2012 - the international society for optics and...
Post on 28-Apr-2018
222 Views
Preview:
TRANSCRIPT
- - -
NanoScience + Engineering- CNTs/graphene
- optical trapping
- metamaterials
- plasmonics
- nanoengineering
Solar Energy + Technology- solar hydrogen
- thin films
- next generation reliability
- concentrators
Organic Photonics + Electronics- organic materials
- OLEDs
- OPVs
- photonic fibers
- OFETs
Optical Engineering + Applications- optical design, systems, and
engineering
- remote sensing and space optics
- x-ray technologies
- solid state lighting
- astronomical instrumentation
Advance Technical Programspie.org/opadvance
12–16 August 2012
2012
Conferences12–16 August 2012
Exhibition14–16 August 2012
LocationSan Diego Convention CenterSan Diego, California, USA
Attend SPIE Optics + Photonics, the largest international, multidisciplinary optical sciences and technology meeting in North America—and see the technologies of our future.
This program is current as of 25 April 2012. See the latest updates online.
Registration fees increase after 27 July 2012.
Secure your housing by 11 July 2012 to get best rates and selection.
12–16 August 2012
2012
Conferences and Courses: 12–16 August 2012 | Exhibition: 14–16 August 2012 San Diego Convention Center | San Diego, California, USA
Register Today · spie.org/opadvance
Advance Technical Program
Go online for the most current information- Up-to-date paper listings, session times,
participants, and locations
- New or updated special events
- New exhibiting companies and activities on the show floor
- New courses and workshops
- Hotel, travel, and parking information
- Onsite and business services
spie.org/opadvance · TEL:+13606763290 · help@spie.org 1
ContentsEventDailySchedule . . . . . . . . . . . . . . . . . . . . . . 2
PlenarySessions. . . . . . . . . . . . . . . . . . . . . . . 8-13
SpecialandNetworkingEvents . . . . . . . . . . .18-19
TechnicalEvents.......................15-17
EventsforStudents/EarlyCareer Professionals . . . . . . . . . . . . . . . . . . . . . . . . 21-23
Exhibition . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24-25
Technical ConferencesTechnicalConferenceIndex. . . . . . . . . . . . . . . 3-5
NanoScience+Engineering. . . . . . . . . . . . . 26-67
SolarEnergy+Technology. . . . . . . . . . . . . . 68-81
OrganicPhotonics+Electronics. . . . . . . . . 82-99
OpticalEngineering+Applications. . . . . . 100-189
CoursesCourseIndex. . . . . . . . . . . . . . . . . . . . . . . . . . . .6-7
CourseDailySchedule . . . . . . . . . . . . . . . .191-195
CourseDescriptions . . . . . . . . . . . . . . . . . 196-234
ProceedingsofSPIE. . . . . . . . . . . . . . . . 236-237
SPIE would like to express its deepest appreciation to the symposium chairs, conference chairs, program committees, session chairs, and
authors who have so generously given their time and advice to make this symposium possible.
The symposium, like our other conferences and activities, would not be possible without the dedicated contribution of our participants and members. This program is based on commitments received up to the time of publication and is subject to change without notice.
SanDiegoConventionCenter,SanDiego,California,USA
NanoScience+Engineering830+ papers ·metamaterials,plasmonics,CNTs,graphene,thinfilms,spintronics,nanoengineering
Solar Energy+Technology200+ papers·thinfilms,concentrators,reliability,next-generationcelltechnologies,materialsprocessing
Organic Photonics +Electronics300+ papers ·OLEDs,OTFTs,OPVs,liquidcrystals,organicmaterials,large-scalefabrication,organicsemiconductors
Optical Engineering+Applications1500+ papers·opticalengineering,lensdesign,metrology,x-ray,SSL,photonicdevices,atmosphericandspaceoptics
12–16August2012
Register for SPIE Optics+Photonics online at spie.org/opadvance
2 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Event Daily Schedule Sunday Monday Tuesday Wednesday Thursday
EXHIBITION, p.24-25 10:00amto5:00pm 10:00amto5:00pm 10:00amto2:00pm
Student Chapter Exhibits,p.2110:00amto4:00pm10:00amto4:00pm10:00amto2:00pm
Take a course, attend a workshop, discover solutions with SPIE professional development.
See SPIE Course descriptions on pages 196-234.
