apollo: a workshop for the manakin research coordination network
TRANSCRIPT
![Page 1: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/1.jpg)
Introduction to Apollo A workshop for the Manakin Research Coordination Network
Monica Munoz-Torres, PhD | @monimunozto
Berkeley Bioinformatics Open-Source Projects (BBOP)Lawrence Berkeley National Laboratory | University of California Berkeley | U.S. Department of Energy
Smithsonian-Mason School of Conservation, Front Royal, VA, USA | 16 August, 2015
![Page 2: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/2.jpg)
OUTLINE
Web Apollo Collabora've Cura'on and Interac've Analysis of Genomes
2 OUTLINE
• MANUAL ANNOTATION necessary, collabora've
• APOLLO
empowering collabora've cura'on • EXAMPLE
demonstra'ons
![Page 3: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/3.jpg)
3
A Genome Sequencing Project
Introduction
Assembly Automated Annotation
Manual annotation
Using Web Apollo
Merge: automated +
manual
Genome-wide & gene-specific comparative
analyses
QC
QC
Synthesis & dissemination.
Experimental design, sample collection preparation.
QC Sequencing
QC
QC
![Page 4: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/4.jpg)
REVIEW ON YOUR OWNfor manual annotation
To remember… Biological concepts to be=er understand manual annota'on
4 FOOD FOR THOUGHT
• GLOSSARY from con$g to splice site
• CENTRAL DOGMA
in molecular biology • WHAT IS A GENE?
defining your goal
• TRANSCRIPTION mRNA in detail
• TRANSLATION
and other defini'ons
• GENOME CURATION steps involved
![Page 5: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/5.jpg)
5
BY THE END OF THIS TALKyou will
v Be=er understand genome cura'on in the context of annota'on: assembled genome à automated annota=on à manual annota=on
v Become familiar with the environment and func'onality of the Apollo genome annota'on edi'ng tool.
v Learn to iden'fy homologs of known genes of interest in a newly sequenced genome.
v Learn about corrobora'ng and modifying automa'cally annotated gene models using available evidence in Apollo.
Introduction
![Page 6: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/6.jpg)
6 CURATING GENOMES
What is a gene?
v The defini'on of a gene paints a very complex picture of molecular ac'vity and it is a con'nuously evolving concept.
• From the Sequence Ontology (SO): “A gene is a locatable region of genomic sequence, corresponding to a unit of inheritance, which is associated with regulatory regions, transcribed regions and/or other func'onal sequence regions”. “Evolving Concept” at h=p://goo.gl/LpsajQ
![Page 7: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/7.jpg)
7 CURATING GENOMES
What is a gene?
v In our life'me, the Encyclopedia of DNA Elements (ENCODE) project updated this concept yet again. Long transcripts & dispersed regula$on!
“A gene is a DNA segment that contributes phenotype/func'on. In the absence of demonstrated func'on, a gene may be characterized by sequence, transcrip'on or homology.”
https://www.encodeproject.org/
![Page 8: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/8.jpg)
8 CURATING GENOMES
What is a gene?considerations
v Consider : • A gene is a genomic sequence (DNA or RNA) directly encoding
func'onal product molecules, either RNA or protein.
• If several func'onal products share overlapping regions, we take the union of all overlapping genomics sequences coding for them.
• This union must be coherent – i.e., processed separately for final protein and RNA products – but does not require that all products necessarily share a common subsequence.
Gerstein et al., 2007. Genome Res.
![Page 9: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/9.jpg)
9 CURATING GENOMES
What is a gene? “The gene is a union of genomic sequences encoding a coherent set of poten'ally
overlapping func'onal products.”
Gerstein et al., 2007. Genome Res
![Page 10: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/10.jpg)
10 CURATING GENOMES
TRANSLATIONreading frame
v Reading frame is a manner of dividing the sequence of nucleo'des in mRNA (or DNA) into a set of consecu've, non-‐overlapping triplets (codons).
v Three frames can be read in the 5’ à 3’ direc'on. Given that DNA has two an'-‐parallel strands, an addi'onal three frames are possible to be read on the an'-‐sense strand. Six total possible reading frames exist.
v In eukaryotes, only one reading frame per sec'on of DNA is biologically relevant at a 'me: it has the poten'al to be transcribed into RNA and translated into protein. This is called the OPEN READING FRAME (ORF) • ORF = Start signal + coding sequence (divisible by 3) + Stop signal
v The sec'ons of the mature mRNA transcribed with the coding sequence but not translated are called UnTranslated Regions (UTR); one at each end.
