intellitouch pool and spa control system cancel feature ... intellitouch pool and spa control system...

Post on 16-Apr-2018

218 Views

Category:

Documents

1 Downloads

Preview:

Click to see full reader

TRANSCRIPT

IntelliTouch Pool and SpaControl System

User’s Guide

IMPORTANT SAFETY INSTRUCTIONSREAD AND FOLLOW ALL INSTRUCTIONSSAVE THESE INSTRUCTIONS

pool/spa control system

© 2005 Pentair Water Pool and Spa, Inc. All rights reserved

This document is subject to change without notice

1620 Hawkins Ave., Sanford, NC 27330 • (919) 566-800010951 West Los Angeles Ave., Moorpark, CA 93021 • (805) 523-2400

Trademarks and disclaimers

IntelliTouch, EasyTouch, IntelliChlor, IntelliFlo, QuickTouch, MobileTouch, SAm, SAL, and FIBERworks, and thePentair Water Pool and Spa logo are trademarks of Pentair Water Pool and Spa, Inc. Other trademarks and tradenames may be used in this document to refer to either the entities claiming the marks and names or their products.Pentair Water Pool and Spa, Inc. disclaims proprietary interest in marks and names of others.

P/N 520102 - Rev E - 11/16/05

i

IntelliTouch Pool and Spa Control System User’s Guide

ContentsImportant Safety Precautions ............................................................................................................................... iiIn this User’s Guide ..............................................................................................................................................vi

Technical Support ..........................................................................................................................................viRelated IntelliTouch Manuals .........................................................................................................................vi

Introduction .......................................................................................................................................................... 1IntelliTouch System Overview .............................................................................................................................. 1In the home .......................................................................................................................................................... 1

Around the pool ............................................................................................................................................. 1At the equipment pad ..................................................................................................................................... 1

IntelliTouch System Components ......................................................................................................................... 2Load or Power Center .................................................................................................................................... 2IntelliTouch Personality Kits ........................................................................................................................... 2IntelliTouch Interfaces .................................................................................................................................... 3IntelliTouch in your home ............................................................................................................................... 4

IntelliTouch Interface Kits ..................................................................................................................................... 5PC Interface (iTC15 Kit - P/N 520500) .......................................................................................................... 5Personal Digital Assistant (PDA) (iTC25 Kit - P/N 520501) ........................................................................... 5In-Wall Touch Screen (iTC35 Kit - P/N 520502)............................................................................................. 5Digital Wireless Tablet (iTC45 Kit - P/N 520503)............................................................................................ 5IntelliTouch ScreenLogic Interface Accessory Kits ....................................................................................... 5

USING INTELLITOUCH CONTROLLERS FOR EVERYDAY OPERATIONS .................................................. 7

Main Screen (Indoor Control Panel and MobileTouch) ......................................................................................... 8Menu Settings and Descriptions .......................................................................................................................... 9Indoor Control Panel Menu Tree ......................................................................................................................... 10General Pool and Spa Operations...................................................................................................................... 11

Heating your Spa and Pool .......................................................................................................................... 11Adjust Spa or Pool Heat Settings ................................................................................................................ 11Configuring the Heating System Options .................................................................................................... 12Switching on Lights Manually ...................................................................................................................... 13Special Lighting Features ............................................................................................................................ 14Dim Lights .................................................................................................................................................... 15Set ON/OFF Times for Equipment .............................................................................................................. 16Using the Once Only Timer ......................................................................................................................... 17Setting the Egg Timer Function .................................................................................................................... 18iS10 Spa-Side Remote Controller ................................................................................................................ 19iS4 Spa-Side Remote Controller .................................................................................................................. 20MobileTouch Wireless Controller ................................................................................................................. 21Charging the MobileTouch Wireless Controller ............................................................................................ 22Using the MobileTouch Wireless Controller ................................................................................................. 22QuickTouch Wireless QT4 Remote Controller ............................................................................................ 23

pool/spa control system

IntelliTouch Pool and Spa Control System User’s Guide

ii

Contents (Continued)

PREPARING THE SYSTEM FOR INITIAL START-UP.................................................................................... 25Setting up the IntelliTouch System ..................................................................................................................... 26Automatically Enabled Wired Controllers ........................................................................................................... 28Adding Multiple Controllers and Expansion Centers .......................................................................................... 28Adding a MobileTouch Wireless Controller ......................................................................................................... 28Testing the Indoor Control Panel and MobileTouch Controller ............................................................................ 28Manually Enabling Wired Controllers and Remotes ........................................................................................... 29Assigning Additional Expansion Centers ........................................................................................................... 30Enabling a MobileTouch Wireless Controller ...................................................................................................... 31Adding an iS10 Spa-Side Remote Controller ..................................................................................................... 33Prepare the System for Operation ..................................................................................................................... 34

Check the Main Load Center ....................................................................................................................... 34Checking the Indoor Control Panel or MobileTouch ..................................................................................... 36Setting up the IntelliTouch System using the Indoor Control Panel or MobileTouch ..................................... 37

The Preference Screen Options ........................................................................................................................ 37Set the System Clock .................................................................................................................................. 38

Assigning Circuit Names to Display 1 (or Display 2, 3, and 4) .......................................................................... 39About DISPLAY Screen 1, 2, 3, 4 ...................................................................................................................... 39Assigning Circuit Names.................................................................................................................................... 40

Labeling Circuit Buttons in the Load Center ................................................................................................ 40IntelliTouch Circuit Names ........................................................................................................................... 40

Creating Custom Names for Auxiliary Circuits .................................................................................................. 42Assign Circuit Functions and Freeze Protection ................................................................................................ 43

Freeze Protection ........................................................................................................................................ 43Assigning Circuit Functions and Freeze Protection ..................................................................................... 43

Special Function to a Circuit .............................................................................................................................. 44Setting up Lighting Options (Color Set and Color Swim) .................................................................................... 45Color Set and Color Swim .................................................................................................................................. 45Setting up Set Colors and Color Swim with SAm, SAL, or FIBERworks ........................................................... 47Setting up Equipment ......................................................................................................................................... 48

Manual Priority Override of Timed Program Circuits ................................................................................... 48Setup Solar Equipment and Heatpump Option ............................................................................................ 49Setting up a 2-Speed Pump ......................................................................................................................... 50Set a Cool-Down Cycle for the Heater ........................................................................................................ 50Delay Cancel Feature .................................................................................................................................. 51

Set Automatic Spa Heating When the Spa is Manually Switched On ................................................................ 52Changing the Display to Show Fahrenheit to Celsius ........................................................................................ 52Chlorine Generator ............................................................................................................................................. 53Activate the Chlorinator Control Interface .......................................................................................................... 53Changing the Chlorinator Output ........................................................................................................................ 54Super Chlorinate the Pool ................................................................................................................................... 54Configuring Valve Actuators (Controlled by AUX or Feature Circuit) ................................................................. 55Configuring Valve Actuators ............................................................................................................................... 55

iii

IntelliTouch Pool and Spa Control System User’s Guide

Contents (Continued)

Feature Circuits .................................................................................................................................................. 56Assign a Circuit Name to a Feature Circuit (not available for model i5 or i5s) ............................................. 56Create a Macro ............................................................................................................................................ 57

Configuring Remote Control Button Circuits (iS4, iS10, QT4 QuickTouch, and Phone Remote) ....................... 58Setting up the Remote Control Telephone Feature ............................................................................................. 59Disable/Enable Spa-Side Remote ...................................................................................................................... 60Calibrating Temperature Sensors ....................................................................................................................... 62Using the Service Personnel Screen ................................................................................................................. 63

Checking Firmware Version......................................................................................................................... 63Manually Updating Between Indoor and Outdoor Control Panels ................................................................ 64Erasing the System Memory ....................................................................................................................... 65

Manually Enable an Indoor Control Panel .......................................................................................................... 66

About DISPLAY Screen 1, 2, 3, 4 ...................................................................................................................... 66

System Worksheet Overview ............................................................................................................................ 67

The Main Outdoor Control Panel ........................................................................................................................ 74

Shared Equipment Systems i5, i7+3, i9+3 .................................................................................................. 74

Erasing Outdoor Control Panel Memory (Factory Default) .......................................................................... 76

System Start-Up ................................................................................................................................................ 78

Check Electronics ....................................................................................................................................... 78

System Test ................................................................................................................................................. 78

Testing the Auxiliary Relays ........................................................................................................................ 78

TROUBLESHOOTING...................................................................................................................................... 79Frequently Asked Questions (FAQ) ................................................................................................................... 79

What does the ‘+3’ on some of the systems mean? .................................................................................... 79

How Do I Setup/Configure/Program the 2-Speed Pump? ........................................................................... 79

Can I turn the Heater On and Change the temperature from the Spa? ....................................................... 79

How do I get Solar to switch on? ................................................................................................................. 79

What are Color Swim and Color Set? .......................................................................................................... 80

How do I get SAm/SAL/PG2000 to Synchronize? ...................................................................................... 80

Can I copy a standard configuration to all the systems I install? ................................................................. 80

Fixing mismatched system personalities ..................................................................................................... 81

Indoor Control Panel and Outdoor Control Panel Connection Problem ....................................................... 81

MobileTouch Temperature Readout Not Accurate (20 to 30 Degrees off) ................................................... 81

System Problem Diagnosis ................................................................................................................................ 82

Problem: The system works in Service Mode, but Indoor Control Panel fails to operate. ............................ 82

Problem: Indoor and Outdoor Control Panels work, but iS4 fails to operate. .............................................. 83

Problem: Indoor and Outdoor Control Panels work, but iS10 fails to operate. ............................................ 84

Problem: The Mobile Control Panel will not work, or will not work dependably. .......................................... 85

Problem: The Quick Touch remote will not work, or will not work dependably. ........................................... 86

Wiring IntelliTouch to a Salt Chlorine Generator ................................................................................................. 90

Glossary ............................................................................................................................................................ 91

IntelliTouch Pool and Spa Control System User’s Guide

iv

Important Notice:

Attention Installer: This manual contains important information about the installation, operation andsafe use of this product. This information should be given to the owner and/or operator of thisequipment.

WARNING - Before installing this product, read and follow all warning notices and instructions whichare included. Failure to follow safety warnings and instructions can result in severe injury, death, orproperty damage. Call (800) 831-7133 for additional free copies of these instructions.

WARNING - Water temperature in excess of 100 degrees Fahrenheit may be hazardous to yourhealth. Prolonged immersion in hot water may induce hyperthermia. Hyperthermia occurs when theinternal temperature of the body reaches a level several degrees above normal body temperature of98.6° F (37° C). The symptoms of hyperthermia include drowsiness, lethargy, dizziness, fainting, and anincrease in the internal temperature of the body.

The effects of hyperthermia include: 1) Unawareness of impending danger. 2) Failure to perceive heat.3) Failure to recognize the need to leave the spa. 4) Physical inability to exit the spa. 5) Fetal damage inpregnant women. 6) Unconsciousness resulting in danger of drowning.

WARNING - To reduce the risk of injury, do not permit children to use this product unless they areclosely supervised at all times.

WARNING - The use of alcohol, drugs, or medication can greatly increase the risk of fatalhyperthermia in hot tubs and spas.

WARNING - Control System is intended to control heaters with built-in high limit circuits ONLY.Failure to do so may cause property damage or personal injury.

WARNING - Do not use this product to control an automatic pool cover. Swimmers may becomeentrapped underneath the cover.

WARNING - For units intended for use in other than single-family dwellings, a clearly labeledemergency switch shall be provided as part of the installation. The switch shall be readily accessible tothe occupants and shall be installed at least 10 feet (3.05 m) away, adjacent to, and within sight of, theunit.

CAUTION - Except for listed spa-side remote controls, install a minimum of five (5) feet from theinside wall of the pool and spa.

IMPORTANT SAFETY PRECAUTIONS

v

IntelliTouch Pool and Spa Control System User’s Guide

IMPORTANT SAFETY PRECAUTIONS (CONTINUED)

FCC Regulatory Safety Notice - The MobileTouch wireless control panel device has beentested and found to comply with the limits for a Class B digital device, pursuant to Part 15 of theFCC Rules. These limits are designed to provide reasonable protection against harmful interferencein a residential installation. This device generates, uses and can radiate radio frequency energy and,if not installed and used in accordance with the instructions, may cause harmful interference to radiocommunications. However, there is no guarantee that interference will not occur in a particularinstallation. If this equipment does cause harmful interference to radio or television reception, whichcan be determined by turning the equipment off and on, the user is encouraged to try to correct theinterference by one or more of the following measures:

• Reorient or relocate the receiving antenna.• Increase the separation between the equipment and receiver.• Connect the equipment into an outlet on a circuit different from that to which the receiver is

connected.• Consult the dealer or an experienced radio/TV technician for help.• Modifications not expressly approved by the party responsible for FCC compliance could

void the user’s authority to operate the equipment.

General Installation Information

1. All work must be performed by a licensed electrician, and must conform to the NationalElectric Code and all national, state, and local codes.

2. Install to provide drainage of compartment for electrical components.

3. If this system is used to control underwater lighting fixtures, a ground-fault circuit interrupter(GFCI) must be provided for these fixtures. Conductors on the load side of the ground-faultcircuit-interrupter shall not occupy conduit, junction boxes or enclosures containing otherconductors unless such conductors are also protected by a ground-fault circuit-interrupter.Refer to local codes for details.

4. A terminal bar stamped is located inside the supply terminal box. To reduce the risk ofelectric shock, this terminal must be connected to the grounding means provided in theelectric supply service panel with a continuous copper wire equivalent in size to the circuitconductors supplying this equipment (no smaller than 12 AWG or 3.3 mm). The bondinglug(s) provided on this unit are intended to connect a minimum of one No. 8 AWG for USinstallation and two No. 6 AWG for Canadian installations solid copper conductor betweenthis unit and any metal equipment, metal enclosures or electrical equipment, metal waterpipe, or conduit within 5 feet (1.5 m) of the unit.

5. The electrical supply for this product must include a suitably rated switch or circuit breakerto open all ungrounded supply conductors to comply with Section 422-20 of the NationalElectrical Code, ANSI/NFPA 70.1987. The disconnecting means must be readily accessibleto the tub occupant but installed at least 10 ft. (3.05 m) from the inside wall of the pool.

6. Supply conductor must be sized to support all loads. Maximum supply conductor currentmust be 125 Amps at 125 VAC or 63 Amps at 240 VAC.

IntelliTouch Pool and Spa Control System User’s Guide

vi

In this User’s GuideThis manual describes the how to operate the IntelliTouch system to control pool pumps, heaters, spa lights, andother functions. Described are basic everyday operations that can be easily automated, to the advanced setupfunctions that only need to be performed once.

This manual consists of the following sections:

Using IntelliTouch IntelliTouch Controllers for Everyday Operations (page 7)

Preparing the System for Initial Start-Up (page 17)

Toubleshooting (page 79)

Glossary (page 91)

Technical Support

Contact Technical Support at:

Sanford, North Carolina (8 A.M. to 5 P.M.)

Phone: (800) 831-7133

Fax: (919) 566-8920

Moorpark, California (8 A.M. to 5 P.M.)

Phone: (800) 831-7133 (Ext. 6502)

Fax: (805) 530-0194

Web sitesvisit www.pentairpool.com and staritepool.com

Related IntelliTouch Manuals

IntelliTouch Personality Kit User’s Guide (P/N 520101)

IntelliTouch Load Center and Power Center User’s Guide (P/N 520100)

IntelliTouch Expansion Center Kit User’s Guide (P/N 520471)

IntelliTouch i-Link Protocol Interface Adapter User’s Guide (P/N 520450)

1

IntelliTouch Pool and Spa Control System User’s Guide

IntroductionWelcome! Your Pentair IntelliTouch Pool and Spa and control system will change the way you view pool andspa controls. This innovation in pool and spa automation offers complete freedom for you while having fullautomation control over your pool, spa, lights, heater, cleaners and much more. You can now schedule multiplestart and stop times to control your lights, heater, spa jets, and filter pumps. Using the Indoor Control Panel orMobileTouch wireless control panel you can control your pool, spa, and lights from anywhere inside or outsideyour home. Optional controllers are also available such as the wireless Digital Tablet or Personal DigitalAssistant (PDA), and in-wall Touch Screen that can interface with your PC. IntelliTouch is a scalable systemthat can be upgraded to a completely integrated home automation solution including audio, security, climate,irrigation and more. For more information about using these interfaces, refer to IntelliTouch ScreenLogic system.

This manual describes how to install, configure, and operate the IntelliTouch system. Before learning how theIntelliTouch system works, familiarize yourself with the various wireless and wired controllers.

IntelliTouch System OverviewIntelliTouch systems offer the flexibility to handle from 5 to 40 circuits (high voltage relays) that can be used tocontrol any combination of pumps, lights, water features, etc. As an added benefit, user-configurable circuitscan also be used to control these combinations of features and more. The Feature Macro circuits feature allowsany number of circuits to be combined on a single button. This gives you the ability to set up “themes” withcustom names all with a press of a button. (Not available with IntelliTouch model i5 or i5S).

IntelliTouch users can also dim any high voltage incandescent light such as Pentair Amerlites and SpaBrites up toeight levels using the IntelliTouch Dimmer Module (P/N 520406). The dimmer module supports multiple lightsfrom 100 watts up to 1,000 watts and installs in a standard relay location. Any number of dimmers (up to 10maximum) may be used with a maximum combined load of 4,000 W in a single Load Center.

In the homeThe IntelliTouch system can utilize multiple wired and wireless controllers including the Digital Tablet, PersonalDigital Assistant (PDA), the wired in-wall Touch Screen, Indoor Control Panel, and the wireless MobileTouchcontrol panel, and even your existing home PC. A maximum of four ScreenLogic interfaces can be used. Forexample, four Tablets, or four PDA’s, or four in-wall Touch Screen’s, or four PC’s in any combination.

Around the poolLocated near your spa, the IntelliTouch, iS10 or iS4 spa-side remote provide control buttons for various pooland spa functions. The iS10 spa-side remote also provides a temperature display.

At the equipment padNear the pump, filter, and other equipment will be located a metal box known as the Load Center or PowerCenter. This is where high voltage from the circuit breaker panel junction box at the home is distributed to theIntelliTouch Load Center or Power Center. The pool service person can periodically check pool operationsfrom this unit. The Load Center is also where the various IntelliTouch controllers interface with the otherequipment.

Mounted on of top the valves you may also find motorized valve actuators used to change the flow of waterthrough the plumbing. There are also temperature sensors and cable that connect to the heater. There should beno need for anyone other than your service person to periodically check this equipment.

