phylogenetic analysis taken from avierstr avierstr and es/msaphylogeny.htm

Phylogenetic analysis

taken from http://allserv.rug.ac.be/~avierstr

http://www.cs.otago.ac.nz/cosc348/Lectures/MSAPhylogeny.htm

Introduction to Bioinformatics course slides

Purpose of phylogenetics :• Reconstruct the evolutionary relationship between species Experience learns that closely related organisms have similar

sequences, more distantly related organisms have more dissimilar sequences.

• Estimate the time of divergence between two organisms since they last shared a common ancestor.

But…• The theory and practical applications of the different models are not

universally accepted. • Important to have a good alignment to start with. (Garbage in,

Garbage out)• Trees based on an alignment of a gene represent the relationship

between genes and this is not necessarily the same relationship as between the whole organisms. If trees are calculated based on different genes from organisms, it is possible that these trees result in different relationships.

Why is phylogeny imporant

• Determining tree of life (e.g., for a new organism)

• Determining gene function

• Understand which parts of the gene/regulatory sequences are important

• Tracing the evolution of genes – horizontal gene transfer etc.

Protein or DNA?

• As with Multiple Sequence Alignment – proteins are preferred– More informative– Shorter in length– Less chance of multiple mutations at the

same site

• When DNA?– A non-coding sequence– Proteins too similar

Terminology :• node : a node represents a

taxonomic unit. This can be a taxon (an existing species) or an ancestor (unknown species : represents the ancestor of 2 or more species).

• branch : defines the relationship between the taxa in terms of descent and ancestry.

• topology : is the branching pattern.

• branch length : often represents the number of changes that have occurred in that branch.

• root : is the common ancestor of all taxa.

• distance scale : scale which represents the number of differences between sequences (e.g. 0.1 means 10 % diff

Possible ways of drawing a tree :

Unscaled branches : the length is not proportional to the number of changes.

•Scaled branches : the length of the branch is proportional to the number of changes (usually in PAMs). The distance between 2 species is the sum of the length of all branches connecting them.

• Rooted trees: the root is the common ancestor. The direction of each path from the root corresponds to evolutionary time.• Unrooted tree: specifies the relationships among species and does not define the evolutionary path.

Rooted vs. unrooted trees

The position of the root does not affect the MP score.

Rooted vs. Unrooted.

s1 s4 s3 s2 s5

Gene number 1

1 1 1 0 0

1 or 0

Intuition why rooting doesn’t change the score

The change will always be on the same branch, no matter where the root is positioned…

We want rooted trees!

How can we root the tree?

Gorilla gorilla

(Gorilla)

Homo sapiens (human)

Pan troglodytes (Chimpanzee)

Gallus gallus (chicken)

Evaluate all 3 possible UNROOTED trees:

Chicken

Gorilla

Chicken

Gorilla

MP tree

Rooting based on a priori knowledge:

Chicken

Gorilla

Human ChimpChicken Gorilla

Ingroup / Outgroup:

Human ChimpChicken Gorilla

INGROUPOUTGROUP

Tree of life

Distance-based methods

• Compress all of the individual differences between pairs of sequences into a single number – the distance.

• Starting from an alignment, pairwise distances are calculated between DNA sequences as the sum of all base pair differences between two sequences (the most similar sequences are assumed to be closely related. This creates a distance matrix.

• From the obtained distance matrix, a phylogenetic tree is calculated with clustering algorithms. These cluster methods construct a tree by linking the least distant pair of taxa, followed by successively linking more distant taxa.

• Algorithms: UPGMA clustering , Neighbor Joining.• Assumes molecular clock ClustalW!

Cladistic methods• Trees are calculated by considering the various possible

pathways of evolution and are based on parsimony or likelihood methods. These methods use each alignment position as evolutionary information to build a tree.

• Parsimony : Looks for the most parsimonious tree: the tree with the fewest evolutionary changes for all sequences to derive from a common ancestor.

• Slower than distance methods.• Assumes molecular clock• Maximum Likelihood : Looks for the tree with the maximum

likelihood: the most probable tree. • this is the slowest method of all but seems to give the best

result and the most information about the tree. • No molecular clock assumption

Phylip

Two homologous DNA sequences which descended from an ancestral sequence and accumulated mutations since their divergence from each other. Note that although 12 mutations have accumulated, differences can be detected at only three nucleotide sites.