![Page 11: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/11.jpg)
11 CURATING GENOMES
TRANSLATIONreading frame: splice sites
v The spliceosome catalyzes the removal of introns and the liga'on of flanking exons. • introns: spaces inside the gene, not part of the coding sequence • exons: expression units (of the coding sequence)
v Splicing “signals” (from the point of view of an intron): • There is a 5’ end splice “signal” (site): usually GT (less common: GC) • And a 3’ end splice site: usually AG • …]5’-‐GT/AG-‐3’[…
v It is possible to produce more than one protein (polypep'de) sequence from the same genic region, by alterna'vely bringing exons together= alterna=ve splicing. For example, the gene Dscam (Drosophila) has 38,000 alterna'vely spliced mRNAs = isoforms
![Page 12: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/12.jpg)
12
"Gene structure" by Daycd- Wikimedia Commons
CURATING GENOMES
TRANSLATIONnow in your mind
![Page 13: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/13.jpg)
13
Text for figures goes here
CURATING GENOMES
TRANSLATIONreading frame: phase
v Introns can interrupt the reading frame of a gene by inser'ng a sequence between two consecu've codons
v Between the first and second nucleo'de of a codon
v Or between the second and third nucleo'de of a codon
"Exon and Intron classes”. Licensed under Fair use via Wikipedia
![Page 14: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/14.jpg)
CURATING GENOMESoverview
1 Predic=on of Gene Models
2 Annota=on of gene models
3 Manual annota=on
CURATING GENOMES 14
![Page 15: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/15.jpg)
15 Gene Prediction
GENE PREDICTION
v The iden'fica'on of structural features of the genome:
• Primarily focused on protein-‐coding genes. • Predicts also transfer RNAs (tRNA), ribosomal RNAs (rRNA),
regulatory mo'fs, long and small non-‐coding RNAs (ncRNA), repe''ve elements (masked), etc.
• Two methods for iden'fica'on. • Some are self-‐trained and some must be trained.
![Page 16: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/16.jpg)
16 Gene Prediction
GENE PREDICTIONmethods for discovery
1) Ab ini,o: -‐ based on DNA composi'on, -‐ deals strictly with genomic sequences -‐ makes use of sta's'cal approaches to search for coding regions and typical gene signals. • E.g. Augustus, GENSCAN,
geneid, fgenesh, etc.
3’
Nat Rev Genet. 2015 Jun;16(6):321-32. doi: 10.1038/nrg3920
![Page 17: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/17.jpg)
17
Nucleic Acids 2003 vol. 31 no. 13 3738-3741
Gene Prediction
GENE PREDICTIONmethods for discovery (ctd)
2) Homology-‐based: -‐ evidence-‐based, -‐ finds genes using either similarity searches in the main databases or experimental data including RNAseq, expressed sequence tags (ESTs), full-‐length complementary DNAs (cDNAs), etc.
• E.g: fgenesh++, Just Annotate My genome (JAMg), SGP2
![Page 18: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/18.jpg)
18
GENE ANNOTATION
Integra'on of data from computa'onal & experimental evidence with data from predic'on tools, to generate a reliable set of structural annota=ons. Involves: 1) ab ini$o predic'ons 2) assessment of biological evidence to drive the gene predic'on process 3) synthesis of these results to produce a set of consensus gene models
Gene Annotation
![Page 19: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/19.jpg)
19
In some cases algorithms and metrics used to generate consensus sets may actually reduce the accuracy of the gene’s representa'on.
GENE ANNOTATION
Gene models may be organized into “sets” using: v automa'c integra'on of predicted sets (combiners); e.g: GLEAN,
EvidenceModeler or
v tools packaged into pipelines; e.g: MAKER, PASA, Gnomon, Ensembl, etc.
Gene Annotation
![Page 20: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/20.jpg)
ANNOTATION IS NOT PERFECT automated annotation remains an imperfect art
Unlike the more highly polished genomes of earlier projects, today’s genomes usually have:
• more frequent assembly errors, which lead to annota'on of genes across mul'ple scaffolds
• lower coverage
No one is perfect, least of all automated annotation. 20
Image: www.BroadInstitute.org
![Page 21: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/21.jpg)
MANUAL ANNOTATIONworking concept
Precise elucida=on of biological features encoded in the genome requires careful
examina=on and review.
Schiex et al. Nucleic Acids 2003 (31) 13: 3738-‐3741
Automated Predictions
Experimental Evidence
Manual Annotation – to the rescue. 21
cDNAs, HMM domain searches, RNAseq, genes from other species.