IntelliTouch Pool and Spa Control System User’s Guide

2

IntelliTouch System ComponentsThe main required components of an IntelliTouch system are the Load or Power Center, IntelliTouchPersonality Kits, and the Interfaces:

Load or Power Center• Load Center: Provides a larger footprint (17" W x 23" H) Includes built-in sub panel (125 AMPS) capable

of holding up to eight 1” breakers. Also includes five 25 AMP three HP relays, 110/240 V transformer withsecondary side circuit protection. Multiple knockouts for different sizes of conduit are supplied as well as aGFCI side knockout. The Load Center provides ample space for all high and low voltage wiring needs.

• Power Center: Offers a smaller footprint (17" W x 17" H) than the Load Center. The Power Center doesnot include a circuit breaker base. Users should choose this enclosure if they already have existing circuitbreakers/sub-panel for their equipment.

• Expansion Kits: Models i5X and i10X, offer five or ten additional Auxiliary Circuits for systems i9+3,i9+3S and i10+3D. Each IntelliTouch Expansion Kit requires a Load Center (P/N 520136) or Power Center(P/N 520137). Up to three Expansion Kits and Load or Power Centers may be added to a system, forcontrol of up to 38 Auxiliary Circuits (40 auxiliary circuits for i10+3D).

IntelliTouch Personality KitsThere are several types of IntelliTouch control systems available for different pool/spa configurations:

• Shared Equipment: Pool and spa combinations with shared filtration system – Pool owners can enjoythe convenience of motorized valves for water flow separation between pool and spa. The Personality Kitmodels are:

• i5 (P/N 520505) – Four auxiliary circuits plus filter pump operation. Five relays are included inthe Load Center.

• i7+3 (P/N 520507) – Six auxiliary circuits plus filter pump operation and the +3 option (create aFeature circuit for valve actuators without using an existing output auxiliary circuit, and speciallight functions for color lighting). Two relays are included in the kit and five in the Load Center.

• i9+3 (P/N 520509) – Eight auxiliary circuits plus filter pump operation and the +3 option (createa Feature circuit for valve actuators without using an existing output auxiliary circuit, and speciallight functions for color lighting). Four relays are included in the kit and five in the Load Center.

• Dual Equipment: Pool and Spa with Dual Sets of Equipment – The IntelliTouch i10+3D (P/N520510) system provides advanced automation for a pool and spa using two separate sets of equipment.This IntelliTouch Personality Kit can control up to 10 pumps and/or lighting circuits, plus two heater circuits.The Personality Kit includes, eight auxiliary circuits plus a filter pump. The +3 option (create a Feature Macrocircuit for valve actuators without using an existing output auxiliary circuit). Five relays are included in the kitand five in the Load Center. You can create a Feature circuit for valve actuators without using an existingoutput auxiliary circuit, and special light functions for color lighting. This model also allows Hi/LowTemperature settings.

• Single Equipment: Pool Only or Spa Only Applications – The IntelliTouch i5S (P/N 520506) andi9+3S provide advanced automation for a single body of water. The i5S (P/N 520506) Personality Kitsincludes eight auxiliary circuits plus filter pump operation. Five relays in the Load Center. The i9+3S (P/N520508) Personality Kits includes four auxiliary circuits plus filter pump operation and the +3 option (create aFeature Macro circuit for valve actuators without using an existing output aux circuit). Four relays areincluded in the kit and five in the Load Center. You can create a Feature circuit for valve actuators withoutusing an existing output auxiliary circuit, and special light functions for color lighting. This model also allowsHi/Low Temperature settings.

3

IntelliTouch Pool and Spa Control System User’s Guide

In-Wall Touch Screen

Digital Tablet

PDA

Indoor Control Panel MobileTouch Wireless Controller

IntelliTouch InterfacesPool and Spa owners can choose one or more of the following interface options to control the IntelliTouchsystem throughout their home.

• iTC15 Kit (P/N 520500) – Includes Protocol Interface Adapter and wireless router that connects to existingDesktop or Laptop PC. This allows control of IntelliTouch pool and spa systems via PC (requires PC withan Ethernet connection, and Windows XP operating system).

• iTC25 Kit (P/N 520501) – Includes Wireless Personal Digital Assistant (PDA) with3.5" color touch screen custom configured for IntelliTouch systems, wireless router, anda Protocol Interface Adapter.

• iTC35 Kit (P/N 520502) – Includes in-wall color touch screen with Ethernet (RJ45)connection and Protocol Interface Adapter and wireless router. The in-wall Touchscreen is custom configured for IntelliTouch systems. Requires an Ethernet cable torouter.

• iTC45 Kit (P/N 520503) – Includes wireless Tablet with color touch screen, ProtocolInterface Adapter, and wireless router. The Tablet is custom configured forIntelliTouch systems.

• Indoor Control Panel (P/N 520138) – 3.75’’ monochrome backlit LCDcontrol panel. Connects to the Personality board in the Load Center.

• MobileTouch (P/N 520340) – 3.75’’ monochrome backlit LCD wirelesscontrol panel with transceiver antenna . Allows any IntelliTouch wired systemto also have a wireless remote with all the capabilities of the Indoor ControlPanel. With an average range of 300 feet, pool owners have system controlanywhere around the home or yard. Powered by a rechargeable lithium-ionbattery. Includes an AC adapter for recharging.

• QuickTouch Wireless Remote (QT4): Four-function wireless remote forpool and spa functions of your choice. This radio transmitter operates up to150 feet range from the Load Center or Power Center.

• iS10 and iS4: 10-function (iS10) and 4-function (iS4) Spa-Side remotecontroller for pool and spa functions of your choice. The controllers canoperate up to 150 feet range from the Load or Power Center.

• i-Link Protocol Interface Adapter: Connects to wireless router via Ethernetconnection and to Personality board (Load Center or Power Center) via Serialcable (Four-wire).

i-Link ProtocolInterface Adapter

QuickTouch wirelessremoter (QT4)

IntelliTouch Pool and Spa Control System User’s Guide

4

Personal Computer (PC): Existing home owner’s PC or Laptop. Connects to a wireless router and the IntelliTouchProtocol adapter for control of IntelliTouch pool/spa systems. Requires a PC/Laptop (Windows XP) with Ethernet/RJ45 adapter installed.

Personal Digital Assistant (PDA): This wireless PDA with a color touch screen enables you to control your pooland spa features using the IntelliTouch ScreenLogic interface. The PDA is custom configured for IntelliTouchsystems.

In-wall Touch Screen: A color display with Ethernet (RJ45) connector. Connects to the provided wireless routerand Protocol adapter via Ethernet (RJ45) for control of IntelliTouch pool and spa systems. The in-wall TouchScreen is custom configured for IntelliTouch systems.

Wireless Tablet: This control panel consists of a color touch screen. Receives and transmits commands viawireless router and Protocol adapter for control of IntelliTouch pool/spa systems. The Tablet is custom configuredfor IntelliTouch systems.

Indoor Control Panel: This control panel consists of a 3.75’’ monochrome backlit LCD and connects to thePersonality Board in the Load Center or Power Center for control of IntelliTouch pool and spa systems.

MobileTouch: This wireless control panel has a 3.75’’ monochrome backlit LCD. Receives and transmitscommands via the Transceiver antenna located at the Load or Power Center.

Wireless router: Connects to the PC or Laptop via Ethernet connection to the Protocol adapter.

Protocol adapter: Connects to wireless router via Ethernet connection and to Personality board (Load/PowerCenter) via a four-wire 22-AWG cable.

Load Center or Power Center. The main control center. Includes the Outdoor Control Panel that controls pump,heater, and light relays. Receives commands via Protocol adapter, and wireless and wired control panelsconnected to the Personality board.

MobileTouch Transceiver antenna: This antenna is connected to the Personality board. Sends and receivescommands to and from the MobileTouch control panel.

10

95

7

8

1

3

4

2 6

IntelliTouch in your home

1

2

3

4

5

6

7

8

9

10

5

IntelliTouch Pool and Spa Control System User’s Guide

IntelliTouch Interface KitsThe following items are included in your IntelliTouch interface kit. If any item is missing or damaged in theIntelliTouch kit, contact your authorized dealer, or contact Pentair Water technical support.

PC Interface (iTC15 Kit - P/N 520500)• Protocol adapter for use with existing Desktop or Laptop PC• Wireless router (802.11b/g) with AC adapter• IntelliTouch ScreenLogic User’s Guide• CD-ROM containing IntelliTouch ScreenLogic PC user interface software

Personal Digital Assistant (PDA) (iTC25 Kit - P/N 520501)• Personal Digital Assistant (PDA) with built-in Wi-Fi 802.11b wireless LAN adapter with antenna. Refer to the

manufacturers documentation for kit contents• Wireless router (802.11b/g) with AC adapter• Protocol adapter• IntelliTouch ScreenLogic User’s Guide• CD-ROM containing IntelliTouch ScreenLogic PC user interface software

In-Wall Touch Screen (iTC35 Kit - P/N 520502)• In-wall Digital Tablet, and AC adapter• Wireless router (802.11b/g) with AC adapter• Protocol adapter• IntelliTouch ScreenLogic User’s Guide• CD-ROM containing IntelliTouch ScreenLogic PC user interface software

Digital Wireless Tablet (iTC45 Kit - P/N 520503)• Digital Tablet (with internal battery pack), stylus, built-in Wi-Fi 802.11b wireless LAN adapter with antenna.• Wireless router (802.11b/g) with AC adapter• Protocol adapter• IntelliTouch ScreenLogic User’s Guide• CD-ROM containing IntelliTouch ScreenLogic PC user interface software

IntelliTouch ScreenLogic Interface Accessory KitsUp to a total of four ScreenLogic interfaces can be used with an IntelliTouch system, as shown above. If youneed additional interfaces, first order one of the ScreenLogic interface kits, then order one or more of thefollowing accessory interfaces accessory kits:

• PDA, CD-ROM and manual (P/N 520497)• In-Wall Touch Screen, CD-ROM and manual (P/N 520498)• Tablet, CD-ROM and manual (P/N 520499)

Note: The above Accessory Kits interfaces do not include a Protocol adapter or wireless router.

IntelliTouch Pool and Spa Control System User’s Guide

6

7

IntelliTouch Pool and Spa Control System User’s Guide

Using IntelliTouch Controllersfor Everyday Operations

IntelliTouch Pool and Spa Control System User’s Guide

8

Heater Enabled Indicator(Flame): Flickers when heateris on. Sun icon indicates solaris selected in Heat menu.

Spa or (Hi-Temp) Mode: For shared (i5, i7+3, i9+3) and dual (i10+3D) equipment systems; switches on filter pump, rotate valve actuator (to isolate spa water from pool water), and fires heater. For single body equipment systems (i5S, i9+3S); Sets Pool or Spa to High-Temperature (Hi-Temp) settings

Pool or (Lo-Temp) Mode: Switches on Filter Pump and fires heater, (if heater is enabled). Shared equipment systems (i5, i7+3, i9+3); rotates valves to pool position. Single body systems (i5S, i9+3S): Sets Pool or Spa to Lo-Temperature settings

Auxiliary Buttons: Operate various equipment such as lighting, automatic pool cleaners, jet pumps and fountains. Green LEDs for Off/On operation.

Day/Time.

Current air Temperature.

SPA: Displays when pool or spa mode is on, and current water temperature and thermostat setting

Menu Button: Access various system setup screens

Heat Button: Access the heating menu for selecting temperature and heating modes

Lights Button: Access the custom lighting effects with SAm, SAL, and Fiberworks colored lighting

Display Button: Access the display screens for additional control circuits

Main Screen: Up to ten buttons can be configured to control various equipment. Names on this screen can be user defined

Display 1, 2, 3, 4: Displays the actual circuits connected to main Load Center (1). Also displays additional installed Expansion Centers (2, 3, 4), models i5, i5x and i10x Feature Circuits: Additional circuits for controlling valve actuators for water features, spa spillway, 2-speed pump, and macro circuits. For i5 or i5S, Feature Circuits are not available.

1

F

Main screen indicator

Display 1 screen.

(Display 2, 3, and 4 show for additional Expansion Centers)

Feature Circuit screen

1

M

F

Flame Icon: Displays when Heater is on for Pool or Spa

M

Spa SAL

Pool SAM

Main Screen(Indoor Control Panel and MobileTouch)

Note: The main screen may be configured to display anyten available circuits (auxiliary or feature).

9

IntelliTouch Pool and Spa Control System User’s Guide

Menu Settings and DescriptionsUse the IntelliTouch menu selections to setup the system up to automatically control general day-to-day pooland spa operations. As shown below, to setup pool and spa schedules, press MENU > PROGRAM. To configuresystem equipment, press MENU > SETUP or MENU >SETUP > ADVANCED.

MENU/PROGRAM/SELECT

DISPLAY EXITBACK

MENU/SETUP

ADVANCED

PREFERENCE

CIRCUIT MACROS

EQUIPMENT

CLOCK

BACK EXIT

Press Menu button

PROGRAM menu settings

SETUP menu settings

Schedule Pool (right side button)operations (see page 11)

Setup equipment (page 48)Set the system clock (page 38)Setup control panel features, backlight,beep etc. (page 37)

Setup circuit names, functions, configurevalves (page 43)

Setup circuit macro functions (page 56)

1

2

3OR

Schedule Spa (left side button)operations (see page 11)

Press PROGRAM or SETUP button

IntelliTouch Pool and Spa Control System User’s Guide

10

(***)PROGRAM

SETUP

EQUIPMENT

MENU

HEAT, Pg. 11

LIGHTS, Pg. 13

DISPLAY

DELAY CANCEL Pg. 51

DISABLE/ENABLESPA SIDE REMOTE

Pg. 60

CLOCK, Pg. 38

PREFERENCESPg. 37

CIRCUIT MACROS

PRIORITY - Pg. 48

CHLORINATOR - Pg. 53

SOLAR - Pg. 49

USER INTERFACESETTINGS, Pg. 37

MAIN SCREENCONFIG, Pg. 8

CREATECUSTOMNAMES

ASSIGNCIRCUIT NAMES

SPA

POOL

AUX1-4

ALL SYSTEMS

AUX5-6

AUX7-8

CIRCUIT NAMES

MAINSCREEN

M

MAINSCREEN

M

AUXSCREEN

1

AUXEXPANSION

SCREEN

2 4

FEATURECIRCUITSCREEN

F

USERNAME-01 THRU -20

Pg. 42

DISPLAY1 THRU 4

Pg. 42

FEATURECIRCUITS

Pg. 56

CIRCUITFUNCTIONS, Pg. 43

CONFIGUREVALVES, Pg. 55

SPA-SIDE ORRF REMOTE

FUNCTIONSELECTION

VALVEASSIGNMENT

CONFIGURE IS4'S, Pg. 58

CONFIGURE IS10'S

CONFIGURE QTWIRELESS

IS10 #1-4Pg. 58

COLOR SWIM

COLOR SET

CONFIGURELIGHT OPTIONS

SELECTION

ALL ON

ALL OFF

SYNC

LIGHTS ON/OFF#1-6

CONFIGUREOPTIONS #7-12

Pg. 45

START TIMESTOP TIMEDAYSSMART START

BOTTOM BUTTON

SIDE BUTTON

Pg. 8

ADVANCED

(*) Pg. 57

2-SPEED PMP - Pg. 50

PUMP DELAYS - Pg. 51

MANUAL HEAT - Pg. 52

DEGREES C/F - Pg. 52

ONCE ONLYEGG TIMER

Pg. 58

Pg. 62

CALIBRATETEMP SENSOR

PHONE REMOTE

CONFIGURE LIGHTOPTIONS

Pg. 45

ALL SYSTEMS

Buttons:

NEXT 6

LIGHTS ON/OFF

Pg. 13CONFIGURE #7 - 12

(*) Not i5 or i5S

(***) i9+3, i9+3S and i10+3D(**) i7+3, i9+3, i9+3S and i10+3D

(**)

(**)

i5x or i10x only

(*)

(*)

Indoor Control Panel Menu Tree

11

IntelliTouch Pool and Spa Control System User’s Guide

General Pool and Spa OperationsThe following describe some of the general day-to-day pool and spa operations.

Heating your Spa and PoolFrom the Heat screen, use Spa button (left side) or Pool button (right side) to adjust the heat temperature foryour pool or spa. You can also switch the heater on or off from this screen. For single-body systems (modelsi5S and i9+3S), spa and pool are replaced with Hi-Temp and Lo-Temp settings.

Adjust Spa or Pool Heat SettingsTo adjust the spa or pool set point temperature, go to the Heat screen:

Note: Be sure the Spa Mode label does not say OFF. If it displays OFF, refer to “Configuring theHeating System Options,” page 12, for more information.

To adjust the spa or pool set point temperature, press the HEAT button at the bottom of the screen:

• SPA: Press the spa Up or Down buttons (top left and right side) to increase or decrease the spa temperature.The set point water temperature is displayed in the middle of the screen.

• POOL: Press the pool Up or Down buttons (third down from the top, left and right side) to increase ordecrease the pool temperature. The set point water temperature is displayed in the middle of the screen.

1. Press the Set button to save the temperature settings. The current spa and pool water temperatures aredisplayed on the main screen.

2. Press the Back button to return to the Main screen.

HEAT

Getting There

SPA

Press to lower SPA temperatureHi-Temp Mode for i5S and i9+3S

Press to increase SPA temperature

Press to lower POOL temperature Press to increase POOL temperatureHi-Temp Mode for i5S and i9+3S

Back button Set button

IntelliTouch Pool and Spa Control System User’s Guide

12

Configuring the Heating System OptionsThe IntelliTouch system allows for many different pool and spa heating options. In some instances, more thanone heating system may be installed. The system can then automatically select the heating system that is mosteffective for your settings. However, before the system can take advantage of these options the system must betold what kind of heating systems are installed.

To configure the heating system options, press the HEAT button at the bottom of the screen.

• SPA: Press the second button from the top (SPA MODE) to select the heating mode.

• POOL: Press the third button from the top (POOL MODE) to select the heating mode.

1. Press the Set button to save the heat settings.

2. Press the Back button to return to the Main screen.

The heat options are:

• OFF - No heating even though pump and other circuits may be operating.

• HEATER - Gas heater only.

• HEAT PUMP - Heat pump only.

• H PUMP PREF. - For when a heat pump is in combination with other heating systems and you want to usethe heat pump only when it is most effective.

HEAT

Getting There

SPA Press to scroll through SPA Heatingoptions: OFF, HEATER. If solar isenabled (see page 49) the optionsare HEAT PUMP, H PUMP PREF.

Press to scroll through POOLHeating options: OFF, HEATER. Ifsolar is enabled (see page 49) theoptions are HEAT PUMP, H PUMPPREF.

Back button Set button

13

IntelliTouch Pool and Spa Control System User’s Guide

Switching on Lights ManuallyUp to 12 lights can be accessed from the Lights screen. You can also set up the Color Set, Color Swim andColor Sync special lighting features. Lights that have dimming functionality can be dimmed from the Lightsscreen. SAm or SAL fiber optic or Halogen lights cannot be dimmed. For more information, refer to “Setting upLighting Options,” page 45.

