15 · Broughton High School 23 | P a g e Academic Biology Chapter 15 – Evolution Carson /Davis Reading a Cladogram A cladogram is a diagram used in cladistics which

Natural Selection and Evolution - Edgenuity Inc.€¦ · evolutionary relationships displayed between organisms on a cladogram and explain how understanding evolutionary history impacts

EVOLUTION REVIEW Do Now: Turn in cladogram labs from yesterday