![Page 22: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/22.jpg)
22
MANUAL ANNOTATIONobjectives
Iden=fies elements that best represent the underlying biology and eliminates elements that reflect systemic errors of automated analyses.
Assigns func=on through compara've analysis of similar genome elements from closely related species using literature, databases, and experimental data.
MANUAL ANNOTATION
h=p://GeneOntology.org
1
2
![Page 23: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/23.jpg)
BUT, MANUAL CURATIONdoes not always scale
Researchers on their own; may or may not publicize results; may be a dead-‐end with very few people ever aware of these results.
Elsik et al. 2006. Genome Res. 16(11):1329-‐33.
MANUAL ANNOTATION 23
Too many sequences and not enough hands.
A small group of highly trained experts (e.g. GO).
1 Museum
A few very good biologists, a few very good bioinforma'cians camping together for intense but short periods of 'me.
Jamboree 2
Co^age 3
![Page 24: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/24.jpg)
GENOME ANNOTATIONan inherently collaborative task
APOLLO 24
Researchers oBen turn to colleagues for second opinions and insight from those with exper$se in par$cular areas (e.g.,
domains, families).
![Page 25: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/25.jpg)
APOLLOcollaborative genome annotation editing tool
25
v Web based, integrated with JBrowse. v Supports real 'me collabora'on! v Automa'c genera'on of ready-‐made computable data. v Supports annota'on of genes, pseudogenes, tRNAs, snRNAs,
snoRNAs, ncRNAs, miRNAs, TEs, and repeats. v Intui've annota'on, gestures, and pull-‐down menus to create and
edit transcripts and exons structures, insert comments (CV, freeform text), associate GO terms, etc.
APOLLO
h=p://GenomeArchitect.org
![Page 26: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/26.jpg)
APOLLO ARCHITECTUREsimpler, more flexible
APOLLO 26
Web-‐based client + annota'on-‐edi'ng engine + server-‐side data service
REST / JSON Websockets
Annotation Engine (Server)
Shiro
LDAP
OAuth
JBrowse Data Organism 2
Annotations
Security
Preferences
Organisms
Tracks
BAM BED VCF GFF3 BigWig
Annotators
Google Web Toolkit (GWT) / Bootstrap
JBrowse DOJO / jQuery JBrowse Data Organism 1
Load genomic evidence for selected organism
Single Data Store PostgreSQL, MySQL,
MongoDB, ElasticSearch
Apollo v2.0
![Page 27: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/27.jpg)
We train and support hundreds of geographically dispersed scien'sts from diverse research communi'es to conduct manual annota'ons, to recover coding sequences in agreement with all available biological evidence using Apollo. v Gate keeping and monitoring. v Tutorials, training workshops, and “geneborees”.
27
DISPERSED COMMUNITIES collaborative manual annotation efforts
APOLLO
![Page 28: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/28.jpg)
LESSONS LEARNED
What we have learned: • Collabora've work dis'lls invaluable knowledge • We must enforce strict rules and formats • We must evolve with the data • A li=le training goes a long way • NGS poses addi'onal challenges
LESSONS LEARNED 28
![Page 29: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/29.jpg)
Apollo h=p://genomearchitect.org/web_apollo_user_guide
![Page 30: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/30.jpg)
1. Select or find a region of interest, e.g. scaffold. 2. Select appropriate evidence tracks to review the gene model.
3. Determine whether a feature in an exis'ng evidence track will provide a reasonable gene model to start working.
4. If necessary, adjust the gene model.
5. Check your edited gene model for integrity and accuracy by comparing it with available homologs.
6. Comment and finish.
Becoming Acquainted with Web Apollo 30 | 30
GENERAL PROCESS OF CURATIONmain steps to remember
![Page 31: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/31.jpg)
31
APOLLOannotation editing environment
BECOMING ACQUAINTED WITH APOLLO
Color by CDS frame, toggle strands, set color scheme and highlights.
Upload evidence files (GFF3, BAM, BigWig), add combina=on and sequence search tracks.
Query the genome using BLAT.
Naviga'on and zoom.
Search for a gene model or a scaffold.
Get coordinates and “rubber band” selec'on for zooming.
Login
User-‐created annota'ons. Annotator
panel.
Evidence Tracks
Stage and cell-‐type specific transcrip'on data.