To manually switch on lights, press the LIGHTS button on the bottom of the main screen:

1. To switch a light system on, find the label for the lighting system you want to switch on. Press the button nextto the label of the light system you want to switch on.

2. If you have more than six circuits, press the Previous 6 or Next 6 button to see these circuits.

3. Press the All On button at the bottom of the screen to switch all the lights on.

4. Press the All Off button at the bottom of the screen to switch off the lights when you are done.

Note: All +3 IntelliTouch models include Color Set, and Color Swim lighting features.

Switch alllights ON

Switches alllights OFF

IntelliTouch Pool and Spa Control System User’s Guide

14

Special Lighting FeaturesIf you have at least two Pentair SAm and/or SAL, and/or FIBERworks lighting systems, you may use thespecial light features to change the lighting settings (only available with +3 models). Up to 12 of these lightssystems can be independently controlled from the Lights screen.

You can change the following light features:

• Color Set - Allows a combination of up to 12 SAm, SAL, or FIBERworks lighting circuits to be preset tospecific colors. This feature is not available for i5 or i5S systems. This feature requires a separate relay foreach light to achieve different colored lights.

• Color Swim - Allows a combination of up to six SAm, SAL, or FIBERworks lighting circuits to be preset totransition through colors in sequence. This gives the appearance of colors dancing through the water. You canadjust the delay of each light to make the colors move at different speeds. This feature is not available for i5 ori5S systems. This feature requires a separate relay for each light to achieve the “Color Swim” lighting feature.

• Sync - Causes all color changing lights to synchronize their colors. This feature is available on all IntelliTouchmodels.

Note: Before you start, review the lighting setup details, refer to “Setting up Lighting Options,”page 45. This procedure is usually done by the installer.

To activate the special lighting features, press the LIGHTS button on the bottom of the main screen:

1. Press the button next to Color Set to get all lights to a pre-programmed color.

2. Press the button next to Color Swim to cycle the lights as though swimming through the water.

3. Press the button next to Sync to activate all color changing lights to synchronize.

4. To configure lights on this screen press Configure.Note: It may take up to a minute or more for Color Set, Color Swim, or Sync to function asprogrammed depending on what kind of light you are activating and what state it was in when theeffect was activated.

Switches all SAm, SAL andFiberworks lights ON andSynchronizes lights.

Switch COLOR SWIM ON.Pressing the button again willnot switch COLOR SWIM OFF.

Use ALL OFF

Switch COLOR SET ON.Pressing the button again willnot switch COLOR SET OFF.Use ALL OFF

“Color Set” buttons for assignedlight circuits

15

IntelliTouch Pool and Spa Control System User’s Guide

Dim LightsIn order to dim lights, the Dimmer Module (P/N 520406) must be installed by a qualified electrician in the LoadCenter or Power Center. Only incandescent tungsten filament lights may be dimmed (not Halogen lights). Thefeature circuit must be assigned a dimmer circuit function. To assign a circuit function, see page 43.

To dim lights, go to the assigned circuit name:

1. Press the button briefly next to the circuit name. A light shouldcome on and be switched on at the specified dimming level.

2. To change the dimming level hold the circuit button down untilthe Dimmer Level Settings screen displays as shown below.

3. Press the button next to Decrease to decrease the dimminglevel, and the button next to Increase to increase the dimminglevel. The percent value displays the current dimming levelsetting.

4. Press Save when done. The light will adjust to the set dimminglevel.

Note: Macros can turn on light dimming circuits, but lights cannot be dimmed through the macro.The dimming level must be changed for each light dimming circuit.

MENU SETUP ADVANCED CIRCUIT FUNCTION (NAME)

Getting There

DIMMER LEVEL SETTINGS

60%

DIMMER CIRCUIT AUX1

EXIT

IntelliTouch Pool and Spa Control System User’s Guide

16

Go to the Program/Select equipment screen. From this screen you canselect SPA, POOL or any of the AUX equipment circuits to program.

1. Press the top right button next to POOL to access the “Program”screen to program the pool equipment.

2. To set the start time: Press the second button down on the leftside, next to HOURS (and the start flag icon) to set the hour.Press the right button to set the minutes for the start time. To usethe “EGGTIMER” feature, see page 18.

3. To set the stop time: Press the third button down on the left side,next to HOURS (and the stop icon) to set the hour. Press the rightbutton to set the minutes for the stop time. To use the “ONCEONLY” feature, see page 17.

4. Days: If you want to program certain days and not run EVERYDAY, press the button either side of the DAYS label. The days ofthe week screen displays. The lights next to the days of the weekare on. To switch off a day, press the button next to the day. Thelight switches is off. To set all day on, all lights should be on. PressSave after selecting the days of the week to run the program. Theprevious screen will be displayed.

5. Press Save to save the current program.Note: If a circuit is assigned a color changing light Circuit Function (SAM, SAL, etc.) an additional menuat the bottom of Smart Start displays. Press this button to toggle between SS_Yes and SS_No. If the toplabel displays SS_Yes, the circuit will switch on and automatically begin changing colors.

6. To create another program, press the button next to the counter label (2/1) to access the next program screenand repeat steps 1 through 4. To erase a program press the Clear button then Save.

7. Press the Back button to return to the SPA, POOL and AUX equipment selection screen to choose otherequipment. Press the Exit button to return to the main screen.

Setting ON/OFF Times for EquipmentFrom the “Program” screen, you can schedule IntelliTouch to automatically run equipment like pool filtration orlights. Any circuit (auxiliary, feature, or macro) can be scheduled to switch on and off at a specific time and on aany day(s) of the week. Up to 99 total programs may be created for all circuits combined.

Schedule a program: The “Program” screen displays a program counter in the upper right (1/0) side of thescreen. This counter indicates the current number of scheduled programs. After setting the start and stop timeand the day(s) to run the first scheduled program, press Save to view the first program (1/1) and increment thecounter to next program. To access the next program screen, press the button next to the counter label (2/1).Set the start and stop time and the day(s) to run the second scheduled program (2/1). Repeat this process toenter another program. For example, 2/3 indicates that you are viewing program 2 of 3 total programs savedfor that circuit. 4/3 indicates that you are creating program 4 but only 3 are currently saved. After pressing theSave button, the counter updates to 4/4. Press the button to the right of the label counter to step through eachprogram first then display the unsaved program screen. The following describes how to program equipment torun the pool filtration system. This process is the same for any installedequipment listed on the screen.

MENU PROGRAM POOL

Getting There

(or any other circuit)

17

IntelliTouch Pool and Spa Control System User’s Guide

Using the Once Only TimerThe “Once Only” feature enables you to automatically switch equipment on for one time. For example, you canset to have the spa and heater switch on before you get home from work for one evening. Unlike a regularscheduled program, the “Once Only” program does not repeat.

Go to the Program/Select equipment screen. From this screen you canselect SPA, POOL or any of the AUX equipment circuits to program.

The following example describes how to program the spa equipmentusing the “Once Only” feature:

1. Press the button next to SPA to access the “Program/Select”screen to program the spa equipment. If this is the first program,the program counter displays (1/0).

2. Press the third button down on the left side, next to HOURS andselect ONCE ONLY (Once Only is displayed one press after11:00 PM).

3. Press the second button down on the left side next to HOURS toset the start time.

Note: Press the button under CLEAR to reset the defaultsettings.

4. DAYS: The label displays EVERYDAY which means today only.If the time you are setting has passed for today, the “Once Only”program is set for tomorrow. If you want to program certain daysand not run EVERY DAY, press the button either side of theDAYS label. The days of the week screen displays. The lights nextto the days of the week are on. To switch off a day, press thebutton next to the day. The light switches is off. To set all day on,all lights should be on. Press Save after selecting the days of the week to run the program. The previousscreen will be displayed.

5. Press Save to save the current program. The program counter displays (1/1).

6. Press the Back button to return to the SPA, POOL and AUX equipment selection screen to choose otherequipment. Press the Exit button to return to the main screen.

MENU/PROGRAM/SELECT

DISPLAY EXITBACK

IntelliTouch Pool and Spa Control System User’s Guide

18

Setting the Egg Timer FunctionThe “Egg Timer” feature lets you manually switch on equipment and switch off automatically after a specifiedtime. You can set this timer feature for other equipment such as lighting, the spa, or the spa jets. Equipment canbe programmed to be switched on for one minute to 24 hours. You can also use the “Don’t Stop” feature tooverride the 12 hour default switch off time, and run continuously until manually switched off.. If you have neverset the timer for a specific piece of equipment, the factory default time is set to 12 hours.

If you have a power outage, this feature will not switch the equipment back on, you need to use set the systemin “Service” mode at the Outdoor Control center to switch the equipment back on. For more information, referto “Service Mode,” on page 74.

Go to the Program/Select equipment screen. From this screen you canselect SPA, POOL or any of the AUX equipment circuits to program.

The following example describes how to program the spa equipmentusing the Egg Timer feature:

1. Press the button next to SPA to access the “Program/Select”screen to program the spa equipment. If this is the first program,the program counter displays (1/0).

2. Press the second button down on the left side, next to HOURSuntil EGG TIMER is displayed. (EGG TIMER is displayed onepress after 11:00 PM).

3. Press the third button on the left side next to HOURS to set countdown time in hours (from 00:00 to 23:00 hours). You can alsoselect “DON’T STOP” to run the circuit continuously untilswitched off manually. “DON’T STOP” is displayed one pressafter 23:00. Press the third button down on the right side next toMINS to set the minutes.

Note: Press the button under CLEAR to reset the defaultsettings.

4. DAYS: The label displays ALWAYS which means run the programto automatically shut-off in the specified time.

5. Press Save to save the current program. The program counterdisplays (1/1).

6. Press the Back button to return to the SPA, POOL and AUX equipment selection screen to choose otherequipment. Press the Exit button to return to the main screen.

MENU/PROGRAM/SELECT

DISPLAY EXITBACK

19

IntelliTouch Pool and Spa Control System User’s Guide

iS10 Spa-Side Remote ControllerThe iS10 Spa-Side remote controller is listed UL (1563) for use with the IntelliTouch systems at the water’sedge. An iS10 controller can control up to ten functions including a spa temperature adjustment. As many asfour iS10’s can be installed in i7+3, i9+3, i9+3S, and i10+3D systems. Only one iS10 is supported by the i5and i5S systems. Note, it is possible to use two iS10’s on an i5 system, however, the two iS10’s will mirroreach other (same ID’s).

Five in-line buttons control up to ten system functions numbered one through five from left to right as shown (ifthe system allows). A label above or below the buttons identifies each circuit function. A “peanut-shaped”middle button toggles between which row of circuit functions will be activated when one of the five in-linebuttons are pressed. A red status LED above and below the toggle button indicates which row (Top orBottom) is active. When one of the in-line buttons is pressed, an adjacent red status LED will be on light,indicating that the circuit has been activated. The default circuits activated by each button are shown in the tablebelow. The iS10 includes an LED display shows the current spa water temperature. The spa temperature maybe increased or decreased by pressing the up or down arrow button located under the display. Thetemperature display will blink while being changed. After setting the desired temperature, the display will returnto steady and show the actual temperature as it meets the set point. The temperature set by the iS10 is onlytemporary. When the Spa mode is switched OFF, the temperature set at the Indoor Control Panel will resumethe next time the spa mode is activated (see “Set Manual Heat for details on page 58). The Spa Mode willautomatically turn off after 24 hours. For iS10 button configuration information, see page 33.

iS10 Spa-Side Remote Controller

1nottuB,D3+01-,3+9i,3+7i,5i APS LOOP

S3+9i,S5i PMET-IH PMET-OL

nottuB 2 1XUA 5XUA

nottuB 3 2XUA 6XUA

nottuB 4 3XUA 7XUA

nottuB 5 4XUA 8XUA

Temperature LED Display

Temperature Down ButtonTemperature Up Button

Bottom Row Toggle Button

Top Row Toggle Button

Bottom RowLED Indicator

In-Line Button 1In-Line Button 2

In-Line Button 3In-Line Button 4

In-Line Button 5

Function LED Indicators

Top Row LED Indicator

Function LED Indicators

IntelliTouch Pool and Spa Control System User’s Guide

20

iS4 Spa-Side Remote ControllerThe iS4 Spa-Side remote controller is a double-insulated, waterproof device that is UL (1563) listed forinstallation at the water’s edge. It is typically installed at the tile-line of the spa wall, or in the deck within arm’sreach of a spa occupant. The iS4 provides remote switching of up to four control circuits from the spa ornearby location. It is typically used for activating spa circulation and any three auxiliary pieces of equipment(such as lights, jet pump, air blower, etc.). The red status light glows steady when in Spa mode and flasheswhile spa is heating. For iS4 button assignment information, see page 58.

iS4 Spa-Side Remote Controller (Wall or tile mount)

1 2 3 4

Red power LEDindicator

iS4 Spa-Side Remote Controller (Deck mount)

3 2 1

Red powerLED indicator

4

21

IntelliTouch Pool and Spa Control System User’s Guide

MobileTouch Wireless ControllerWith an operating range of up to 300 ft, the MobileTouch wireless controller provides the same functionality asthe IntelliTouch Indoor Control Panel. The optimum wireless transmit and receive range may be effected byphysical obstructions, (especially those containing metal), weather conditions, and geographical features.

WARNING! Do not plug in the AC adapter to a power source within five (5) feet of the pool and spa.Canadian installations require a minimum of (3) meters from pool water. Do not recharge outdoors.

CAUTION! The MobileTouch controller screen is an LCD (liquid crystal display) which can be sensitive tosunlight. When exposed for extended periods the LCD screen will heat up and go black. If this happens, placethe remote in a shaded area and allow the screen to cool down. Do not attempt to adjust the contrast or thescreen will be unreadable when it eventually cools. When used outside, keep the remote covered or in ashaded area. Prolonged exposure to sunlight may permanently damage the unit.

CAUTION! The MobileTouch wireless controller is only water resistant and can be exposed to temporarysplashing or wet hands. However, the controller is NOT intended to be submersible. Remove unit immediatelyif it is dropped in the water or exposed to rain. Store the unit indoors in a dry environment. Do not charge theremote when it is wet.

CAUTION! Only use Pentair approved AC adapter transformer.

Note: For details about enabling the MobileTouch wireless controller, refer to “Enabling theMobileTouch Wireless Controller,” page 31.

MobileTouch Wireless Controller

IntelliTouch Pool and Spa Control System User’s Guide

22

Charging the MobileTouch Wireless ControllerTo charge the MobileTouch controller battery:

• Plug the AC adapter (provided with the Personality Kit) into an AC wall outlet. Insert the AC Adapter pluginto the MobileTouch power jack.

Note: A full day’s usage requires a complete battery charge (4-5 hours). With a charge time of 10-15minutes on a dead battery, usage may be up to an hour. The battery is NOT field replaceable.Return unit to the manufacturer for factory service.

Using the MobileTouch Wireless ControllerThe range of the MobileTouch wireless controller can be up to 300 feet from its transceiver antenna. Theantenna is typically located near the IntelliTouch Load Center. The unit can be used all day at full power with acomplete battery charge (4-5 hours). With a charge time of 10-15 minutes on a dead battery, usage may be upto an hour.

To use the MobileTouch wireless controller:

1. The MobileTouch controller can be used while connected to the to the AC adapter or disconnected from theAC adapter power plug.

2. Press the button at the top of unit to switch the unit ON or OFF. The LCD backlight is set to switch off in fiveminutes by default. If you wish to change this setting, see “Preference Screen Options,” on page 37.

3. The MobileTouch controller is ready for use.

AC adapter power jackOn/Off button

MobileTouch Wireless Controoler

23

IntelliTouch Pool and Spa Control System User’s Guide

QuickTouch Wireless QT4 Remote ControllerThe QuickTouch QT4 wireless remote controller provides switching of up to four circuits. It is typically used foractivating the spa circulation, and for operating three auxiliary pieces of equipment (such as lights, jet pump, airblower, waterfall, etc.).

Each of the four functions on the QT4 remote controller has an ON and an OFF button. To switch a circuit onor off, press and hold the appropriate button for at least a full second.

Although the Remote is capable of duplicating any four circuits, it has been preset at the factory to control thefollowing:

• Spa button activates the spa circuit.

• A button activates Auxiliary 1 circuit.

• B button activates Auxiliary 2 circuit.

• C button activates Auxiliary 3 circuit.Note: To control circuits other than Spa, Aux1, Aux2 and Aux3, it is possible to make adjustmentsthrough the Indoor Control Panel or MobileTouch wireless control panel.

IMPORTANT: The QT4 remote may be used with wet hands, but should never be submersed inwater, as this could damage the unit. If accidental submersion occurs, dry unit out by removingbattery cover and removing battery. Position unit so that water can drain out. Reassemble when theunit is completely dry.

QuickTouch QT4 Wireless Remote Controller

IntelliTouch Pool and Spa Control System User’s Guide

24

25

IntelliTouch Pool and Spa Control System User’s Guide

Preparing the System forInitial Start-Up

IntelliTouch Pool and Spa Control System User’s Guide

26

Setting up the IntelliTouch SystemUse the following recommended steps to configure the IntelliTouch system using the Indoor Control Panel orMobileTouch controller.

1. Main screen settings (pages 37 - 38)Set time, date, clock, button beep sound levels, lights and screen brightness levels.

2. Assign circuit names (pages 40)Assign circuit names for output auxiliary equipment.

3. Creating custom names for auxiliary circuits (page 42)There are nearly 100 circuit names stored in the IntelliTouch software (see page 23 for the complete list). If youcannot find one to fit your application you can create up to 20 custom names.

4. Assign a circuit function to a circuit name (Page 43 )From your worksheet Programmable Settings section, assign circuit functions to all circuits that are notmarked GENERIC. Nothing needs to be done if the circuit is GENERIC (simple ON/OFF when the button ispushed). From the Circuit Functions screen, you can also assign special logic to a circuit by selecting one ofthe circuit functions. The circuit functions are: Master Cleaner, Light, Dimmer, SAM Light, SAL Light, PhotonGenerator, Spillway, and Color Wheel. Check page 25 for all names

5. Create and assign a feature circuit name (pages 56)Based on the temporary circuit names from the worksheet (page 61), create and assign circuit names to theauxiliary (AUX) connections. On the Assign Circuit Screen, auxiliary circuit names are assigned throughDisplays 1 through 4. Displays 1 through 4 correspond to the main Load Center or Power Center (Display1) to which they are wired. Display 2 through 4 may be additional Expansion Centers. Note the original namespresented, AUX 1 through AUX 10, correspond to the plug-in location of the relay on the Outdoor ControlPanel in the main Load Center or Power Center. Feature circuits are assigned on the Feature Circuit screen.Select from the available list circuit names. For a complete list of circuit names see page 41. Up to 20 additionalnames may be custom created prior to assigning names, see page 42. If the circuit is to be a Macro, then referto page 57.