Even the best evolutionary models can't solve this problem...

Molecular clocks

• Assumption: constant rate of evolution

• Different rate for different genes:

Millions of years since divergence

Dickerson, 1971

Human insulin

Insulin multiple alignment

Surprisingly, insulin from the guinea pig evolved seven times faster than insulin from other species. Why?

The answer is that guinea pig insulin does not bind two zinc ions, while insulin molecules from most other species do. There was a relaxation on the structural constraints of these molecules, and so the genes diverged rapidly.

Problems with molecular clocks

Building trees with ClustalW

Place alignment here

Choose a tree here

http://www.ebi.ac.uk/clustalw/

PHYLIP

• A suite of phylogeny tools

• Both web servers and stand-alone applications

• Used for distance/parsimony/maximum likelihood

• http://bioweb.pasteur.fr/seqanal/phylogeny/phylip-uk.html

Sequences

Bootstrapping

• Assigns confidence to individual tree branches

• Columns of the alignment are randomly sampled (with replacement) and the tree is recomputed X many interactions

• Boorstrap value of a branch = how many iterations had it.

Collections of homologous genes

• Homologene @ Entrez– http://www.ncbi.nlm.nih.gov/sites/entrez?db=homolog

ene• COG – Clusters of Orthologous Genes

– Results of Blast All-vs-All between genomes. Genes within the same COG are “pairwise best hits”

– http://www.ncbi.nlm.nih.gov/COG/• RDP – Ribosomal sequences

– The “standard” sequences for doing species phylogeny

– Focused on Bacteria– http://rdp8.cme.msu.edu/html/

Orthologs

Homologous sequences are orthologous if they were separated by a speciation event:

If a gene exists in a species, and that species diverges into two species, then the copies of this gene in the resulting species are orthologous.

Orthologs

• Orthologs will typically have the same or similar function in the course of evolution.

• Identification of orthologs is critical for reliable prediction of gene function in newly sequenced genomes.

Orthologs

speciation

ancestor

descendant 2 (e.g., dog)descendant 1 (e.g., human)

Paralogs

Homologous sequences are paralogous Homologous sequences are paralogous if they were separated by a if they were separated by a gene gene duplication duplication event: event:

If a gene in an organism is duplicated, If a gene in an organism is duplicated, then the two copies are paralogous. then the two copies are paralogous.

Paralogs

• Orthologs will typically have the same or similar function.

• This is not always true for paralogs due to lack of the original selective pressure upon one copy of the duplicated gene, this copy is free to mutate and acquire new functions.

Paralogs

Duplication

38(taken from NCBI)

Using BLAST and phylogeny to study gene evolution

Mol. Biol. Evol. (2005) 22:598-606

Evolutionary rate and conservation

Functionally or structurally important sites are conserved:

Conserved sites “slow” evolving sitesVariable sites “fast evolving” sites

Sites which are under a functional/structural constraint are conserved, and evolve slowly

Conservation in an MSA

S1 KITAYCELARTDMKLGLDFYKGVSLANWVCLAKWESGYN S2 MPFERCELARTLKRMADADIRGVSLANWVCLAKWFWDGGS3 MPFERCELARTLKRMMDADIRGVSLANWVCLAKWFWDGG

From the MSA (and the tree), one can determine how From the MSA (and the tree), one can determine how conserved is a gene.conserved is a gene.

“Inverse relation between evolutionary rate and age of mammalian genes”: Protocol

Step 1 - BLAST

Build the dataset of mammalian genes

Step 1 – BLAST: build the dataset of mammalian genes, based on

mouse-human ortholog pairs• The orthologs are defined as pairs of

reciprocal BLAST hits.

• Eliminate genes with more than one potential orthologous sequence.

• Select only genes which the human protein was functionally annotated.

Step 2 – Calculate conservation

Step 2 – Calculate Evolutionary Rates (Conservation)

For each orthologous pair:

• Alignment at the amino acid level.

• Measure evolutionary rate

The dataset contained 6,776 human-mouse gene pairs.

Step 3 – Assignment of Temporal Categories

How old is each gene? Used BLAST to find homologs in 6 different eukaryotic genomes

Caenorhabditis elegans Schizosaccharo

myces pombe

Takifugu rubripes

Drosophila melanogaster

Arabidopsis thaliana

Saccharomyces cerevisiae

What is Old ?• Presence of any

homolog in all the 6 genomes.