![Page 32: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/32.jpg)
REMOVABLE SIDE DOCKwith customizable tabs
HIGHLIGHTED IMPROVEMENTS 32
Annotations Organism Users Groups Admin Tracks Reference Sequence
![Page 33: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/33.jpg)
EDITS & EXPORTSannotation details, exon boundaries, data export
HIGHLIGHTED IMPROVEMENTS 33
1 2
Annotations
1
2
![Page 34: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/34.jpg)
HIGHLIGHTED IMPROVEMENTS 34
Reference Sequences
3
FASTA
GFF3
EDITS & EXPORTSannotation details, exon boundaries, data export
3
![Page 35: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/35.jpg)
Sort
35 Becoming Acquainted with Web Apollo.
35
APOLLOthe [old] sequence selection window
![Page 36: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/36.jpg)
36 | 36 Becoming Acquainted with Web Apollo.
USER NAVIGATION
Annotator panel.
• Choose appropriate evidence tracks from list on annotator panel. • Select & drag elements from evidence track into the ‘User-created Annotations’ area. • Hovering over annotation in progress brings up an information pop-up.
![Page 37: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/37.jpg)
37 | 37
USER NAVIGATION
Becoming Acquainted with Web Apollo.
• Annotation right-click menu
![Page 38: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/38.jpg)
38
Annota'ons, annota'on edits, and History: stored in a centralized database.
38
USER NAVIGATION
Becoming Acquainted with Web Apollo.
![Page 39: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/39.jpg)
39
The Annota'on Informa=on Editor
DBXRefs are database crossed references: if you have reason to believe that this gene is linked to a gene in a public database (including your own), then add it here.
39
USER NAVIGATION
Becoming Acquainted with Web Apollo.
![Page 40: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/40.jpg)
40
The Annota'on Informa=on Editor
• Add PubMed IDs • Include GO terms as appropriate
from any of the three ontologies • Write comments sta'ng how you
have validated each model.
40
USER NAVIGATION
Becoming Acquainted with Web Apollo.
![Page 41: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/41.jpg)
41 | 41
USER NAVIGATION
Becoming Acquainted with Web Apollo.
• ‘Zoom to base level’ op'on reveals the DNA Track.
![Page 42: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/42.jpg)
42 | 42
USER NAVIGATION
Becoming Acquainted with Web Apollo.
• Color exons by CDS from the ‘View’ menu.
![Page 43: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/43.jpg)
43 |
Zoom in/out with keyboard: shiv + arrow keys up/down
43
USER NAVIGATION
Becoming Acquainted with Web Apollo.
• Toggle reference DNA sequence and transla=on frames in forward strand. Toggle models in either direc'on.
![Page 44: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/44.jpg)
Annota'ng
![Page 45: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/45.jpg)
simple cases
![Page 46: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/46.jpg)
“Simple case”: -‐ the predicted gene model is correct or nearly correct, and
-‐ this model is supported by evidence that completely or mostly agrees with the predic'on.
-‐ evidence that extends beyond the predicted model is assumed to be non-‐coding sequence.
The following are simple modifica'ons.
46 | 46
ANNOTATING SIMPLE CASES
Becoming Acquainted with Web Apollo. SIMPLE CASES
![Page 47: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/47.jpg)
47 |
• A confirma'on box will warn you if the receiving transcript is not on the same strand as the feature where the new exon originated.
• Check ‘Start’ and ‘Stop’ signals aver each edit.
47
ADDING EXONS
Becoming Acquainted with Web Apollo. SIMPLE CASES
![Page 48: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/48.jpg)
If transcript alignment data are available and extend beyond your original annota'on, you may extend or add UTRs.
1. Right click at the exon edge and ‘Zoom to base level’.
2. Place the cursor over the edge of the exon un$l it becomes a black arrow then click and drag the edge of the exon to the new coordinate posi'on that includes the UTR.
48 |
To add a new spliced UTR to an exis'ng annota'on follow the procedure for adding an exon.
48
ADDING UTRs
Becoming Acquainted with Web Apollo. SIMPLE CASES
![Page 49: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/49.jpg)
1. Zoom in to clearly resolve each exon as a dis'nct rectangle.
2. Two exons from different tracks sharing the same start and/or end coordinates will display a red bar to indicate matching edges.
3. Selec'ng the whole annota'on or one exon at a 'me, use this ‘edge-‐matching’ func'on and scroll along the length of the annota'on, verifying exon boundaries against available data. Use square [ ] brackets to scroll from exon to exon.
4. Check if cDNA / RNAseq reads lack one or more of the annotated exons or include addi'onal exons.
49 | 49
CHECK EXON INTEGRITY
Becoming Acquainted with Web Apollo. SIMPLE CASES
![Page 50: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/50.jpg)
To modify an exon boundary and match data in the evidence tracks: select both the offending exon and the feature with the expected boundary, then right click on the annota'on to select ‘Set 3’ end’ or ‘Set 5’ end’ as appropriate.