6. Configure valve actuators controlled by AUX or feature circuit (page 48)Assign which circuits will activate which valves (A and B or optional C, D, E). If more than one circuit mustoperate the same valve, then one Feature Circuit may be created and configured to activate the valve. Thencreate Feature Circuits for all other circuits and use the Macro function to activate the valve along with any relayconnections. Feature circuits are not available for i5 or i5S systems.

27

IntelliTouch Pool and Spa Control System User’s Guide

7. Setting up additional equipment (pages 48)Tell the system what special equipment the system may have.

• Is solar heating available? Is solar being used for a heat pump?

• What circuits will turn 2-Speed pumps to High Speed?

• Cool-down cycle for the heater - Lets you set circuits that switch the filter pump to high speed.

• Do you want to delay turning off the filter pump for 10 minutes when the heater is turned off?

• Do you want the spa to heat whenever the Spa button is pressed?

8. Set up Solar Equipment, 2-speed pump, Set a heater cool-down cycle (pages 49)Set up additional equipment if required. Set up the chlorine generator

Set up the Indoor Control Panel to operate with optional salt chlorine generators.

9. Configuring the heater system options (pages 12)Set times for automatic circuit activation. Each system may have up to 99 total programs. All user createdprograms are active all the time; so check that there are not conflicting automated times.

10. Create Macros from Feature Circuits (pages 57)Now that all the simple circuits are defined, you may combine circuits (Auxiliaries and Features) to maximize thesystem capability. Feature circuits that are assigned as Macros may also have all the same Circuit Functionsand Equipment capabilities as any other circuit. Simply repeat the above steps using the Feature Circuit name.

11. Configure spa-side remote (iS4, iS10, QT4) buttons (pages 58)Set which circuits will be operated by which button on each remote. Once you have checked all buttonsoperate properly, place labels on remote controls.

12. Set the delay cancel feature (page 51)Set the one time Delay Cancel feature for the heater, 2-speed pump, and automatic pool cleaner.

13. Set on/off times for circuit (pages 16-18)Set times for automatic circuit activation. Each system may have up to 99 total programs. All user createdprograms are active all the time; so check that there are not conflicting automated times.

14. Configure the lighting options screen (page 45)From this unique lighting screen you can enable special control of your pool and yard lighting, such as colorchanging lights, and synchronized colored lights.

IntelliTouch Pool and Spa Control System User’s Guide

28

Adding Multiple Controllers and Expansion CentersWhen adding multiple Indoor Control Panels, iS10 Spa-Side controllers, and Expansion Centers, you will needto manually enable each controller and assign an Expansion Center. The IntelliTouch system will then beconfigured to use the additional controller and Expansion Center. To manually enable a wired controller, refer to“Manually Enabling Wired Controllers and Remotes,” on page 29. To assign multiple expansion centers, refer to“Assigning Additional Expansion Centers” on page 30.

Adding a MobileTouch Wireless ControllerBefore using a MobileTouch wireless controller with the IntelliTouch system, it must first be manually enabled.For details, refer to “Enabling a MobileTouch Wireless Controller,” page 31.

Testing the Indoor Control Panel and MobileTouch ControllerTo test communication to the Outdoor Control Panel for either the Indoor Control Panel or MobileTouch:

• Press the button next to Spa or Hi-Temp (upper left, depending on the model of Indoor Control Panel). Agreen light will be on. If none of the lights are on, refer to System Problem Diagnosis,” page 79, in theTroubleshooting section.

Automatically Enabled Wired ControllersWhen powered up for the first time, the IntelliTouch system will automatically enable one each of the followingwired controllers:

• Outdoor Control Panel (located in the main Load Center or Power Center)

• Indoor Control Panel (wired to the Personality board in Load Center)

• iS10 Spa-Side Remote (wired to the Personality board in Load Center)

• Expansion Center (includes Outdoor Control Panel model i5x or i10x)

ExpansionCenter (OutdoorControl Panelmodel i5x ori10x). May beLoad Center orPower Center

IntelliTouch System Controllers (automatically enabled)

Main Load Center orPower Center(Outdoor Control Panelmodel i9+3, i9+3S,i10+3D)iS10 Spa-Side Remote

Indoor Control Panel

29

IntelliTouch Pool and Spa Control System User’s Guide

Manually Enabling Wired Controllers and RemotesTo manually enable additional wired controllers, remotes (Indoor Control Panel, iS10 Spa-Side remoteController) and Expansion Centers, perform the following steps on the Outdoor Control Panel located in themain Load Center or Power Center and at the controller(s) and additional Expansion Centers.

Note: For information about how the IntelliTouch automatically enables wired controllers, refer to the“Automatically Enabled Wired Controllers,’’ page 28.

To manually enable additional wired controllers and Expansion Centers:

1. On the Outdoor Control Panel, press the Reset button.

2. The three red System Control LEDs will be on for about 10 seconds. While these LEDs are lit, pressauxiliary Button 1.

3. The auxiliary LEDs begin flashing together. The system is ready to enable the additional wired controllers(Indoor Control Panels, iS10 Spa-Side remote controllers, and Expansion Centers).

4. ENABLE EACH CONTROLLER OR REMOTE: For instructions about enabling each controller, remote andExpansion Center, refer to the following:

• Indoor Control Panel, go to page 66

• iS10 Spa-Side Remote, go to page 33

• Expansion Center, go to page 30

5. After each controller is enabled, press Reset on the Outdoor Control Panel and wait until the red Auto andPool LEDs are lit. The system is ready for normal operation.

Main Outdoor Control Panel (Located in the Load Center or Power Center)

Auxiliary LEDs

Reset button1 buttonF button(i5, i5S i7+3,i9+3S, i9+3)

P button (i10+3D)

Three SystemControl LEDs

IntelliTouch Pool and Spa Control System User’s Guide

30

Assigning Additional Expansion CentersUp to three additional Expansion Centers can be used in an IntelliTouch system. The IntelliTouch systemautomatically assigns the “main” Load Center or Power Center as number 1, and other additional ExpansionCenters as number 2, 3, or 4. An Expansion Center includes an Outdoor Control Panel (model i5x or i10x)which is connected to the Load Center or Power Center.

Note: If the first Expansion Center was installed with the main Load Center or Power Center, it willautomatically be assigned as number 2. Other additional Expansion Centers need to be manually assigned anumber.

To manually assign a number for an Expansion Center:

1. On the Expansion Center, press the Reset button and wait for two seconds, and press Button 1. TheSystem Control LEDs on the Expansion Center will flash.

2. Buttons 2, 3, and 4 LEDs will be on. Do one of the following:

• If this is the first Expansion Center, press Button 2.• If this is the second Expansion Center, press Button 3.• If this is the third Expansion Center, press Button 4.

Note: Do not set more than one Expansion Center to the same number. These numbers correspondwith the numbered display screens on the Indoor Control Panel and MobileTouch wireless controller.

3. The red LED will be on above the selected button number.

4. Repeat the steps above for each additional Expansion Center.

AdditionalExpansion Center(3 maximum)

Main Load Center(i9+3, i9+3S, i10+3D)

Expansion Center(i5x or i10x)

AdditionalExpansionCenter

Number 1 Number 2 Number 3 Number 4

Note: Expansion Centers may be a Load Center or Power Center.

31

IntelliTouch Pool and Spa Control System User’s Guide

MENU SETUP ADVANCED

Getting There

Press button 2 and 4 at the sametime to access the ServicePersonnel screen

Enabling a MobileTouch Wireless ControllerWhen adding a MobileTouch wireless controller to a new or existing IntelliTouch system installation, you mustfirst manually enable it before using it with the IntelliTouch system.

To manually enable the MobileTouch wireless controller:

1. On the Outdoor Control Panel, press the Reset button.

2. The three red System Control LEDs will be on for about 10 seconds. While the LEDs are on, press the“F” Filter button. For model i10+3 press the “P” Pool Filter Pump button. For model i5S, press the1 button.

3. The auxiliary LEDs will cycle through the V (or F) button and the 1, 2, ,3, 4 buttons. The system is ready toenable the MobileTouch wireless controller.

Go to the Advanced screen.

4. From the MobileTouch Advanced screen, press buttons 2 and 4 at the same time. The Service Personnelscreen is displayed.

Auxiliary LEDs

Reset button1 buttonF button(i5, i5S i7+3,i9+3S, i9+3)

P button (i10+3D)

Three SystemControl LEDs

IntelliTouch Pool and Spa Control System User’s Guide

32

Enabling the MobileTouch Wireless Controller (Continued)

5. Press the button next to Lock On Address. This will setup the MobileTouch controller to operate on aunique frequency to avoid inference from other wirelessdevices within range of the controller’s Transceiver.

6. Select the control panel number (1, 2, ,3 or 4) for thecontroller at hand by pressing either button next to the panelnumber. Do not select a number already in use by anothercontroller. Any combination of up to four Indoor ControlPanels and/or MobileTouch control panels may be configured.

7. You will automatically be returned to the Service Personnelscreen. Press Exit to return to the main screen.

8. Repeat these steps for each controller if necessary.

9. Return the Load Center or Power Center. The System ControlLEDs will be flashing. Press the Reset button. When the“Auto” LED is on the process is complete and the system isready for operation.

33

IntelliTouch Pool and Spa Control System User’s Guide

Adding an iS10 Spa-Side Remote ControllerUp to four iS10 Spa-Side remote controllers can be installed to allow each iS10 to operate different functionsor to the same functions at different locations. Each iS10 can be assigned as number 1, 2, 3, or 4. If a differentnumber is not assigned to each installed iS10, then all iS10’s are assigned as number iS1. This is useful if youwish to have the same functions available at different iS10 locations.

The following steps describes how to manually assign each iS10 a number 2, 3, or 4 as required.

Note: If the first iS10 was installed with the main Load Center or Power Center, it willautomatically be assigned as number 1. Other additional iS10s need to be manually assigned.

To configure an additional iS10:

1. On the iS10, press the bottom part of the “peanut shaped” toggle switch and the 1 button at the same timewhile the Outdoor Control Panel lights are flashing.

2. The temperature display should read SHA.

3. The four red LEDs adjacent to the in-line buttons will be on. Do one of the following:

• If this is the second iS10, press 2. The temperature display reads IS2.• If this is the third iS10, press 3. The temperature display reads IS3.• If this is the fourth iS10, press 4. The temperature display reads IS4.

4. The iS10 Spa-Side Remote red LEDs will start to flash for about a minute. Wait until they stop flashing beforeresuming normal operation.

Note: To configure the buttons on the iS10 and QuickTouch (QT4) remote controller, refer to“Configuring Remote Control Button Circuits (iS4, iS10, QT4 QuickTouch, and Phone Remote” onpage 58. To disable or enable the iS10 Spa-Side Remote from the Indoor control Panel, refer to“Disable/Enable Spa-Side Remote,” page 60.

Main Outdoor Control Panel and iS10 Spa-Side remote controller

Auto, Service and

Time Out LEDs

Press Toggle switch and 1 Button as the same time

IntelliTouch Pool and Spa Control System User’s Guide

34

Prepare the System for OperationNote: If the system needs to be reset to the factory defaults, see “Erasing the System Memory,” onpage 65.

If you have more than one Indoor Control Panel, you only need to configure just the one main panel. OtherIndoor Control Panels will be configured with the same settings and use the configured settings. Use thefollowing steps to ensure that the IntelliTouch system is properly set up and working correctly. Before you start,make sure you have:

• Pen and paper• Marker to label the circuits. Use the provided Circuit ID label worksheet (see page 68-73), a permanent

marker, or other permanent means of labeling.• If you are setting up a large system that covers a large area, ask your assistant to visually inspect the

equipment while you test the circuits from the Outdoor Control Panel.

Check the Main Load Center

1. Switch on the electrical power at the house breaker.2. Switch on the Load Center or Power Center. You may need to switch on the breakers on the Load Center.3. Wait for the following:

· The red Auto LED on.· The light labeled See Indoor Control Panel if Flashing to stop flashing.

4. Press the Service button to put the Load Center or Power Center in Service Mode for testing.

Note: If you are working with the i5, i7+3, or i9+3 systems, go to step 5. If you are working with the i5S,i9+3S, or i10+3D systems, skip step 5 and go to step 6. The IntelliTouch system model ID is located on thefront of the Indoor Control Panel below the low voltage circuit breakers.

5. Press the Valves button. Step through all four valve positions: Pool, Spa, Fill, Drain. Make sure the valvesrotate to the correct position and the water is moving in the correct direction for each position. If necessary,flip the actuator toggle switch to change the direction of the water. After setting the valves and the system is in“Auto” mode, do not change the toggle switches.

6. Press the Filter Pump button. Make sure the filter pump turns on correctly. If the pump has two speeds:Press the one time to run the pump in low speed. Press the button again to run the pump in high speed. Pressthe button again to switch the pump off. A Two-Speed pump has to be configured from the EQUIPMENTscreen.

7. Step through the rest of the system AUX buttons. Notice which button turns on which equipment. You mayneed to walk the property to find what each button turns on.

35

IntelliTouch Pool and Spa Control System User’s Guide

8. Press each AUX button to switch on each circuit. Affix a label under the appropriate button identifying thefunction and number of the circuit.

9. Repeat steps 4 through 9 for each Expansion Center. Note that Aux 1 through Aux 10 are used as circuitnames on the Expansion Centers. Do not duplicate these circuit names with the circuit names of the mainLoad Center or Power Center.

10. The system is automatically configured if there is no more than one Load Center, one Expansion Center, anIndoor Control Panel, and one Spa-Side Remote. If there are additional Expansion Centers and/orcontrollers, then these need to be configured. For details about adding multiple Expansion Centers andcontrollers, see “Enable Additional Expansion Centers” on page 30.

‘V” Valve button

“F” Filter Pump button

IntelliTouch systemmodel number

Label location forAUX circuit name

AUX circuits buttons/LEDs

IntelliTouch Pool and Spa Control System User’s Guide

36

Checking the Indoor Control Panel or MobileTouchTo test communication to the Outdoor Control Panel for either the Indoor Control Panel or MobileTouch:

• Press the button next to Spa or Hi-Temp (upper left, depending on the model of Indoor Control Panel). Agreen light will be on. If none of the lights are on, refer to System Problem Diagnosis,” page 79, in theTroubleshooting section.

37

IntelliTouch Pool and Spa Control System User’s Guide

Setting up the IntelliTouch System using the Indoor Control Panel orMobileTouch

This section describes how to configure and set up the IntelliTouch system via the Indoor Control Panel orMobileTouch.

The Preference Screen OptionsFrom the Preference screen you can change the control panel beeper volume, display settings, and set the

screen contrast.

To change the screen settings go to the Preferences screen.

1. To change the display backlight: Press the top left orright button and select the option that you want. The optionsare; OFF IN 5 MIN, BLANK IN 5 MIN, and ALWAYSON.

2. To change the display contrast: Press either the left orright second button down, next to the Up or Down to set thecontrast level.

3. To change the brightness of the LED lights: Press eitherthe left or right third button down, next to LED Brightnesslabel to set brightness level to set the brightness level. TheLED brightness levels are 100%, 75%, 50%, and 25%.

4. To change the display backlight brightness: Press eitherthe left or right fourth button down, next to BacklightBrightness label to set the backlight brightness. Thebacklight brightness levels are 100%, 75%, 50%, and25%.

5. To turn the button beeper sound off: Press the buttonnext to the User Interface label. In the next screen, pressthe button next to Beeper Level to OFF. To switch ON thesound, select HIGH. Press the Back button when finished.

Note: It is recommended to leave the Key Repeat Delay and Rate set to the factory defaultsetting (1/2 and 15 PS). The Key Repeat Delay adjusts the amount of time a key/button has tobe held down before it starts auto-repeating. Key Repeat Rate adjusts the number of times persecond (5, 10, 15, or 20 key repeats per second) the key/button repeats once it is held down.

6. When finished, to save the settings press the Exit button to return to the main screen.

IntelliTouch Pool and Spa Control System User’s Guide

38

Set the System ClockSetting the system clock allows all automatic pool functions to work correctly. Set the clock to the current timeand date for your area.

To set the system clock, go to the Clock screen.

1. Use the buttons on either side of the panel to set the timeand date.

2. Specify the Daylight Savings setting.If you are in an area that observes Daylight Savings, set thisto Auto. If you are in an area that does not observe DaylightSavings, set this to Manual.

3. Change the clock accuracy offset by seconds, press theright-side button to increase the offset and the left-sidebutton to decrease. The offset value can be set from -300 to+300 seconds.

4. Press the Save button when finished.

5. Press the Exit button to return to the main screen.

A

MENU SETUP CLOCK

Getting There

39

IntelliTouch Pool and Spa Control System User’s Guide

Assigning Circuit Names to Display 1 (or Display 2, 3, and 4)Setting the circuit names allows you to identify equipment from the Indoor Control Panel or MobileTouchwireless control panel. Many common equipment names are already programmed into the control panel.

You can also set up to 20 custom names for equipment, if one of the almost 100 programmed names does notfit. Customizing names can help the homeowner find unusual equipment they may have. For more information,refer to “Creating Custom Circuit Names for Auxiliary Circuits,” page 42.

You can also program multiple circuits to work with one button on the Indoor Control Panel and assign it acustom name. This is called creating a MACRO. For example, by creating a macro, you can program onebutton to switch on the spa, spa lights, fountain, and back yard lights. This is a two step process: first you createa custom name and then create the macro that program the functions to work together. Macros are stored in theFeature Circuits, where motorized valves, 2-Speed filter pump, and other features are saved. You can have upto 10 feature circuits. Note: This feature is not available with the i5 or i5S systems.

Note: The default top row of two circuits on Display 1 always has special reserved functionality thatcannot be changed. The default circuits may be given any name but always perform in the same manner.Be careful not to duplicate circuit names with these circuits. These circuits may also be used to activate2-speed pumps to high speed, turn additional valves, etc. The preset functionality is as follows:

About DISPLAY Screen 1, 2, 3, 4

The auxiliary circuits that control the pool and spa equipment can be accessed from the Indoor Control PanelDisplays screen. Pressing Display 1, 2, 3, or 4 will put you in the screen with circuits belonging to that particularLoad Center or Expansion Center. The Feature Display assigns Feature Circuits. The Displays screens are asfollows:

Display 1 - This screen shows the filter pump, pool and spa modes, andall high voltage auxiliary circuits connected to the Load Center or PowerCenter.

Display 2 - This screen shows additional auxiliary circuits connected tothe first Expansion Center.

Display 3 - This screen shows additional auxiliary circuits connected tothe second Expansion Center.

Display 4 - This screen shows additional auxiliary circuits connected tothe third Expansion Center.