What is Presence ? Using an e-value cutoff of

10-4 in BLAST.

METAZOANS

DEUTEROSTOMES

TETRAPODS

• METAZOANS - Organisms whose bodies consist of many cells, as distinct from Protozoa, which are unicellular; also commonly called animals.

• DEUTEROSTOMES - The second of the two main groups of bilaterally symmetrical animals. The name derives from 'deutero' (second) 'stome' (mouth), referring to the origin of the definitive mouth as an opening independent from the blastopore of the embryo.

• TETRAPODS - Any four-legged animals, including mammals, birds, reptiles and amphibians.

Insect

Tetrapods

Deuterostomes

Metazoa

Old (eukaryotes)

Results

Negative correlation between “age” of genes and the rate of evolution

Evolutionary rate

Negative correlation between “age” of genes and the rate of evolution

Control.

• Changing the sensitivity of the BLAST detection to a more conservative one of 10-10, did not significantly affect the result.

Explanations

• Functional constraints remained constant throughout the evolutionary history of each gene, but the newer genes are less constrained than older genes.

• Functional constraints are not constant, rather they are weak at the time of origin of a gene and they become progressively more stringent with age.

Eran Elhaik, Niv Sabath, and Dan Graur

Mol. Biol. Evol. 23(1):1–3. 2006

• To show that these results are an artifact caused by our inability to detect similarity when genetic distances are large.

Simulation

The evolutionary process

Ala ArgVal

Replacement probabilities

Ala ArgVal

Rat L M T G S H M G N F I IMouse L M T G S G M A N H V ICat I M T G S H I G Y A M FDog M M T G S G I G L T R A Fly V M T G S W R G R M Y A

And repeat the process for all positions…(assume: each position evolves independently)

All the genes originated in the common ancestor of A,B,C,D,E and are, thus, of equal age.

Similar to the human and mouse orthologous genes.

Remote homologs from increasingly distant taxa (similar to fish, insect, yeast…)

The aim of the simulations: generate sequences with the following phylogenetic relationships:

DA B EC

Simulation

• They simulated genes with 101 different rates.

• High rate higher likelihood for an amino acid replacement in each branch.

After simulating the sequences:

Use BLAST, at the same way that Alba and Castresana used it, to detect homology between gene A to genes C,D and E.

Only one difference – the groups names

METAZOANS

DEUTEROSTOMES

TETRAPODS

SENIORS

ADULTS

TEENAGERS

TODDLERS

Results

Same as Alba and Castresana

But all the simulated genes are at the same

“age”.

What is the problem ???

We can only count genes that are identified as homologous by the protocol … BLAST

Alba and Castresana may have, thus, failed to spot the vast majority of homologs from among

the fastest evolving genes

The vast majority of the fastest evolving genes are undetectable even when the cutoffs are extremely permissive.

Conclusion

The inverse relationship between evolutionary rate and gene age is an

artifact caused by our inability to detect similarity when genetic distances are

large.

• Since genetic distance increases with time of divergence and rate of evolution, it is difficult to identify homologs of fast evolving genes in distantly related taxa.

• Thus, fast evolving genes may be misclassified as “new”.

So, the only conclusion that can be drawn from Alba and Castresana’s

study is that

Slowly evolving genesevolve slowly!!!

phylogenetic analysis taken from avierstr avierstr and es/msaphylogeny.htm

Documents

phylogenetic workflows

phylogenetic tree

phylogenetic analyses2

phylogenetic inference

constructing phylogenetic trees - shodorshodor.org › ......

reading phylogenetic trees -...

bioinformatics phylogenetic...

phylogenetic morphological

maximum likelihood (ml) parameter estimation with...

phylogenetic tree

phylogenetic tools

phylogenetic community structure and phylogenetic turnover...

8. lecture ws 2003/04bioinformatics iii1 phylogenetic...

phylogenetic inference

assessing phylogenetic hypotheses and phylogenetic data we...

phylogenetic structure and phylogenetic diversity of...

maximum likelihood (ml) parameter estimation with...

guest lecture : phylogenetic analysis...phylogenetic...

phylogenetic trees

phylogenetic methods