50 |
In some cases all the data may disagree with the annota'on, in other cases some data support the annota'on and some of the
data support one or more alterna've transcripts. Try to annotate as many alterna've transcripts as are well supported by the data.
50
EXON STRUCTURE INTEGRITY
Becoming Acquainted with Web Apollo. SIMPLE CASES
![Page 51: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/51.jpg)
Flags non-‐canonical splice sites.
Selec'on of features and sub-‐features
Edge-‐matching
Evidence Tracks Area
‘User-‐created Annota'ons’ Track
Apollo’s edi'ng logic (brain): § selects longest ORF as CDS § flags non-‐canonical splice sites
51
ORFs AND SPLICE SITES
Becoming Acquainted with Web Apollo. SIMPLE CASES
![Page 52: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/52.jpg)
52 |
Exon/intron junc'on possible error
Original model
Curated model
Non-‐canonical splices are indicated by an orange circle with a white exclama'on point inside, placed over the edge of the offending exon.
Canonical splice sites:
3’-‐…exon]GA / TG[exon…-‐5’
5’-‐…exon]GT / AG[exon…-‐3’ reverse strand, not reverse-‐complemented:
forward strand
52
SPLICE SITES
Becoming Acquainted with Web Apollo. SIMPLE CASES
Zoom to review non-‐canonical splice site warnings. Although these may not always have to be corrected (e.g GC donor), they should be flagged with the appropriate comment.
![Page 53: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/53.jpg)
Web Apollo calculates the longest possible open reading frame (ORF) that includes canonical ‘Start’ and ‘Stop’ signals within the predicted exons.
If ‘Start’ appears to be incorrect, modify it by selec'ng an in-‐frame ‘Start’ codon further up or downstream, depending on evidence (protein database, addi'onal evidence tracks).
It may be present outside the predicted gene model, within a region supported by another evidence track.
In very rare cases, the actual ‘Start’ codon may be non-‐canonical (non-‐ATG).
53 | 53
‘START’ AND ‘STOP’ SITES
Becoming Acquainted with Web Apollo. SIMPLE CASES
![Page 54: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/54.jpg)
complex cases
![Page 55: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/55.jpg)
Evidence may support joining two or more different gene models. Warning: protein alignments may have incorrect splice sites and lack non-‐conserved regions!
1. In ‘User-‐created Annota=ons’ area shiv-‐click to select an intron from each gene model and right click to select the ‘Merge’ op'on from the menu.
2. Drag suppor'ng evidence tracks over the candidate models to corroborate overlap, or review edge matching and coverage across models.
3. Check the resul'ng transla'on by querying a protein database e.g. UniProt. Add comments to record that this annota'on is the result of a merge.
55 | 55
Red lines around exons: ‘edge-‐matching’ allows annotators to confirm whether the evidence is in agreement without examining each exon at the base level.
COMPLEX CASES merge two gene predictions on the same scaffold
Becoming Acquainted with Web Apollo. COMPLEX CASES
![Page 56: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/56.jpg)
One or more splits may be recommended when: -‐ different segments of the predicted protein align to two or more different gene families -‐ predicted protein doesn’t align to known proteins over its en're length
Transcript data may support a split, but first verify whether they are alterna've transcripts.
56 | 56
COMPLEX CASES split a gene prediction
Becoming Acquainted with Web Apollo. COMPLEX CASES
![Page 57: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/57.jpg)
DNA Track
‘User-‐created Annota=ons’ Track
57
COMPLEX CASES correcting frameshifts and single-base errors
Becoming Acquainted with Web Apollo. COMPLEX CASES
Always remember: when annota'ng gene models using Apollo, you are looking at a ‘frozen’ version of the genome assembly and you will not be able to modify the assembly itself.
![Page 58: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/58.jpg)
58
COMPLEX CASES correcting selenocysteine containing proteins
Becoming Acquainted with Web Apollo. COMPLEX CASES
![Page 59: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/59.jpg)
59
COMPLEX CASES correcting selenocysteine containing proteins
Becoming Acquainted with Web Apollo. COMPLEX CASES
![Page 60: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/60.jpg)
1. Apollo allows annotators to make single base modifica'ons or frameshivs that are reflected in the sequence and structure of any transcripts overlapping the modifica'on. These manipula'ons do NOT change the underlying genomic sequence.