MENU SETUP CIRCUIT NAMES ASSIGN CIRCUIT NAMES DISPLAYADVANCED

Getting There

IntelliTouch Pool and Spa Control System User’s Guide

40

Assigning Circuit NamesAssigning the circuit names allows you to use the pool equipment from the Indoor Control Panel. Manycommon equipment names are already programmed into the Indoor Control Panel.

Labeling Circuit Buttons in the Load CenterIn order to identify the equipment connected to theauxiliary circuits (SPA, AUX 1, AUX 2) in the LoadCenter, you need to assign names to the correspondingauxiliary circuits in the Indoor Control Panel. Manycommon equipment names are already programmed intothe Indoor Control Panel.

Use the written list of circuit names (button 1, button 2etc.) you made while setting up the Load Center. Findwhat you labeled circuit button 1, button 2 etc. The circuitnames you assign must match the labels you put on theLoad Center.

1. On the Assign Circuit Display screen, press thebutton next to the label AUX 1. A small arrowpointing to the name is displayed.

2. Get the written list of circuit names you made whilesetting up the Load Center. Find what you labeledAUX circuit button 1. The circuit names you assignmust match the labels you put on the Load Center.

3. Use the Up and Down buttons at the bottom of thescreen to scroll through the alphabetical list ofprogrammed names.

4. When you find the name you want, press the buttonnext to the label AUX 2. The small arrow moves tothat label. You are done setting the first circuit nameand are ready to program the next circuit.

5. Continue the process to assign the other circuits.Depending on the model you are programming, youmay not have equipment for all circuits.

6. When you are done assigning names, press the Save button.

7. Press the Exit button to return to the Main screen.

41

IntelliTouch Pool and Spa Control System User’s Guide

AERATORAIR BLOWERAUX 1AUX 2AUX 3AUX 4AUX 5AUX 6AUX 7AUX 8AUX 9AUX 10BACKWASHBACK LIGHTBBQ LIGHTBEACH LIGHTBENCHBLOWERBOOSTER PUMPBUG LIGHTCABANA LTSCHEM. FEEDERCHLORINATORCLEANERCOLOR WHEELDECK LIGHTDRAIN LINEDRIVE LIGHTEDGE PUMPENTRY LIGHTFANFIBER OPTICFIBERWORKSFILL LINEFLOOR CLNRFOGGERFOUNTAINFOUNTAIN 1FOUNTAIN 2FOUNTAIN 3FOUNTAINSFRONT LIGHTGARDEN LTSGAZEBO LTSHIGH SPEEDHIGH TEMPHOUSE LIGHTJETSLIGHTSLOW SPEEDLOW TEMPMALIBU LTSMISTMOTOR VALVEMUSIC

IntelliTouch Circuit NamesCustom Names (11 characters maximum)

USER NAME 01 ____________________

USER NAME 02 ____________________

USER NAME 03 ____________________

USER NAME 04 ____________________

USER NAME 05 ____________________

USER NAME 06 ____________________

USER NAME 07 ____________________

USER NAME 08 ____________________

USER NAME 09 ____________________

USER NAME 10 ____________________

USER NAME 11 ____________________

USER NAME 12 ____________________

USER NAME 13 ____________________

USER NAME 14 ____________________

USER NAME 15 ____________________

USER NAME 16 ____________________

USER NAME 17 ____________________

USER NAME 18 ____________________

USER NAME 19 ____________________

USER NAME 20 ____________________

(NOT USED)OZONATORPATH LIGHTSPOOL SAM 3SECURITY LTSLIDESOLARSPASPA HIGHSPA LIGHTSPA LOWSPA SALSPA SAMSPA WTRFLLSPILLWAYSPRINKLERSSTREAMSTATUE LTSWIM JETSWTR FEATUREWTR FEAT LTWATERFALLWATERFALL 1WATERFALL 2WATERFALL 3WHIRLPOOLWTRFL LGHTYARD LIGHT

IntelliTouch Pool and Spa Control System User’s Guide

42

Creating Custom Names for Auxiliary CircuitsThere are nearly 100 circuit names stored in the IntelliTouch software (see page 23 for the complete list). If youcannot find one to fit your application you can create up to 20 custom names. To create a custom name, firstchoose one of the 20 USERNAMES and change it from "USER NAME-01 thru -20" to your name of choice.Like this example, USER NAME-01 could be changed to LION'S HEAD. After you have created and savedyour custom names. For details, refer to “Assign a Feature Circuit Name,” page 56.

To create a custom circuit name go to the Create Custom Names screen.

Note: If you want to create a custom name you must program the name first.

1. Press the button next to the first User Name label you want tocreate. If no custom names have been created, all labels sayUser Name -01 through User Name -20.

2. Use the third and fourth button from the top to find the firstletter of the name.

3. Press the button next to SELECT once you have found yourletter. Then move on to the next letter. Note: You can alsoenter names in Spanish if required.

4. Press the Save button when you are finished. To programanother name, repeat steps 1 and 2.

5. Press the Exit button to return to the main screen.

43

IntelliTouch Pool and Spa Control System User’s Guide

Assign Circuit Functions and Freeze ProtectionAssigning circuit functions allows you set special logic to a circuit. For example, when setting up an automaticpool cleaner pump, you would assign the circuit function MASTER CLEANER. With this "Cleaner" logic thecleaner pump would force the filter pump on, and the cleaner pump would start after a delay of five minutes.The cleaner pump would automatically shut off whenever the spa and solar is switched on with the cleaner pumpwould be delay for five minutes if energy from the solar is required.

Freeze ProtectionFreeze protection switches on a circuit if the outdoor air temperature sensor detects the temperature is gettingclose to freezing (below 35° F). The system switches on all circuits that have been assign freeze protection, andruns the circuits for 15 minutes to stop the pipes from freezing. This is especially important if there is a pool andspa combination. If freeze protection is set to both the spa and pool circuits, the filter pump switches on and thepool and spa valves alternate every 15 minutes to keep the water moving in both the pool and spa. This processcontinues until the freeze condition is over.

Assigning Circuit Functions and Freeze Protection

To assign a circuit function:

1. The first line (CLEANER) displays the desired circuit that youwish to assign the function logic to. This circuit is selected fromthe previous screen.

2. The second line (MASTER CLEANER) shows the type oflogic needed for your circuit. Use the Next/Prev buttons toselect the function. For the complete list of the various types offunctions, see “Preset Functions List,” on page xx. Note: Youmust set pressure cleaners to Master Cleaner circuitfunction.

3. The third line shows “ON WITH FREEZE.” Select YES ifcircuit is to have freeze protection. If you select YES, thecircuit will turn on if air temperature drops to 35° F. Repeatsteps 1 through 3 for any other circuits that you want to assign freeze protection.

4. Press Save when finished.

5. Press the Back button to return to the Circuits screen or press the Exit button to return to the Main screen.

Note: SAP, POOL, HI-TEMP, LOW-TEMP factory default settings are set to FREEZE “YES.”

MENU SETUP ADVANCED CIRCUIT FUNCTIONS SELECT DESIRED CIRCUITSELECT DESIRED SCREEN DISPLAY 1,2,3,4 or F

This Button appears onlywhen you have FEATUREcircuits or multiple DISPLAYS.

Getting There

IntelliTouch Pool and Spa Control System User’s Guide

44

Special Function to a Circuit

cireneG elbammargorpehtllahtiwtiucricafolortnocffO/nOelpmiS.cigoLlaicepsoN.seitilibapac

renaelcretsaM seodtI.rotautcaevlavrenaelcrospmuprenaelcloopcitamotuahtiwskroW:gniwollofeht

.renaelcehterofebsetunim5nopmupretlifehtsecroF-

.nosiapsehtnehwfforenaelcehtsnruT-

.snigebgnitaehralosehtnehwsetunim5roffforenaelcehtsnruT-

thgiL .ffosthgilLLAronosthgilLLAsahcus,krowotserutaefgnithgillaicepsswollA

remmiD .dellatsniebtsumyalergnimmiD.krowotserutaefgnimmidthgilswollA

thgiLMAS roodnIehtnosneercsrehtonosmargorpgnithgilroloclaicepssetavitcAevahnacuoy,elpmaxeroF.sthgilloopMAShtiwdesunehwlenaPlortnoC

.hcnySroloCro,teSroloC,miwSroloCesuro,ffosthgilLLAronosthgilLLA

thgiLLAS roodnIehtnosneercsrehtonosmargorpgnithgilroloclaicepssetavitcAhtiwdesunehwlenaPlortnoC LAS evahnacuoy,elpmaxeroF.sthgilaps LLA

ro,ffosthgilLLAronosthgil .hcnySroloCro,teSroloC,miwSroloCesu

rotareneGnotohP roloCroteSroloCybdetarepoebblubcitporebifskrowrebiFriatnePsteL.gnithgilLASdnaMAShtiwdesunehwsmargorpmiwS

leehWroloC roodnIehtnosneercsrehtonosmargorpgnithgilroloclaicepssetavitcAnacuoy,elpmaxeroF.skrowrebiFriatnePhtiwdesunehwlenaPlortnoC evah

suro,ffosthgilLLAronosthgilLLA .teSroloCro,hcnySroloC,miwSroloCe

evlaV .desuyltnerructoN

yawllipS sihT.loopehtevobadesiarsiapsehterehwsnoitanibmocaps/looproFehtmorfretawehtslluppmupretlifehttahtosevlavnruterehtsevomgnittes

loopcitamotuA.tceffellafretawagnitaerc,apsehtottisnruterdnaloop.nodenrutsierutaefsihtnehwffodenruterasrenaelc

renaelCroolF 2neewtebwolfgnitanretlasetunim02yreveevlavyaw-3asevomgnittessihT.sdaehpu-popehtdeeftahtsevlavmetsysrenaelc

45

IntelliTouch Pool and Spa Control System User’s Guide

Setting up Lighting Options (Color Set and Color Swim) - Requires use of at

least two SAm and/or SAL and/or Fiberworks Lighting products controlled by separate AUX circuits

You may group up to 12 light circuits on a special Lights screen. The Lights screen is also used to activate thespecial lighting features. The Color Set and Color Swim special features each must have their own relay andseparate circuits. These lighting features are not available for the i5, and i5S systems.

IMPORTANT: Before proceeding, make sure the auxiliary circuits (AUX) that control the lights have beenassigned names. Then verify that SAm and SAL lights have been assigned in the CIRCUIT FUNCTIONS asSAM and SAL lights. If FIBERworks lighting is being used, it also has to be set up as a PHOTONGENERATOR for the circuit controlling the light bulb, and COLOR WHEEL for the circuit controlling the colorwheel (see page 44).

Color Set and Color Swim

Although the same screen is used to program the Color Set and Color Swim features, these two special lightingeffects operate independently of each other. It may take up to a minute or more for Color Set or Color Swim tooperate as programmed, depending on what kind of light you are activating and what state it was in when theeffect was activated.

• Color Set - Allows any combination of up to 12 SAm, SAL, and/or FIBERworks lighting circuits to bepreset to specific colors. For example, you can set the colors for red, white, and blue, or red and green.

• Color Swim - Allows any combination of up to 12 Am, SAL, and/or FIBERworks lighting circuits to bepreset to transition through colors in sequence, giving the appearance of the colors swimming across thewater. The delay in sequencing each light can be adjusted to customize the display for your pool. This featurerequires the use of at least two SAm, SAL, and/or FIBERworks lighting products controlled by separateAUX circuits.

• Sync - Causes all color changing lights to synchronize their colors.

Setting up Set Colors and Color Swim with SAm, SAL, or FIBERworksBoth the Color Set and Color Swim feature are configured on the same Lights screen, but operateindependently of each other. It may take up to a minute or more for Color Set or Color Swim to operate asprogrammed, depending on what kind of light you are activating and what state it was in when the effect wasactivated. The Color Swim feature create the illusion of bands of color moving through the water by switchingon each light with a specific color in a specified order and at different time intervals. The order and time delaybetween lights can be mixed and matched to create many different effects. For example, colors moving left toright, one body of water to another, from the middle outward, etc.

To add circuits to the Lights screen, press the Lights button on thebottom of the screen.

1. Press the button next to “Configure.” (Fifth button from the topon the right side).

LIGHTS CONFIGURE NEXT TO "NONE"PRESS BUTTON

Getting There

LIGHTS

ALL OFF SYNCSAVE ALL ON

CONFIGURE

POOL SAM 2

POOL SAM 1SPA SAL

COLOR SWIM

NEXT 6

COLOR SET

IntelliTouch Pool and Spa Control System User’s Guide

46

Setting up Set Colors and Color Swim with SAm, SAL,or FIBERworks (Continued)

2. Press the button next to “NONE” to assign a light circuit to the button.

3. Press the top button (either side) to scroll through the possible light circuits which can use Color Set andColor Swim.

4. Select the circuit you wish to set up. The displayed circuit names selections are circuit names that werepreviously assigned. If there are no circuits available for selection, refer to “Assigning Circuit Names” and“Setting Circuit Functions” on pages 40 and 43 for more information.

LIGHTS/CONFIG/POOL SAM 1

PREV NEXT

PREV

PREV

PREV

NEXT

NEXT

NEXTPOOL SAM 1

WHITE

1ST POSITION

DELAY 5 SECS

SAVE EXIT

Select the light circuitSelect the color

Select the light positionColor Swim: Set the delay time

between lights

Available light circuitAvailable light circuitAvailable light circuit

View next six lights

LIGHTS/CONFIG-SELECTION

EXITBACK

POOL SAM 2

POOL SAM 1SPA SAL

CONFIGURE NEXT 6

NONE

NONE

NONE

47

IntelliTouch Pool and Spa Control System User’s Guide

Setting up Set Colors and Color Swim with SAm, SAL,or FIBERworks (Continued)

5. Color Set: Press the second button down from the top to scroll through the color choices. Select thecolor of your choice. The selections are, White, Light Green, Cyan, Blue, Lavender, and Magenta.

6. Set Light Position: Press the third button down from the top to set the position of the first light in thesequence. Position 1 will lead all the other lights in the color changing sequence. Position 2 followsPosition 1 and so on. More than one light may be assigned to the same position number so that theircolors may be synchronized. For example, to make the colors swim right to left, make your right mostlight POSITION 1. You may need to go back to step 1 and scroll through your lights to find the rightmost light, and set it as POSITION 1.

7. Color Swim: Press the forth button down from the top to set the time delay between this light and theprevious position. Use a higher delay time for lights spread further apart. Try 5 seconds for all lights andobserve the effect. Use different time settings to achieve unique lighting moods and effects.

8. Press Save to save the current setting for the first light. You will return to the “CONFIGURE-SELECTION screen. To program the next light six lights, press the button next to “CONFIGURENEXT 6.” Repeat step 1 through 5 to set the light for POSITION 2 for Color Swim, and a new colorchoice for Color Set. Press Save. Repeat this process until all desired lights have set colors, positions anddelays.

9. Press Exit when finished configuring the light circuits.

IntelliTouch Pool and Spa Control System User’s Guide

48

Setting up EquipmentIf any special equipment is attached to the Load Center you need to configure the system to recognize theequipment. You may or may not have this equipment.

The following describes how to set up:

• Solar or heat pump equipment - Lets you set solar or heat pump heaters to work (see page 49).

• Two-speed pump - Lets you set circuits that switch the filter pump to high speed.

• Cool-down cycle for the heater - Lets you set a cool-down cycle for heaters that need it.

• Automatic spa heating when the spa is manually turned on - Heats the spa using the Spa button on theIndoor Control panel or the spa-side control, even when the heater is set to OFF in the Heat screen. This letsthe homeowner heat the spa on-demand. Timed programs will not heat the spa.

Manual Priority Override of Timed Program CircuitsA circuit that is programmed to switch off at a certain time of day will always switch off at that time even if thecircuit was manually turned on. For example, a circuit has a program that switches it on from 4 PM to 6 PM.The circuit is activated at 3 PM. At 6 PM the circuit will switch itself off and need to be reactivated manually.

This internal logic may be manually overridden so that a circuit turned on manually will default to the 12 hourtime-out instead of turning off at the programmed time.

Go to the Priority screen.

1. Press one of the top buttons next to Manual Op Priority until Yes displays.

2. Press Save.

3. Press Exit to return to the main screen.

MENU SETUP EQUIPMENT PRIORITY

Getting There

49

IntelliTouch Pool and Spa Control System User’s Guide

MENU SETUP EQUIPMENT SOLAR

Getting There

Setup Solar Equipment and Heatpump option

To set up the solar equipment

Note: If solar is set then the Valve A actuator will bededicated to the solar valve actuator. Setting the system toHeat pump will free Valve A for use on other valves.

Go to the Solar screen.

1. Press the button next to the “Water Solar Present” tochange it to Yes.

2. If a heat pump is being used instead of a solar heatingsystem, also press the second button to change “Solar is aHeatpump” to Yes.

Note: For model i10+3D, press YES for each body ofwater with solar heating.

3. Press the Save button when finished.

4. Press the Exit button to return to the main screen.

IntelliTouch Pool and Spa Control System User’s Guide

50

MENU SETUP PUMP DELAYSEQUIPMENT

Getting There

MENU/SETUP/EQUIPMENT/PUMP DELAYS

DELAY FOR VALVES NO

YES

Setting up a 2-Speed PumpEquipment circuits displayed on this screen will automatically switch a two speed filter pump to high speedwhen these circuits are switched on. In this example, the FILTER PUMP will switch from low speed to highspeed whenever the JETS or CLEANER is on.

Go to the 2-Speed Pump screen to select your choice of heatoptions to force the pump to high speed:

1. Press the button next to a None label. The small arrow ispointing to the name of that label.

2. Use the Up and Down buttons at the bottom of the screen andscroll through the previously assigned names to add anothercircuit for switching filter pump to high speed. After you havefound the desired circuit, you can add another circuit by repeating step 1, or go to step 3. You can use aFEATURE circuit as one of the circuits which can switch the pump to high speed (except for models i5and i5S).

3. Press the Save button. When you find the circuit names that you want, or that will switch the filter pump tohigh speed.

4. Press the Exit button to return to the main screen.

Note: With a dual equipment system i10+3D, the left column controls the spa pump and the rightcolumn controls the pool pump.

Set a Cool-Down Cycle for the Heater

Go to the Pump Delays screen.

1. Find the Master Spa/Pool label. Press the button next to it tochange the setting to Yes.

2. Press the Save button when finished.

3. Press the Exit button to return to the main screen.

Note: Pentair heaters do not require this feature.

MENU SETUP EQUIPMENT 2-SPEED PMP

Getting There

51

IntelliTouch Pool and Spa Control System User’s Guide

Delay Cancel FeatureFor convenience, on a one time basis, the DELAY CANCEL feature will cancel the following safety delayswhich can be set up in the IntelliTouch system. Please note there is generally not a need to cancel any of thesedelays except for servicing or testing the system.

• Heater Cool-Down Delay Cancel: Shuts Filter Pump off immediately.

• 2-Speed Filter Pump 5 minute START on HIGH SPEED Delay Cancel: Shifts pump to low speed.

• Automatic Pool Cleaner START Delay: Starts Cleaner Pump immediately. Normally there is a delay inwhich the filter pump first runs for 5 minutes before the cleaner pump starts.

• Automatic Pool Cleaner-SOLAR Delay: Allows Cleaner Pump to run even though solar delay has shut itoff for 5 minutes.

About the Heater Cool-down Cycle and Delay Cancel

Some heaters require a cool-down cycle before being turned off. This can be accomplished with a SET UPprocedure in the IntelliTouch system which runs the filter pump an additional ten minutes to dissipate residualheat built up inside the heater combustion chamber. The DELAY CANCEL feature is mainly for use by servicetechnicians when they want to shut the filter pump off immediately, and know the heater has not been running.

IMPORTANT: Heaters manufactured by Pentair Water Pool and Spa do not require this cool-down periodand do not need the delay to be set up.

To cancel a safety delay:

Go to Delay Cancel Screen

1. Press the button next to the Delay label. The selectedequipment is switched off and the pool is ready to be serviced.

2. Press the Back button when finished. The Delay switches offand your system is set back to normal.

MENU DELAY CANCEL

Getting There

IntelliTouch Pool and Spa Control System User’s Guide

52

Set Automatic Spa Heating When the Spa is Manually Switched OnGo to the Manual Heat screen.

1. Find the Spa Manual Heat label. Press the button next to itto change the setting to Yes (default setting).

2. Press the Save button when finished.

3. Press the Exit button to return to the main screen.

Note: If you do not want the heater to switch on when youpress the SPA button, change the factory setting from YES toNO.

Changing the Display to Show Fahrenheit to CelsiusYou can change the temperature settings to show either Fahrenheit orCelsius.

To change the temperature settings go to the Degrees C/F screen.

1. Find the label next to the Degrees Displayed In button.

2. To change the setting to the either Fahrenheit or Celsius,press the button next to the label.

3. Press the Save button to save your settings,

4 Press the Back button when finished.

MENU SETUP MANUAL HEATEQUIPMENT

Getting There

53

IntelliTouch Pool and Spa Control System User’s Guide

Chlorine GeneratorThe IntelliTouch system is designed to operate with the following salt chlorine generators:

• IntelliChlor• GoldLine Aqua Rite• Clear Tech Automation AutoClear Plus• AutoPilot Pool Pilot Digital

Note: Call your manufacturer for compatibility with IntelliTouch systems.

Activate the Chlorinator Control InterfaceBefore operating the chlorinator control interface you must first activate the system to control the chlorinatorfrom the IntelliTouch Indoor Control Panel. The IntelliTouch system can control the chlorinator but does notturn the chlorination system on or off. When the chlorinator control is enabled, the chlorinator can only beoperated by the IntelliTouch. When the chlorinator controlis disabled, the chlorinator is still operating but must becontrolled at the chlorinator control panel.

To obtain chlorination status and make adjustments:

Go to the Chlorinator screen.

1. Press the button next to Control Enabled until Yes isdisplayed.

2. Press Save.

3. Press the button next to Chlorinator to display the chlorinator screen. At the top of the screen your brand ofchlorinator is displayed.

• STATUS line: Describes the current chlorinator operating condition. Any error codes will display here.

• WATER SALT LEVEL: Displays how much salt (in parts per million (ppm)) is in the water. See chlorinatormanufacturer’s instructions for recommended salt levels.

• OUTPUT LEVEL (0 -100%): Displays the chlorination output level from 0 to 100%. Press the button nextto UP or DOWN button to increase or decrease the chlorination output level.

• CONTROL ENABLED: Press the button next to YES until NO is displayed to disable the control of thechlorination interface from the Indoor Control Panel.

4. Press Exit to return to the main screen.

MENU SETUP EQUIPMENT CHLORINATOR

Getting There

IntelliTouch Pool and Spa Control System User’s Guide

54

Changing the Chlorinator OutputThe IntelliTouch system will automatically drop the chlorine output levels to 1/20 the output when the Spa modeis switched on. For example, if the output level is set to 60%, when Spa Mode is switched on, the chlorinationlevel is reduced to 3%.

To change the chlorine output level:

Go to the Chlorinator screen.

1. Press the buttons next to Output Level to raise or lower the output level. The level displays the 0 to 100%.

2. Press Save when done.

3. Press Exit to return to the main screen.

Super Chlorinate the PoolAt the start of the pool season or after long periods of disuse you may want to “super chlorinate” the pool toprepare it for swimming.

MENU SETUP EQUIPMENT CHLORINATOR

Getting There

Go to the Chlorinator screen.

1. Press the bottom button next to Super Chlor.

2. The default run time for super chlorination is 24 hours.Press the buttons next to Hours to Run to change the runtime of super chlorination mode.

3. Press Save when done. The chlorinator willautomatically start super chlorination and switch on thefilter pump. When done the system will return to normal.

4. To cancel super chlorination: Go back to theChlorinator Screen. The time left for super chlorination isdisplayed.

5. Press the button under Cancel Super Chlor.

6. Press Exit to return to the main screen.

Note: For information about wiring a salt chlorinegenerator to the IntelliTouch system , see “WiringIntelliTouch to a Salt Chlorine Generator,” on page 90.

55

IntelliTouch Pool and Spa Control System User’s Guide

Configuring Valve Actuators (Controlled by AUX or Feature Circuit)All IntelliTouch systems can drive two auxiliary valve actuators (A and B) for applications such as solar heatingand water features. With the addition of the Valve Module (P/N 520285), installed in the Load Center orPower Center, the system will accommodate up to three additional actuators (C, D, and E). An AUX circuit orFEATURE circuit can control auxiliary valve actuators. Please note that the i5 and i5S models do not includeFEATURE circuits and therefore must use the AUX circuits for controlling valve actuators. By using Featurecircuits to control valve actuators, you can conserve your AUX circuits for high voltage relays for controllingpumps and lights. Use Macros to couple valve actuators with AUX circuits for specific applications.

Note: All Personality boards (including i5x and i10x) has two valve outputs A & B. With the addition ofthe Valve Module (P/N 520285) board that connects to the Personality board, three additional valveoperators can be added to the system.

Configuring Valve Actuators

Note: If Expansion Centers are a part of the system, before thisscreen, you must select which main Load Center or PowerCenter you wish to configure. The Load Center or PowerCenter number matches display number (1 through 4).

Go to the Configure Valves screen.

1. Select the button next to the valve actuator you wish toconfigure. Keep pressing the button until you find the circuitname which you would like to use to control that valveactuator.

Valve A: Resides on the Personality board. If solar heating issetup AND NOT configured as a heat pump, then this valve isdedicated for controlling the solar heating valve actuator.

Valve B: Resides on the Personality board next to Valve A.

Valves C, D, E: Reside on the optional Valve Module board that may be plugged into the Personality boardin any Load Center or Power Center.

2. Repeat the above steps for each valve actuator.

3. Press Save when done.

4. Press Exit to return to main screen.

MENU SETUP ADVANCED CONFIGURE VALVES

Getting There

IntelliTouch Pool and Spa Control System User’s Guide

56

Feature CircuitsFeature Circuits provide a way to control a piece of equipment, which is not controlled by an AUX circuit.Typically AUX circuits are used for high voltage equipment such as pumps and lights, whereas Feature Circuitsare used for valve actuators. However, Feature Circuits can go beyond this definition, and be used in othercreative ways. For example, Feature Circuits may be used to create a Macro circuit in which several othercircuits can be switched on or off with the same button. This is accomplished by first choosing a name for yourMacro and assigning that name to a Feature Circuit. There is a limit of 10 Feature Circuits in the system.Macros are not available with i5 or i5S systems.

• Valve Actuators - Feature Circuits may be assigned for controlling up to five valve actuators per LoadCenter, which requires the installation of the optional Valve Module P/N 520285 that include three actuatorsoutputs (C, D, and E) per Load Center. For more information about configuring valve actuators, refer to page28.

• 2-Speed Pump - A Feature Circuit may be assigned as a way to turn a 2-speed Filter Pump to high speed.

• Spa Spillway - A Feature Circuit may be assigned to activate the Spa Spillway effect, where in a pool/spacombination, all of the pool water can be diverted to the spa then spill back into the pool.

Assign a Circuit Name to a Feature Circuit (not available for model i5 or i5s)

Note: Use the written list of circuit names and assigned buttons (button 1) on the Outdoor ControlPanel that you made while setting up the system. The circuit names you assign in the Indoor Control

Panel must match the button labels on the Outdoor ControlPanel.

1. Press the button next to the circuit that you wish to assign aname. A small arrow pointing to the name is displayed.

2. Use the Up and Down buttons to scroll through the list ofalphabetical programmed names. If you cannot find a name tomatch your circuit, you can create your own custom name bygoing back to the CREATE CUSTOM NAMES screen.For a complete list of the IntelliTouch Circuit Names, see thefollowing page.

3. Repeat step 1 and 2 for all the buttons you wish to assign names to. Continue to assign the other circuits.Depending on the model you are programming, equipment may not be installed for all available circuits shownon the screen.

4. Press the Save button when you are done assigning names.

5. Press the Exit button to return to the main screen.

MENU/SETUP/ADV/AUX/NAME/FEATURE

57

IntelliTouch Pool and Spa Control System User’s Guide

Create a MacroMacros give you the ability to combine various circuits together so a single button can operate them all at once.For example, you could create a Macro that would give you one button that turns on your spa, spa light,fountain, fountain light, and patio lights. You can assign a name to your Macro from the list of IntelliTouch circuitnames. For the complete list of names, see “IntelliTouch Circuit Names,” on page 41. You can also create yourown custom name, like SPA PARTY for example. A Macro also has the capability to switch a circuit off. So inthis SPA PARTY example, if there was a spa fountain which should not be on when spa is on (because it couldput cold water in the spa) it can be set up in the Macro to automatically switch off when SPA PARTY isswitched on. An OFF Macro can also be used to switch any number of lights off with one button. To create aMacro, first assign a feature circuit name, see page 56), assign the function name for the feature circuit, thengo to the Circuit Macros screen and set up your Macro.

Note: Macros may not be set as Dimmers although they can turn on light dimming circuits.

To create a macro, go to the Circuit Macro screen.

1. Select the button next the label you created. Press the buttonnext to the circuit you want to assign to this macro. If yoursystem includes more than 10 circuits, press the Displaybutton to view the next screen of circuits.

• To switch a circuit ON, press the button next to the circuitname one time. The light is on.

• To switch a circuit OFF, press the button next to the circuitname two times. The light blinks on and off.

• To set a circuit to be unaffected by the macro, press the buttonnext to the circuit name three times. The light is off.

Note: Be careful when you select circuits to switch on. Onemacro circuit can switch on another macro circuit, resultingin systems switching on or off that you do not want on or off.

2. Press the Save button when finished.

3. Press the Exit button to return to the main screen.

MENU SETUP CIRCUIT MACROS

Getting There

IntelliTouch Pool and Spa Control System User’s Guide

58

Configured for iS4

iS4 Spa Side Remote

Configured for iS10

Configuring Remote Control Button Circuits (iS4, iS10, QT4QuickTouch, and Phone Remote)

You can specify any Spa-Side remote button to control different functions. Each Spa-Side remote has a slightlydifferent screen, however, all screens configure the same, regardless of how many buttons the remote has.

To configure the Spa-Side remotes:

1. Press the button next to CONFIGURE iS4’S or CONFIGURE iS10’S or CONFIGUREQUICKTOUCH to select the remote.

• For iS4: Press the top button to access the iS4 setup screen.

• For iS10: Press the second button from the top to select iS10#1 for the first iS10. Choose which one of the four iS10’s youare configuring, iS10 #2, iS10 #3, or iS10 #4.

• For QuickTouch: Press the third button from the top toaccess the “CONFIGURE QUICKTOUCH” setup screen.

2. On the remote’s specific screen, press the button next to thecircuit you want to change. You see a small arrow pointing tothe name of that circuit.

3. Use the Up and Down buttons at the bottom of the screen toscroll through the previously assigned circuit names.

4. When you find the circuit you want, press the button next toanother Spa-Side control button circuit you want to change.The small arrow moves to that label. You are done setting thefirst spa-side control button circuit and are ready to set thenext.

5. Continue the process to assign other circuits to the spa-sidecontrol buttons.

6. When you are done assigning circuits to the buttons on theSpa-Side remote, press the Save button.

7. Press the Exit button to return to the main screen. You canpress Back to go back to the remotes screen and configureanother remote.

59

IntelliTouch Pool and Spa Control System User’s Guide

Setting up the Remote Control Telephone FeatureThe remote control telephone feature allows you to switch on a feature by calling the Indoor Control Panel viathe telephone.

You can only use this feature if you have the TELSPA installed in the Load Center or Power Center, connectedto the Personality board, and connected to your phone line.

The following describes how to switch on your spa remotely. However, you can scroll through the list ofavailable features and set any one of them. You can also use a macro circuit (see page 57).

To setup the telephone remote control:

Go to the Spa RF and Phone Remotes screen.

1. Press the fourth button from the top (CONFIGURE MOD-PHONE) to access the Phone Remote setup screen.

2. Press the top left button so that the arrow appears to the rightof NONE. If this is the first time you have set this feature,NONE is displayed.

3. Press the Up or Down buttons to scroll through the availablecircuit names until you find the function you would like toassign to the telephone remote. Choose the function you willuse most often, for example SPA allows you to call the systemand switch on spa filtration and heating with one command.

Note: If you are using the remote to turn on your spa, youmust also set up the spa for MANUAL HEAT. This allows the heater to always switch onwhenever the spa is switched on via the telephone. For more information, see page 52.

4. Press the Save button to save the setting. The remotes screen displays.

5. Press the Exit button.

IntelliTouch Pool and Spa Control System User’s Guide

60

Disable/Enable Spa-Side RemoteThis feature is useful for families with young children. It gives you an easy way to switch off the Spa-SideRemote so it cannot affect the system. You can enable and disable the Spa-Side Remote with the same button.Each time the button is pressed it toggles to either DISABLED or ENABLED.

Go to the Spa Side Remote Disable/Enable screen

1. To Disable: Press SPA SIDE REMOTE ENABLED.Screen will immediately respond and display SPA SIDEREMOTE DISABLED. Remote is now off.

To Enable: Press SPA SIDE REMOTE DISABLED.Screen will immediately respond and display SPA SIDEREMOTE ENABLED. Remote is now on.

2. Press the Back button when finished.

MENU SETUP ADVANCED REMOTES

Getting There

61

IntelliTouch Pool and Spa Control System User’s Guide

Service and Maintenance

IntelliTouch Pool and Spa Control System User’s Guide

62

Calibrating Temperature SensorsThe IntelliTouch system includes two temperature sensors (10 kΩ) for water and ambient air temperature. Youcan add a third sensor for controlling solar heating systems. Note: The i10+3D system includes three sensors.

Generally, these sensors are accurate and you do not have to calibrate them. However, long plumbing runs andwater features cause temperatures at a body of water to be different from the temperature sensor reading. Youcan manually recalibrate the sensors to adjust for this.

Before you start, you need an accurate all weather thermometer. If you are calibrating the air sensor, wait untilthe sensor is not in direct sunlight. Ensure that the air sensors are located in the shade for accurate freezeprotection.

To calibrate the sensors, go to the Calibrate screen.

There is a Water Temp and Air Temp setting. If you have an i10+3D system, you will see Spa Temp, PoolTemp, and Air Temp. Calibrate the Spa and Pool temperatures the same way as described below for WaterTemp. If you have an i5, i5S, i7+3, or i9+3 system, there will be one sensor water and one for air temperature.Make sure to locate the air sensor in the shade for accurate readings. Make sure to locate the solar sensor inthe sun for accurate readings.

To calibrate the water sensor:

1. Switch on the spa or pool filter pump.

2. Place the thermometer in the spa or pool, depending on the system model number. For shared equipment, youonly need to calibrate one body of water.

3. Take an accurate temperature reading.

4. At the Indoor Control Panel, press the buttons next to the Water Temp label to adjust the temperature up ordown. If you have an i10+3D repeat the above for the pool. The i10+3D has three sensors, one each for thespa and poll water and one for the air temperature. For the Solar option there will be one sensor for the poolsolar, and one for the spa solar.

5. Press the Exit button when finished.

To calibrate the air sensor:

1. Place the thermometer next to the air sensor. The sensor is normally located near or under the Load Centeror Power Center enclosure, not inside the enclosure.

2. Take an accurate temperature reading in the shade.

3. At the Indoor Control Panel, press the buttons next to the Air Temp label to adjust the temperature up ordown.

4. Press the Exit button when finished.

MENU SETUP ADVANCED CALIBRATE

Getting There

63

IntelliTouch Pool and Spa Control System User’s Guide

Checking Firmware VersionThe IntelliTouch factory installed operating system software is known as firmware. There is a different firmwareprogram loaded on the controllers (Indoor Control Panel and MobileTouch) and the Outdoor Control Panels.Every time the firmware version is changed it is assigned a new release level number (version #). Changes aremade to the firmware to either add functionality or enhance performance. If you need to determine the firmwarerelease level on your system perform the following steps.

To check the system firmware version:

Go to the Advanced screen.

1. From the Advanced screen, press buttons 2 and 4 at the same time. The Service Personnel screen isdisplayed.

2. Press the System Version Info button. The firmware version is displayed for the Indoor Control Panel andOutdoor Control Panel. Note: UOC is Outdoor Control Panel. UIC is Indoor Control Panel

4. Press Back to exit.

5. Press Exit to return to the main screen.

Note: Different controllers may have different release levels depending on when they were installed.To determine the release version of each controller repeat the above steps for each controller.

Using the Service Personnel ScreenIntelliTouch system information such as circuit configurations is retained in the Outdoor Control Panel memory.System information relating to user interface settings and ordering of controllers is retained locally at thecontroller (Indoor Control Panel, MobileTouch, iS10 etc.). All system information is backed up and updated toall Indoor Control Panels, MobileTouch controllers, and the main Outdoor Control Panel periodically. Ifrequired, you can upload or down load the current system configuration to and from the Outdoor Control Paneland controllers. This feature is available from the Service Personnel screen.

MENU SETUP ADVANCED

Getting There

Press both buttons at the same time toaccess the Service Personnel screen

IntelliTouch Pool and Spa Control System User’s Guide

64

Manually Updating Between Indoor and Outdoor Control PanelsWhen an update is made to the system configuration or a new component is added the system will automaticallycommunicate the updated information to all the other controllers. System configuration settings reside in allcontrollers and the Outdoor Control Panel. This facilitates configuration retrieval in the event one of thecontrollers or control panels is damaged. A system configuration update may be forced immediately by doingthe following:

To update system configuration information between controllers:

Go to the Advanced screen.