2. If you determine that you need to make one of these changes, zoom in to the nucleo'de level and right click over a single nucleo'de on the genomic sequence to access a menu that provides op'ons for crea'ng inser'ons, dele'ons or subs'tu'ons.
3. The ‘Create Genomic Inser=on’ feature will require you to enter the necessary string of nucleo'de residues that will be inserted to the right of the cursor’s current loca'on. The ‘Create Genomic Dele=on’ op'on will require you to enter the length of the dele'on, star'ng with the nucleo'de where the cursor is posi'oned. The ‘Create Genomic Subs=tu=on’ feature asks for the string of nucleo'de residues that will replace the ones on the DNA track.
4. Once you have entered the modifica'ons, Apollo will recalculate the corrected transcript and protein sequences, which will appear when you use the right-‐click menu ‘Get Sequence’ op'on. Since the underlying genomic sequence is reflected in all annota'ons that include the modified region you should alert the curators of your organisms database using the ‘Comments’ sec'on to report the CDS edits.
5. In special cases such as selenocysteine containing proteins (read-‐throughs), right-‐click over the offending/premature ‘Stop’ signal and choose the ‘Set readthrough stop codon’ op'on from the menu.
60 | 60 Becoming Acquainted with Web Apollo. COMPLEX CASES
COMPLEX CASES correcting frameshifts, single-base errors, and selenocysteines
![Page 61: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/61.jpg)
Follow the checklist un'l you are happy with the annota'on!
And remember to… – comment to validate your annota'on, even if you made no changes to an exis'ng model. Think of comments as your vote of confidence.
– or add a comment to inform the community of unresolved issues you think this model may have.
61 | 61
Always Remember: Web Apollo cura'on is a community effort so please use comments to communicate the reasons for your
annota'on (your comments will be visible to everyone).
COMPLETING THE ANNOTATION
Becoming Acquainted with Web Apollo.
![Page 62: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/62.jpg)
Checklist
![Page 63: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/63.jpg)
1. Can you add UTRs (e.g.: via RNA-‐Seq)?
2. Check exon structures
3. Check splice sites: most splice sites display these residues …]5’-‐GT/AG-‐3’[…
4. Check ‘Start’ and ‘Stop’ sites
5. Check the predicted protein product(s) – Align it against relevant genes/gene family. – blastp against NCBI’s RefSeq or nr
6. If the protein product s'll does not look correct then check: – Are there gaps in the genome? – Merge of 2 gene predic'ons on the same scaffold
– Merge of 2 gene predic'ons from different scaffolds
– Split a gene predic'on – Frameshigs
– error in the genome assembly? – Selenocysteines, single-‐base errors, etc
63 | 63
7. Finalize annota'on by adding: – Important project informa'on in the form of
comments – IDs from public databases e.g. GenBank (via
DBXRef), gene symbol(s), common name(s), synonyms, top BLAST hits, orthologs with species names, and everything else you can think of, because you are the expert.
– Whether your model replaces one or more models from the official gene set (so it can be deleted).
– The kinds of changes you made to the gene model of interest, if any.
– Any appropriate func'onal assignments of interest to the community (e.g. via BLAST, RNA-‐Seq data, literature searches, etc.)
THE CHECKLIST for accuracy and integrity
MANUAL ANNOTATION CHECKLIST
![Page 64: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/64.jpg)
Example
![Page 65: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/65.jpg)
Example
Example 65
A public Apollo Demo using the Honey Bee genome is available at h=p://genomearchitect.org/WebApolloDemo
-‐ Demonstra'on using the Hyalella azteca genome (amphipod crustacean).
![Page 66: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/66.jpg)
What do we know about this genome?
• Currently publicly available data at NCBI: • >37,000 nucleo'de seqsà scaffolds, mitochondrial genes • 300 amino acid seqsà mitochondrion • 53 ESTs • 0 conserved domains iden'fied • 0 “gene” entries submi=ed
• Data at i5K Workspace@NAL (annota'on hosted at USDA) -‐ 10,832 scaffolds: 23,288 transcripts: 12,906 proteins
Example 66
![Page 67: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/67.jpg)
PubMed Search: what’s new?
Example 67
![Page 68: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/68.jpg)
PubMed Search: what’s new?
Example 68
“Ten popula'ons (3 cultures, 7 from California water bodies) differed by at least 550-‐fold in sensi=vity to pyrethroids.”
“By sequencing the primary pyrethroid target site, the voltage-‐gated sodium channel (vgsc), we show that point muta'ons and their spread in natural popula'ons were responsible for differences in pyrethroid sensi'vity.”