1. From the Advanced screen, press the 2nd. and 4th. buttonsat the same time. The Service Personnel screen is displayed.

2. Press Get Image from Outdoor to download a systemconfiguration residing in the Outdoor Control Panel memory.

3. Press Send Image to Outdoor to download a systemconfiguration residing in the controller at hand. You may see astopwatch clock flash indicating memory transfer.

4. When the transfer is finished, press Back to exit.

5. Press Exit to return to the main screen.

MENU SETUP ADVANCED

Getting There

65

IntelliTouch Pool and Spa Control System User’s Guide

Erasing the System MemoryThe IntelliTouch system includes dual micro processors, one on the Outdoor Control Panel, and the other on theIndoor Control Panel. System information relating to circuit configuration, operation and display is retained atthe main Outdoor Control Panel and all Indoor Control Panels and MobileTouch controllers. Systeminformation automatically downloads from programmed components to non-programmed components in case ofaccidental memory loss and to ease board replacement, system programmed memory can be erased andreturned to the factory default settings. Once this is done, the main Outdoor Control Panel (located in the mainLoad Center or Power Center) will auto-enable all connected wired controllers. If there are multiple ExpansionCenter, iS10’s, or Indoor Control Panels or a MobileTouch, each one of the controllers will need to be manuallyenabled.

To reset to the system to the factory default settings:

CAUTION: This procedure will erase all system settings. All controllers will need to be manuallyenabled again. If more than one wired Indoor Control Panel, MobileTouch, or Expansion unit(2, 3, or 4) is added, the system must be in “AUTO” mode.

1. On the main Outdoor Control Panel (located in the main Load Center or Power Center), press the Resetbutton. All the System Control lights turn on.

2. Press 5. The System Control lights flash OFF and then back on.

3. While the System Control LED lights are on, press 1.

4. The System Control LED lights flash.

Go to the Advanced screen.

5. From the Advanced screen, press buttons 2 and 4 at thesame time. The Service Personnel screen is displayed.

6. Press either button next to Erase EEPROM All!!7. When asked if you are sure you want to do this press YES.

8. Then select ERASE. The screen will blink a few times thenreturn to the main screen. All system configuration data shouldnow be erased.

9. Repeat this step with each controller.

10. At the Outdoor Control Panel press Reset and wait for the system to return to “AUTO” mode.

MENU SETUP ADVANCED

Getting There

1 button 5 button Reset button

SystemControl Lights

IntelliTouch Pool and Spa Control System User’s Guide

66

Manually Enable an Indoor Control Panel

About DISPLAY Screen 1, 2, 3, 4The auxiliary circuits that control the pool and spa equipment can be accessed from the Indoor Control PanelDisplays screen. Pressing Display 1, 2, 3, or 4 will put you in the screen with circuits belonging to that particularLoad Center or Expansion Center. The Feature Display assigns Feature Circuits. The Displays screens are asfollows:

• Display 1 - This screen shows the filter pump, pool and spa modes, and all high voltageauxiliary circuits connected to the Load Center or Power Center.

• Display 2 - This screen shows additional auxiliary circuits connected to the first ExpansionCenter.

• Display 3 - This screen shows additional auxiliary circuits connected to the second ExpansionCenter.

• Display 4 - This screen shows additional auxiliary circuits connected to the third ExpansionCenter.

67

IntelliTouch Pool and Spa Control System User’s Guide

System Worksheet OverviewSystem worksheets are provided to help you plan the system at start-up. Make copies of each systemworksheet (page 61 - 66) appropriate for your system and use a unique one for each Load Center or PowerCenter. Circle the Load Center or Power Center number on the top. Each worksheet is divided into aHardwired Connections and a Programmable Settings sections. The Hardwired Connections sectionrepresents which relays, actuators, and heater have been plugged into the Personality board. Some connectionsare mandatory for each system as shown on the work sheet. The Programmable Settings section representswhat functionality the circuit will have and is set from any Indoor Control Panel and/or MobileTouch controlpanel independent of the hardwired connection.

In the left-side column, write-in temporary circuit names based on the capabilities you want the system to have.For example: Spillway, Solar Heating, Cherub Fountain, etc. Eventually circuit names will be given to each ofthese capabilities. Although duplicate names can be used, it is best to keep each one unique. Be sure to writethe circuit name on the work sheet that will have the hardwired connection.

Mark on the worksheet which Hardwired Connections (relay or valves) will be activated by the circuit. It maybe helpful to fill this out at the Load Center or Power Center where the circuits and associated equipment maybe quickly verified. Remember the following rules to assist in making marks:

• Assign no more than one relay connection to any auxiliary circuit (shown on Display 1 through 4) EXCEPTfor 2-Speed or Feature Circuits.

• Feature Circuits may have multiple relay connections if set up as a Macro.

• Feature Circuits may have multiple valves assigned to them and 2-Speed without being set up as a Macro andwith no other relay connection.

• Valves A-E may be assigned to the same auxiliary circuit as a relay connection.

• If one valve is to be turned on by more than one circuit, then it is suggested to assign a Feature Circuit to justthat valve. That valve and any combination of relay connections may be activated with Macros.

• If SOLAR relay connection is checked and SOLAR is NOT a heat pump, also check Valve A. Valve A maynot then be used with any other circuit. Valve A and the SOLAR relay are activated when solar heating isenabled.

Mark Programmable Settings for each circuit. Mark what special Circuit Functions, if any, each circuit willhave. Circuit Functions may be assigned to any number of circuits. For a detailed description of CircuitFunctions, see page . If Spillway is checked, the Intake and Return valves will turn to divert all the pool intakewater to be returned to the spa. If “Floor Cleaner” is checked, then one or more valves must also be checkedto run the floor cleaner multi-port valves. If no special function will be assigned check GENERIC.

Write-in any automatically timed programs you want for a circuit. Up to 99 total timed programs may beassigned, but only three are presented on the work sheet. Indicate start times, stop times, countdown time(called “EGG TIMER”), days to be active, and if a color changing light whether or not it should change colorswhen turned on (SMART START).

Finally, indicate what circuits you want to appear on the Indoor Control Panel main screen and what circuits youwant activated by what buttons on a Spa-Side remote. The top buttons of the main screen are dedicated forSpa and Pool modes, however the lower buttons numbered downward may be configured to display anycircuit.

Note: The homeowner should keep the system worksheet for future reference.

IntelliTouch Pool and Spa Control System User’s Guide

68

WORKSHEET FOR SHARED EQUIPMENT SYSTEMSi5, i7+3, i9+3 (Sheet 1 of 2)

69

IntelliTouch Pool and Spa Control System User’s Guide

WORKSHEET FOR SHARED EQUIPMENT SYSTEMSi5, i7+3, i9+3 (Sheet 2 of 2)

IntelliTouch Pool and Spa Control System User’s Guide

70

WORKSHEET FOR SINGLE BODY SYSTEMSi5S, i9+3S (Sheet 1 of 2)

71

IntelliTouch Pool and Spa Control System User’s Guide

WORKSHEET FOR SINGLE BODY SYSTEMSi5S, i9+3S (Sheet 2 of 2)

IntelliTouch Pool and Spa Control System User’s Guide

72

WORKSHEET FOR DUAL EQUIPMENT SYSTEMSi10+3D (Sheet 1 of 2)

73

IntelliTouch Pool and Spa Control System User’s Guide

WORKSHEET FOR DUAL EQUIPMENT SYSTEMSi10+3D (Sheet 2 of 2)

IntelliTouch Pool and Spa Control System User’s Guide

74

The Main Outdoor Control PanelThe main Outdoor Control Panel consists of the Personality board mounted onto the motherboard. TheOutdoor Control Panel is housed in the Load Center or Power Center. It includes, control buttons for pumps,filters, and heater, red status lights, and a Reset button. The Personality board defines the type of equipmentinstalled. The Outdoor Control Panel can be used to override the Indoor Control Panel functions for poolservice and for equipment set up. The Outdoor Control Panel can be folded downward to access thePersonality board.

Note: Pressing System Control buttons at any of the Outdoor Control Panels, will affect the entiresystem.

CAUTION: Be sure the High Voltage Cover Panel is in place over the bottom edge of the control panel. DONOT OPERATE ANY OF THESE CONTROLS BEFORE READING THESE INSTRUCTIONS.

Shared Equipment Systems i5, i7+3, i9+3

or the T-Stat setting.

75

IntelliTouch Pool and Spa Control System User’s Guide

Single Body Systems Model i5S, i9+3SOperation same as i5, i9+3 except no valve controls.

Dual Body Dual Equipment System Model i10+3DOperation same as i9+3 except S and P buttons operate independent filter pumps and the Heater and Solarbuttons operate independent heating systems and no valve controls.

Expansion Centers Model i5x, i10xExpansion Centers provide additional valve and auxiliary circuits. They are designed to operate with basesystems: i9+3, i9+3S, i10+3D. Auxiliary Control Capability Buttons operate the same way as all other systemControl Capability Buttons.

IntelliTouch Pool and Spa Control System User’s Guide

76

Erasing Outdoor Control Panel Memory (Factory Default)The Outdoor Control Panel programmed memory can be erased and returned to the factory default settings.System information such as feature circuit configuration, operation and display is retained at the main LoadCenter Outdoor Control Panel and all Indoor Control Panels and MobileTouch controllers. If the memory iserased in the main Outdoor Control Panel (located in the Load Center or Power Center), system informationretained in the Indoor Control Panel or MobileTouch is automatically downloaded. This feature is important incase of accidental memory loss and to ease board replacement. If there are multiple Expansion Center, iS10Spa-Side remotes, or Indoor Control Panels, each one of the controllers will need to be manually enabled (seepage 54 for details). For instructions about erasing system memory from both the Outdoor Control Panel andIndoor Control Panel, refer to “Erasing the System Memory,” page 65.

To reset to the factory default settings:

1. On the Outdoor Control Panel, press the RESET button.

2. The three red System Control LEDs are lit for about ten seconds.

3. While the red LEDs are lit, press one of the following buttons

• For models i5, i7+3, i9+3, i5S, i9+3S, and i10+3D, press button 5.

• For models i5x, i10x, press button 7.

4. The System Control LEDs will switch off then on completing a normal system restart. Wait until the systemhas returned to “AUTO” and “POOL” modes before resuming operation.

Main Outdoor Control Panel (Located in the Load Center or Power Center)

LEDs (System Control)

Reset button5 button(i5, i7+3, i9+3, i5S,

i9+3S, i10+3D)

7 button(i5, i10x)

77

IntelliTouch Pool and Spa Control System User’s Guide

Troubleshooting

IntelliTouch Pool and Spa Control System User’s Guide

78

System Start-UpThe following information describes a basic system start-up procedure. Before switching on the power to theIntelliTouch Load Center or Power Center, first check the following:

Check ElectronicsCheck that the following plugs are seated correctly on the Personality board. For connector locations, refer tothe System Wiring Diagrams on page 88 and 89.

• Relay connectors - FLTR PUMP - AUX1 - AUX8

• Temperature sensors connectors - WATER, SOLAR, AIR

• Transformer wire harness - J2

• Heater control connector - ELEC HTR or screw terminals

System TestThe following describes how to test the Outdoor Control Panel to activate the heater, valves and pumps. Thistest assumes that all system equipment has been properly installed and connected to the Load Center andPower Center.

Testing Valve Actuators and Pumps:

Use the following steps to test the valve actuators (CVA24T - P/N 263045) for proper rotation. For OutdoorControl Panel System i5, i7+3, i9+3 (shared equipment).

To test the valve actuators and pump:

1. Power up the Load Center or Power Center.

2. Press the SYSTEM CONTROL button on the Outdoor Control Panel until the SERVICE light is on. .

3. Press the V (Valve) button to select POOL.

4. Press the F (Filter Pump) button to activate the filter pump. Water will be removed from the pool andreturned to the pool. The bypass valve will allow some water to fall from the spa back to the pool.

5. Set both valve actuators (CVA24T - P/N 263045) for suction and return. Use the toggle switch on therear of the CVA-24 to withdraw and return water from the pool.

Note: With the filter pump operating, if water is not being removed and returned to the pool, it may benecessary to check the plugs on the Personality board and the toggle switches on the valve actuators.

Testing the Auxiliary RelaysAffix the auxiliary relay labels to the appropriate buttons on the Outdoor Control Panel. If necessary, write thefunction on the control panel.

79

IntelliTouch Pool and Spa Control System User’s Guide

TroubleshootingThis section provides information to help you resolve any problems that may occur during installing or using theIntelliTouch system. If by following the recommended actions you are still unable to resolve the problems pleasecontact Technical Support, see page vi.

Frequently Asked Questions (FAQ)

What does the ‘+3’ on some of the systems mean?The first number of a “System Personality” indicates the number of high voltage (auxiliary) circuits availableincluding the filter pump. The ‘+3’ indicates the capability of operating additional equipment without using uphigh voltage circuits. Typically this refers to spillway functionality, valve control (see page 44), and featurecircuits (see page 56).

How Do I Setup/Configure/Program the 2-Speed Pump?Two-speed pumps operate using two relays and one or more circuits with the IntelliTouch system. The firstrelay turns the pump on or off. Assuming this is the filter pump and depending on the system personality, thiscircuit is controlled by the Pool, Spa, high temp, or low temp circuits or any other circuit that may be tied to thefilter pump (such as circuits with freeze protection, etc.). The second relay turns the pump from low speed tohigh speed. The default condition is low speed, but up to 10 circuits may be assigned to trigger the pump tohigh speed. Note: These 10 circuits do NOT turn the pump on.

To configure a two-speed pump relay, refer to “Setting Up a 2-Speed Pump,” page 50. For relay location andwiring, see page 88 and 89. The 2-Speed pump relay is plugged into the 2-SPD output on the Personalityboard. A circuits must be assigned to trigger from low to high speed, see page 50 for details.

Can I turn the Heater On and Change the temperature from the Spa?The heater may be turned on from the spa using one of two hardwired Spa-Side remote (iS4 or iS10) or bywireless remote controls (MobileTouch or QuickTouch). To learn more about these remotes and controllers,see page 12, 13, 14, and 16. Only the iS10 or wireless controllers can change the temperature from the spalocation.

How do I get Solar to switch on?The system must first be told that solar heat is installed. Go to the Solar equipment screen (Menu > Setup >Equipment > Solar) and press the YES button to tell the system solar is present. Note: Do not set solar as aheat pump. Then the heating method must be selected for each body of water. Many options are availablethrough the Heat screen. For instructions on how to select the heating method see page 49.

IntelliTouch Pool and Spa Control System User’s Guide

80

What are Color Swim and Color Set?Color Set: Allows any combination of up to 12 SAm, SAL, and/or FIBERworks lighting circuits to be presetto specific colors, such as red, white, and blue for the Fourth of July or red and green for Christmas.

Color Swim: Allows any combination of up to twelve SAm, SAL, and/or FIBERworks lighting circuits to bepreset to transition through colors in sequence, giving the appearance of the colors swimming across the water.The delay in sequencing each light can be adjusted to customize the display for your pool. For more informationsee “Setting Up Lighting Options,” page 45.

How do I get SAm/SAL/PG2000 to Synchronize?There are many ways to configure color changing lights to synchronize on the same colors. The first step is toassign all color changing light circuits a circuit function such as SAm, SAL, Photon Generator, or Color Wheel.Refer to “Assigning Circuit Functions,” page 43.

To manually synchronize the lights, use the Sync button on the Lights screen. Refer to page 10 for details abouthow to get the circuits to appear on the Lights Screen.

Light circuits may be controlled to switch on at a particular time and synchronize automatically. This may bedone by using the Smart Start functionality in the Program Screen. See page 16 for programming details.

Can I copy a standard configuration to all the systems I install?Yes you can but only if you maintain a standard system configuration on a system in your headquarters. AnIndoor Control Panel with a properly wired four conductor patch cable may be used to accomplish this.

CAUTION - Do NOT use the Service Panel. This accessory auto erases every time power is removed.It is for on-site work only.

1. Plug the Indoor Control Panel into a COM port on the Personality board of dedicated system at headquarters.

2. One of several things may happen at this point:

• The Indoor Control Panel may automatically download the system configuration if its own memory waserased.

• You may be prompted to update system personality, see page 65.

• You may be prompted to select Indoor or Outdoor memory. Always Select Outdoor or you will write overyour dedicated set up.

• You may have to force a download to the system.

3. This same controller may then be taken to the job-site to configure the system. Switch off the system power.Open Load Center or Power Center front door, remove the two retaining screws and fold down the OutdoorControl Panel.

4. Plug in the Indoor Control Panel to one of the COM ports from headquarters.

CAUTION - Be sure to check that the wiring is matching both ends before turning system power back on.Crossed wiring may permanently damage the system.

5. The procedure is identical to Step 2 above. Plug into the COM port on the Personality board in the LoadCenter or Power Center. Again, several different things may happen. Check all the relevant sections to avoidany problems.

81

IntelliTouch Pool and Spa Control System User’s Guide

Fixing mismatched system personalitiesThere are many possibilities that may cause an Indoor Control Panel or MobileTouch to have a modelpersonality (i9+3, i10+3D, etc.) that is different from the system personality. Such occasions include but are notlimited to:

1. Controller is added or replaced. Accessory and replacement controllers leave the factory identified as i9+3system personalities.

2. Controller memory is erased while unplugged from the system.

3. System personality was changed.

This is a minor problem and you may see a mismatched system personality screen. Press NEXT to update thecontroller to match the system personality. If you do not want to update the controller (most likely because youare service person using the controller for another purpose) then press IGNORE.

Indoor Control Panel and Outdoor Control Panel Connection ProblemSystem information relating to circuit configuration, operation and display is retained at the main Load CenterOutdoor Control Panel and all Indoor Control Panels and MobileTouch. System information is automaticallydownloads from programmed components to non-programmed components in case of accidental memory lossand to ease board replacement.

If for some reason the controller and outdoor control panel both have user settings that conflict with each otherthen this must be reconciled. Such occasions include but are not limited to:

1. The MobileTouch wireless controller made changes while the system power was down.

2. A service company made a special upgrade and installed it on an existing system.

If the Service Personnel screen appears, choose Indoor to use the controller settings and Outdoor to use theOutdoor Control Panel settings. Refer to page 65 for more information.

MobileTouch Temperature Readout Not Accurate (20 to 30 Degrees off)Problem: If the MobileTouch wireless controller LCD temperature readout displays an inaccurate reading, itmay be due to wireless signal interference. In this case, the air temperature readout can be correct.

Description: Temperature sensor cables are picking up signal interference.

Solution: To prevent signal transmission interference, ensure that the temperature sensor cables that connect thesensor to the Load Center are not routed near a Florescent lighting fixture (within six inches).

IntelliTouch Pool and Spa Control System User’s Guide

82

System Problem DiagnosisUse the following information to resolve system problems.

Problem: The system works in Service Mode, but Indoor Control Panel fails to operate.

motpmyS esuaCelbissoP noituloS

onsahlenaPlortnoCroodnIon,knalb,neercs(-rewop.gnikrowtonsnottub,sDEL

morfnurgniriwdaBlortnoCroodtuO

draobytilanosreP/lenaProretneCdaoLehtni

retneCrewoP

.snoitcennoclanimretwercsdna,gniriwkcehCesU/etaerC.detrohsronekorberaseriwonerusnE

lenaproodniehttcennocdnaelbactsettrohsaredrogniriwehttcerroCretnecrewopehtotyltcerid

esuacyamsihtsesacemosnI.stinullaneewteblacinhceTtcatnocsruccosihtfI.egamadtnenamrep

tsomsisihT.sBCPtnemecalperroftroppuSroodnIerapsagnisuybdenimretedylevitceffe

lacinhceTtcatnoC.lenaps'namecivreSrorellortnocBCPtnemecalperroftroppuS

seriw(yltcerrocnideriW)redrotcerrocniton

emosnI.stinullaneewtebredrogniriwehttcerroCsihtfI.egamadtnenamrepesuacyamsihtsesac

.sBCPtnemecalperroftroppushcettcatnocsrucco

roodnIevitcefeDlenaPlortnoC

erapsagnisuybdenimretedylevitceffetsomsisihTtcatnoC.lenaps'namecivresrorellortnocroodnI

BCPtnemecalperroftroppushcet

tub,pusthgiLlenaproodnIehT.yltcerrocetarepootsliaf

tnempiuqenruttonlliwtinusmetiemosnrutyamro,ffo/no

tonyamdnaffotontub,noroodninosnottubraensDEL

.lenap

gniriw/elbaCevitcefeD yfireV elbac .nekorberasnoitcennoconerusnidnaehtrednunekorbsieriwasesacemosnI

ruofehtfoseriwretnecowtehT.noitalusni)wolleYdnaneerG(tcepsuseraelbacrotcudnoc

ylevitceffetsomsisihTagnisuybdenimretedrellortnocroodnIeraps.lenaps'namecivresro

troppushcettcatnoCBCPtnemecalperrof

erapsagnisuybdenimretedylevitceffetsomsisihTtcatnoC.lenaps'namecivresrorellortnocroodnI

.BCPtnemecalperroftroppushcet01SI/slenaplortnocelpitlumhtiwsmetsysnI

troppuSlacinhceTllac-tluafenimreted

tonlenaPlortnoCroodnI.gnidnopser

.sserddatcerrocnI nahtsserddatnereffidasahlenaPlortnocroodnIXUAnehtTESERsserP.lenaPlortnocroodtuOeht

kcoldnalenaPlortnoCroodnIehtotoG.nottub1.SSERDDAno

83

IntelliTouch Pool and Spa Control System User’s Guide

Problem: Indoor and Outdoor Control Panels work, but iS4 fails to operate.

motpmyS7 esuaCelbissoP noituloS

etarepootsliafediSapS4Si.tnempiuqe

silortnoCediSapSniamybdelbasiD

.lenap

.lenaps'namecivresarolenaproodniehtgnisUAPS"sdaernoitcelesehterusnidna'UNEM'sserPEDISAPS"sdaertifI."DELBANEETOMEREDISehtedisebnottubehtsserp"DELBASIDETOMER

.noitcelesehtelggototnoitpo

noitarugifnoctcerrocnIhctiwsottiucricro

evitcefedrotnemngissa.gniriw

sserP.putes4SiyfireVENOHP&,FR,APS/DECNAVDA/PUTES/UNEM'ehterusnI's'4SiERUGIFNOC'tceleS'SETOMER

tiucricdetcepxeehtsahnoitseuqni4Sidesunuotdengissatonsidna,stnemngissa

.stiucric

4SievitcefeD 4SievitcefedecalpeR

emosylnoetarepootsliaf4Sisrehtotub,sehctiwsehtfo

.enifkrow

enonogniriwevitcefeDsdael4Sieromro

evobadebircsedsagniriwyfireV

noitarugifnoctcerrocnIhctiwsottiucricro

.tnemngissa

evobadebircsedsanoitarugifnocyfireV

4SievitcefeD ecalpeR.retemmhO-tloVahtiw4SiyfirevdnatseTsitinufi.troppuSlacinnhceTtcatnoC.4Sievitcefed

.dabllits

IntelliTouch Pool and Spa Control System User’s Guide

84

Problem: Indoor and Outdoor Control Panels work, but iS10 fails to operate.

motpmyS esuaCelbissoP noituloS

etarepootsliafediSapS01Si.tnempiuqe

silortnoCediSapSniamehtmorfdelbasiD

.lenaplortnoc

.lenaps'namecivresarolenaproodniehtgnisUAPS"sdaernoitcelesehterusnedna'UNEM'sserP

EDISAPS"sdaertifI."DELBANEETOMEREDISehtedisebnottubehtsserp"DELBASIDETOMER

.noitcelesehtelggototnoitpo

gniriWevitcefeD sserP.putes01SiyfireVENOHP&,FR,APS/DECNAVDA/PUTES/UNEM'

ehterusnE.s'01SiERUGIFNOC'tceleS'SETOMERtiucricdetcepxeehtsahnoitseuqni01Si

desunuotdengissatonsidna,stnemngissa.stiucric

noitarugifnoctcerrocnIhctiwsottiucricro

.tnemngissa

sserP.putes01SiyfireVENOHP&,FR,APS/DECNAVDA/PUTES/UNEM'

ehterusnE's'01SiERUGIFNOC'tceleS'SETOMERtiucricdetcepxeehtsahnoitseuqni01Si

desunuotdengissatonsidna,stnemngissa.stiucric

yltcerroctonsi01SIdelbane

.01Siehtelbaneyllaunamot55egapeeS

01SievitcefeD lacinnhceTtcatnoC.01SievitcefedecalpeR.troppuS

ylnoetarepootsliaf01Situb,sehctiwsehtfoemos

.enifkrowsrehto

enonogniriwevitcefeDsdael01Sieromro

dna,erarsisihT.evobadebircsedsagniriwyfireVsihtesuacnactahtdaeleriwylnoehtyllamron

.noitcennoCyfireV.eriw'neerG'ehtebdluow

noitarugifnoctcerrocnIhctiwsottiucricro

.tnemngissa

evobadebircsedsanoitarugifnocyfireV

01SievitcefeD .retemmhO-tloVahtiw01SiyfirevdnatseTlacinnhceTtcatnoC.01SievitcefedecalpeR

.dabllitssitinufi.troppuS

85

IntelliTouch Pool and Spa Control System User’s Guide

Problem: The Mobile Control Panel will not work, or will not work dependably.

motpmyS esuaCelbissoP noituloS

otsliafhcuoTeliboMehTrononruttonseodtI.etarepo

.puthgil

degrahctonsiyrettaBdeggulptonsitinuro

.ni

hcuoTeliboMehtotniregrahcerCAehtdehcattA.teltuollawaotnigulpdna

.hcuoTeliboMevitcefeD .troppuSlacinhceTtcatnoC.tinuecalpeR

otsliafhcuoTeliboMehT.etarepo

neebtonsahtinuehT.yltcerrocdelbane

.hcuoTeliboMehtelbaneyllaunamot13egapeeS

ehT-gniriWevitcefeDotdehcattareviecsnarT

roretneCdaoLehttonsiretneCrewoP

.deriwyltcerroc

nekorbrofkcehC.redrogniriwdna,gniriWyfireV.snoitcennocesooldnaseriw

tareviecsnarTevitcefeDroretneCdaoLeht

.retneCrewoP

erareviecsnarTehtnosDELowtehttahtyfireVREWOPdekramDELehT.detcepxesaevitca

KNILdekramDELehT.tilebsyawladluohssdnocesowtyreve.xorppahsalfdluohsYTIVITCAnehwsahcus(noitacinummocsierehtrevenehwro

.hcuoTeliboMehtnonottubasserpuoy

.hcuoTeliboMevitcefeD .troppuSlacinhceTtcatnoC.tinuecalpeR

otsliafhcuoTeliboMehT.ylbadnepedetarepo

ehT-gniriWevitcefeDotdehcattareviecsnarT

toretneCdaoLehttonsiretneCrewoP

.deriwyltcerroc

dluoweriwneergehtylno,llamrondna,erarsisihT.noitcennoCyfireV.melborpsihtesuac

yrevsahhcuoTeliboMehTegnargnitareporoop

mumitponahtsseLehtfonoitacol

detcennocreviecsnarTroretneCdaoLehtot

.retneCrewoP

detcurtsbosselawollaotreviecsnartehtetacoleR.reviecsnarTehtdnahcuoTeliboMehtneewtebhtap

onsiegnarhcuoTeliboMehThtiwneveteef03nahterom

otnoitarepothgisfoenilraelc.reviecsnarTeht

rotinuevitcefeDylekiL.reviecsnarTnekorbroevitcefedlanretniroannetna

.noitcennocannetna

.troppuSlacinhceTtcatnoC

IntelliTouch Pool and Spa Control System User’s Guide

86

Problem: The Quick Touch remote will not work, or will not work dependably.

motpmyS esuaCelbissoP noituloS

nothgiltonseodDELREWOPBCPrevieceReht

daoLhcuoTilletnIretneCrewoProretneC

.rewopevahtonseod

rewopehttahtdnadeilppusgniebsirewoperusnEreviecerehttuohtiwyltcerrocsetareporetnec

.dellatsni

roelbacevitcefeDdaoLehtotnoitcennoc

rewoProretneC.retneC

doognwonkgnisudraobehtfonoitcnufehtyfireV.gniriwllakcehC.teselbac

revieceRevitcefeD.draob

.troppuSlacinhceTtcatnoC

tonseodDELKNILMMOClamronnI.knilbrothgil

taknilblliwDELnoitareposdnoces2yrevetsael

roelbacevitcefeDdaoLehtotnoitcennoc

rewoProretneC.retneC

doognwonkgnisudraobehtfonoitcnufehtyfireV.teselbac

reviecerevitcefeD.draob

.draobreviecerecalpeR

erasehctiwssserddAderugifnocyltcerrocni

sserddaehttahtyfireVehtnosehctiwsdnarettimsnart

reviecerdlehdnahdnatcerroceradraob

.hctam

.deliafsahyrettabrettimsnarT

rettimsnarTecalpeRyrettab

revieceRrorettimsnarTevitcefeD

lacinhceTtcatnoC.troppuS

emostub,snoitcnuftinUro,krowtonodstiucric

tiucrictcerrocniehtetarepo

hcuoTkciuQsinoitarugifnoc

.tcerrocni

sserP.putesTQyfireVENOHP&,FR,APS/DECNAVDA/PUTES/UNEM''HCUOTKCIUQERUGIFNOC'tceleS'SETOMER

tiucricdetcepxeehtsahhcuoTkciuQehterusnEstiucricdesunuotdengissatonsidna,stnemngissa

sliafro,etarepootsliaftinUegnartaylbadnepedetarepo

esionlacirtceleeudnU sahcustnempiuqemorfyawareviecerehtetacoleR.srotomrewolb

snoitcurtsboynamooTrettimsnartehtneewteb

.reviecerdna

.revieceretacoleR

ootsitinurevieceR.dnuorgehtraen

ecnatsidehtezimixamotreviecerehtetacoleR.dnuorgehtdnaannetnareviecerehtneewteb

87

IntelliTouch Pool and Spa Control System User’s Guide

Problem: The Quick Touch remote will not work, or will not work dependably (Continued).

motpmyS esuaCelbissoP noituloS

fforononrutotsmeestinU/resuehttuohtiwstiucric

rettimsnart

siemohybraenAralimisagnitarepo

tinusseleriw

ehtrofedocsserddaetanretlanaatceleSnosehctiwsehtegnahc.e.I.reviecerdnarettimsnart

.gnittesgnihctamtub,etanretlanaotsdraobhtob

snrutylbadnepedtinUecnotub,NOtnempiuqe

seodtigninnursitnempiuqetnempiuqenrutylbadnepedton

yltaergsiegnarro,FFOsitnempiuqenehwdecuder

gninnur

esionlacirtceleeudnUybdecudorpgniebsi

foseceiperomroenoesolcnitnempiuqe

.reviecerehtotytimixorp

sahcustnempiuqemorfyawarevieceRehtetacoleRnoitacolanirevieceRehtetacoleRsrotomrewolb

resuehtaeraehtotsnoitcurtsborewefsedivorptaht.rettimsnartehtsetarepoylnommoc

yltaergsahtub,setarepotinUotderapmocegnardecuder

noitcnufroirp

siyrettaBrettimsnarTgniliaf

yrettabrettimsnarTecalpeR

IntelliTouch Pool and Spa Control System User’s Guide

88

Power Center System Wiring Diagram

89

IntelliTouch Pool and Spa Control System User’s Guide

Load Center System Wiring Diagram

POOL/SPA CONTROLLER5K42

IntelliTouch Pool and Spa Control System User’s Guide

90

Wiring IntelliTouch to a Salt Chlorine GeneratorBe sure to check the wire color and function of the salt chlorine generator before connecting it to theIntelliTouch COM port on the Personality board. See the wiring table below for the pin configuration.

Commonly used salt chlorine generator wiring is shown but you should still verify with the manufacturersdocumentation.

Failure to wire the salt chlorine generator properly can permanently damage the IntelliTouch system or chlorinegenerator.

Wiring Description

tropMOChcuoTilletnInoitcennocrolocgniriw

noipircseD rotareneGenirolhCtlaSsroloceriwdesuylnommoc

DER CDV51+ DER

WOLLEY ATAD+ KCALB

NEERG ATAD- WOLLEY

KCALB DNUORG NEERG

91

IntelliTouch Pool and Spa Control System User’s Guide

Glossary

IntelliTouch Pool and Spa Control System User’s Guide

92

GlossaryActuators: motorized accessory for turning valves and diverting water; model CVA24T.

Color Set: Allows a combination of up to 12 SAm, SAL, or Fiberworks lighting circuits to be preset to specificcolors.

Color Swim: Allows a combination of up to 12 SAm, SAL, or Fiberworks lighting circuits to be preset totransition through colors in sequence. This gives the appearance of colors dancing across your water.

Component ID: unique identifier that tells the system what each component is.

Controller: Indoor Control Panel or MobileTouch hand-held remote.

Expansion Kit: A kit that includes additional auxiliaries to an existing Personality Kit. Requires a Load Centeror Power Center for each Expansion Kit.

Feature Circuits: programmable circuits that may control relays, macros, and/or valve actuators.

Firmware: factory installed operating system software dedicated for use with the IntelliTouch system; each typeof control panel has its own firmware and release level.

Freeze Protection: turns on a circuit if the air temperature drops below 35° F.

High Voltage Compartment: Large lower right compartment of Load Center or Power Center for all highvoltage wiring including circuit breakers, relays, and GFCI.

House Address: signal that allows Each IntelliTouch system the ability to group all its attached componentsunder a single system identification; prevents the system from confusing its components from components on aneighbor’s system.

ICP: Indoor Control Panel

Indoor Control Panel: fourteen button remote controller with LCD (liquid crystal display) is wired to thePersonality board in the Power/Load Center.

iS4: Four function Spa-Side remote. Wall or deck mounted.

iS10: Ten function spa-side remote with temperature changing capability and display. Wall or deck mounted.

Load Center: Metal enclosure with power relays, transformer, and circuit breakers. The Load Center isInstalled prior to Personality Kit installation. Used for distributing power for controlling IntelliTouch Systems.Also known as the “sub-panel.”

Low Voltage Compartment: Top compartment of Load Center or Power Center for all low voltage wiring.

Low Voltage Raceway: Vertical space in the left side of Power/Load Center for low voltage cabling.

Macro: Feature circuit that allows you to combine circuits to activate together.

MobileTouch Controller: Wireless controller for the IntelliTouch Systems with all the functionality of theIndoor Control Panel.

Mud Box: Enclosure to provide mounting features for iS10 spa-side remote that is cast into gunite, concrete,or other spa wall/deck construction.

Outdoor Control Panel: Control panel with flexible hinge installed in upper portion of Load Center or PowerCenter to control IntelliTouch systems.

93

IntelliTouch Pool and Spa Control System User’s Guide

Glossary of TermsPersonality Board: The circuit board mounted on top of the Outdoor Control Panel motherboard. ThePersonality board defines the system capabilities.

Personality Kit: Set of parts to define the capability of a system. Can include, temperature sensors, actuators,and additional relays, actuators.

Power Center: Same as Load Center with the exception of the circuit breaker base.

Relay Circuits: The circuits that control the relays on the Personality Board. Connectors on top edge of thecircuit board.

Screw Terminal Connector: Removable connector that may attach to circuit board with multiple sockets(anywhere from 2 to 12) to receive wires from controllers and sensors; wires held by screw terminals; multiplewires of a small enough gauge (usually 22 AWG) may be coupled to a single socket of a terminal connector.

Transceiver: Circuit board with attached antenna that can send and receive radio frequency (wireless)transmissions.

Screw Terminal: Removable connector that may attach to circuit board with multiple sockets (anywhere from2 to 12) to receive wires from controllers and sensors; wires held by screw terminals; multiple wires of a smallenough gauge (usually 22 AWG) may be coupled to a single socket of a terminal connector.

System Personality: The capability of a system to operate a set of equipment, independent of the kind ofcontroller or other accessories; system personalities include “shared equipment” (i5, i7+3, i9+3), “dualequipment” (i10+3D), or “single body of water” (i5S, i9+3S).

Temperature Sensor: Specially designed probe for measuring temperature of the air or pool water; 10 kohmthermistor.

Terminal Connector: Removable connector that may attach to PCB with multiple sockets (anywhere from 2to 12) to receive wires from controllers and sensors; wires held by screw terminals; multiple wires of a smallenough gage (usually 22 AWG) may be coupled to a single socket of a terminal connector.

Two-Speed Pump Relay: Relay to toggle a two-speed pump from low-speed to high-speed operation; doesnot turn pump on or off.

Transceiver: Special printed circuit board that can send and receive radio frequency (wireless) transmissions.

QuickTouch QT4: provides switching of up to four remote control circuits from a wireless Hand-held Remote.

Valve Module: Accessory PCB (P/N 520285) to increase auxiliary actuator outputs from two to five.

IntelliTouch Pool and Spa Control System User’s Guide

94

NotesUse this page to take notes or write down important information while you configure the IntelliTouch system.For example, you can write down the names of circuits.

P/N 520102 - Rev E

top related