“The finding that a non-‐target aqua'c species has acquired resistance to pes'cides used only on terrestrial pests is troubling evidence of the impact of chronic pes=cide transport from land-‐based applica'ons into aqua'c systems.”
![Page 69: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/69.jpg)
How many sequences for our gene of interest?
Example 69
• Para, (voltage-‐gated sodium channel alpha subunit; Nasonia vitripennis).
• NaCP60E (Sodium channel protein 60 E; D. melanogaster). – MF: voltage-‐gated ca'on channel ac'vity (IDA, GO:0022843).
– BP: olfactory behavior (IMP, GO:0042048), sodium ion transmembrane transport (ISS,GO:0035725).
– CC: voltage-‐gated sodium channel complex (IEA, GO:0001518).
And what do we know about them?
![Page 70: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/70.jpg)
Retrieving sequences for sequence similarity searches.
Example 70
>vgsc-‐Segment3-‐DomainII RVFKLAKSWPTLNLLISIMGKTVGALGNLTFVLCIIIFIFAVMGMQLFGKNYTEKVTKFKWSQDGQMPRWNFVDFFHSFMIVFRVLCGEWIESMWDCMYVGDFSCVPFFLATVVIGNLVVSFMHR
![Page 71: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/71.jpg)
BLAT search
Example 71
>vgsc-‐Segment3-‐DomainII RVFKLAKSWPTLNLLISIMGKTVGALGNLTFVLCIIIFIFAVMGMQLFGKNYTEKVTKFKWSQDGQMPRWNFVDFFHSFMIVFRVLCGEWIESMWDCMYVGDFSCVPFFLATVVIGNLVVSFMHR
![Page 72: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/72.jpg)
BLAT search
Example 72
![Page 73: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/73.jpg)
Customizations: high-scoring segment pairs (hsp) in “BLAST+ Results” track
Example 73
![Page 74: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/74.jpg)
Creating a new gene model: drag and drop
Example 74
• Apollo automatically calculates ORF. In this case, ORF includes the high-scoring segment pairs (hsp).
![Page 75: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/75.jpg)
Available Tracks
Example 75
![Page 76: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/76.jpg)
Get Sequence
Example 76
http://blast.ncbi.nlm.nih.gov/Blast.cgi
![Page 77: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/77.jpg)
Also, flanking sequences (other gene models) vs. NCBI nr
Example 77
In this case, two gene models upstream, at 5’ end.
BLAST hsps
![Page 78: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/78.jpg)
Review alignments
Example 78
HaztTmpM006234
HaztTmpM006233
HaztTmpM006232
![Page 79: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/79.jpg)
Hypothesis for vgsc gene model
Example 79
![Page 80: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/80.jpg)
Editing: merge the three models
Example 80
Merge by dropping an exon or gene model onto another.
Merge by selec'ng two exons (holding down “Shiv”) and using the right click menu.
or…
![Page 81: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/81.jpg)
Editing: correct boundaries, delete exons
Example 81
Modify exon / intron boundary: -‐ Drag the end of the
exon to the nearest canonical splice site.
-‐ Use right-‐click menu.
Delete first exon from HaztTmpM006233
![Page 82: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/82.jpg)
Editing: set translation start
Example 82
![Page 83: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/83.jpg)
Editing: modify boundaries
Example 83
Modify intron / exon boundary also at coord. 78,999.
![Page 84: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/84.jpg)
Finished model
Example 84
Corroborate integrity and accuracy of the model: -‐ Start and Stop -‐ Exon structure and splice sites …]5’-‐GT/AG-‐3’[… -‐ Check the predicted protein product vs. NCBI nr
![Page 85: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/85.jpg)
Information Editor
• DBXRefs: e.g. NP_001128389.1, N. vitripennis, RefSeq
• PubMed iden'fier: PMID: 24065824
• Gene Ontology IDs: GO:0022843, GO:0042048, GO:0035725, GO:0001518.
• Comments.
• Name, Symbol.
• Approve / Delete radio bu=on.
Example 85
Comments (if applicable)
![Page 86: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/86.jpg)
Demo video
![Page 87: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/87.jpg)
APOLLOdemonstration
Apollo demo video available at: h=ps://youtu.be/VgPtAP_fvxY
DEMO 87
![Page 88: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/88.jpg)
Exercises
![Page 89: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/89.jpg)
![Page 90: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/90.jpg)
Exercises Live Demonstra'on using the Apis mellifera genome.
90
1. Evidence in support of protein coding gene models. 1.1 Consensus Gene Sets: Official Gene Set v3.2 Official Gene Set v1.0 1.2 Consensus Gene Sets comparison: OGSv3.2 genes that merge OGSv1.0 and RefSeq genes OGSv3.2 genes that split OGSv1.0 and RefSeq genes 1.3 Protein Coding Gene Predic=ons Supported by Biological Evidence: NCBI Gnomon Fgenesh++ with RNASeq training data Fgenesh++ without RNASeq training data NCBI RefSeq Protein Coding Genes and Low Quality Protein Coding Genes
1.4 Ab ini,o protein coding gene predic=ons: Augustus Set 12, Augustus Set 9, Fgenesh, GeneID, N-‐SCAN, SGP2 1.5 Transcript Sequence Alignment: NCBI ESTs, Apis cerana RNA-‐Seq, Forager Bee Brain Illumina Con'gs, Nurse Bee Brain Illumina Con'gs, Forager RNA-‐Seq reads, Nurse RNA-‐Seq reads, Abdomen 454 Con'gs, Brain and Ovary 454 Con'gs, Embryo 454 Con'gs, Larvae 454 Con'gs, Mixed Antennae 454 Con'gs, Ovary 454 Con'gs Testes 454 Con'gs, Forager RNA-‐Seq HeatMap, Forager RNA-‐Seq XY Plot, Nurse RNA-‐Seq HeatMap, Nurse RNA-‐Seq XY Plot
Becoming Acquainted with Web Apollo.
![Page 91: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/91.jpg)
Exercises Live Demonstra'on using the Apis mellifera genome.
91
1. Evidence in support of protein coding gene models (Con=nued). 1.6 Protein homolog alignment: Acep_OGSv1.2 Aech_OGSv3.8 Cflo_OGSv3.3 Dmel_r5.42 Hsal_OGSv3.3 Lhum_OGSv1.2 Nvit_OGSv1.2 Nvit_OGSv2.0 Pbar_OGSv1.2 Sinv_OGSv2.2.3 Znev_OGSv2.1 Metazoa_Swissprot
2. Evidence in support of non protein coding gene models 2.1 Non-‐protein coding gene predic=ons: NCBI RefSeq Noncoding RNA NCBI RefSeq miRNA 2.2 Pseudogene predic=ons: NCBI RefSeq Pseudogene
Becoming Acquainted with Web Apollo.
![Page 92: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/92.jpg)
APOLLO DEVELOPMENT
APOLLO DEVELOPERS 92
h^p : / /GenomeA r c h i t e c t . o r g /
Nathan Dunn
Eric Yao JBrowse, UC Berkeley
Deepak Unni Colin Diesh
Elsik Lab, University of Missouri
Suzi Lewis Principal Investigator
BBOP
Moni Munoz-Torres Stephen Ficklin GenSAS,
Washington State University
![Page 93: Apollo: A workshop for the Manakin Research Coordination Network](https://reader031.vdocuments.us/reader031/viewer/2022030311/58ef784e1a28abe41e8b45ef/html5/thumbnails/93.jpg)
• Berkeley Bioinforma=cs Open-‐source Projects (BBOP), Berkeley Lab: Web Apollo and Gene Ontology teams. Suzanna E. Lewis (PI).
• § Chris$ne G. Elsik (PI). University of Missouri.
• * Ian Holmes (PI). University of California Berkeley.
• Arthropod genomics community: i5K Steering Commi=ee (esp. Sue Brown (Kansas State)), Alexie Papanicolaou (UWS), and the Honey Bee Genome Sequencing Consor'um.
• Apollo is supported by NIH grants 5R01GM080203 from NIGMS, and 5R01HG004483 from NHGRI; by Contract No. 60-‐8260-‐4-‐005 from the Na'onal Agricultural Library (NAL) at the United States Department of Agriculture (USDA); and by the Director, Office of Science, Office of Basic Energy Sciences, of the U.S. Department of Energy under Contract No. DE-‐AC02-‐05CH11231
•
• For your a^en=on, thank you!
Thank you. 93
Web Apollo
Nathan Dunn
Colin Diesh §
Deepak Unni §
Gene Ontology
Chris Mungall
Seth Carbon
Heiko Dietze
BBOP
Web Apollo: h=p://GenomeArchitect.org
i5K: h=p://arthropodgenomes.org/wiki/i5K
GO: h=p://GeneOntology.org
Thanks!
NAL at USDA
Monica Poelchau
Christopher Childers
Gary Moore
HGSC at BCM
fringy Richards
Dan Hughes
Kim Worley
JBrowse Eric Yao *