Plenary Presentation: The Exciting Science of Light with Metamaterials (Shalaev),p.8
Plenary Presentation: Future of Optics and Photonics (Saleh), p.8
Panel Discussion: Vision 2025(Lakhtakia, Todd), 4:45to5:45pm,p.15
Optics Outreach Olympics, 7:30to11:30pm,p.21
Guest Hospitality Suite,8:30to10:00am,p.19
Plenary Presentation: The Light and Sound Fantastic: Radiation Pressure at the Nanoscale (Painter),p.9
Plenary Presentation: Organics and Nanostructures for Nonlinear Optics (Peyghambarian),p.9
Plenary Presentation: From Nanophotonics, to Metaphotonics, to Dynamic Photonics: Controlling Light Propagation and Light-Matter Interactions for Emerging Technologies(Prasad),p.9
Plenary Presentation: Global Activities in Novel-Nano Magnetic Materials for Magnetic, Optoelectronics Applications (Mah),p.10
Plenary Presentation: Understanding the Generation of Charge Carriers in Organic Photovoltaic Devices (Rumbles),p.10
Plenary Presentation: Light Management in Single-Junction III-V Solar Cells(Kayes),p.10
Plenary Presentation: Carbon Nanotubes for Photovoltaics (Heben),p.11
Plenary Presentation: Advanced Solar Cell Technologies for Concentrating Photovoltaics Systems (Sabnis),p.11
Plenary Presentation: High-Rate Processing and Advanced Emitter Structures for CIGS PV Module Manufacturing (Stanbery),p.11
Plenary Presentation: On the Way to Accelerated Life Testing(Köhl), p.11
The 2012 Zoom Lens Design Problem, 11:40amto12:10pm,p.15
Lunch with the Experts - A Student Networking Event, 12:30to1:30pm,p.21
Women in Optics Presentation and Reception,5:00to6:30pm,p.18
Poster Session: Solar Energy and Optical Engineering + Applications, 5:30to7:30pm,p.15
All-Conference Welcome Reception, 7:00to8:30pm,p.18
Illumination Technical Event (Jacobsen), 8:00to10:00pm,p.15
Guest Hospitality Suite,8:30to10:00am,p.19
Panel Discussion: Commercialization of Emerging Photovoltaic Technologies (Tsakalakos), 10:30amto12:00pm,p.15
Plenary Presentation: Development of Charge Generation Layers for Multiphoton Emission OLED (Kido),p.12
Plenary Presentation: LED Development with Nanostructures and Nanophotonics(Yang),p.12
Plenary Presentation: A New Job for Telescopes: Making Solar Electricity (Angel), p.12
Plenary Presentation: From Titanic to the Tiny: Three Decades of Underwater Optical Imaging(Jaffe), p.12
SPIE Fellows Luncheon, 12:00to1:30pm,p.18
Student Chapter Exhibit Mixer, 4:00to5:00pm,p.18
SPIE Members Reception, 7:00to8:30pm,p.18
Lens Design Technical Event: Let’s Give ‘Em Something to Talk About! (Pfisterer),8:00to10:00pm,p.15
An Optical Believe It or Not: Key Lessons Learned Technical Event (Kahan), 8:00to10:00pm,p.16
Optomechanical/Instrument Technical Group Event (Hatheway), 8:00to10:00pm,p.16
Penetrating Radiation Technical Event (Baciak),8:00to10:00pm,p.16
Workshop on X-Ray Mirrors (Khounsary) 8:15to9:15pm,p.16
Panel Discussion:Life in the Cosmos (Hoover, Wickramasinghe),8:00to10:00pm,p.16
Guest Hospitality Suite,8:30to10:00am,p.19
SPIE Senior Members Breakfast,8:00to9:00am,p.19
Plenary Presentation: Liquid Crystal Lasers: From Concepts to Practical Realisation(Coles), p.13
Plenary Presentation: The Role of Solution Processing in the Future of OLED TVs(O’Regan), p.13
Plenary Presentation: Plastic Solar Cells: Breaking the 10% Commercialization Barrier(Yang), p.13
Speed Networking Social, 5:00to6:30pm,p.18
Poster Session: Nanotechnology, Organic Photonics + Electronics, and Digital Image Processing, 5:30to7:30pm,p.17
SPIE 2012 Annual Awards Banquet, 7:30to10:00pm,p.19
Tribute to William Wolfe(Turner), 8:00amto5:00pm,p.17
Panel Discussion: Polymers vs. Glass... and Other Questions Concerning Polymer Optics and Molded Glass (Krevor),4:30to5:30pm,p.17
Guest Hospitality Suite,8:30to10:00am,p.19
JOB FAIR,p.2110:00amto5:00pm10:00amto5:00pm
spie.org/opadvance · TEL:+13606763290 · help@spie.org 3
Symposium Chairs:David L. Andrews,Univ.ofEastAngliaNorwich(UnitedKingdom)
James G. Grote,AirForceResearchLab.(USA)
Symposium Cochairs:Satoshi Kawata,OsakaUniv.(Japan)
Manijeh Razeghi,NorthwesternUniv.(USA)
Technical Conference Index
NanoScience8455 Metamaterials: Fundamentals and Applications V
(Boardman/Engheta/Noginov/Zheludev) . . . . . . . . . . . . . . . .27
8456 Nanophotonic Materials IX(Cabrini/Mokari). . . . . . . . . . . .31
8457 Plasmonics: Metallic Nanostructures and Their Optical Properties X(Stockman) . . . . . . . . . . . . . . . . . . . . . . . . . . . .33
8458 Optical Trapping and Optical Micromanipulation IX(Dholakia/Spalding). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .39
8459 Physical Chemistry of Interfaces and Nanomaterials XI (Clark/Silva). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .44
8460 Biosensing and Nanomedicine II(Mohseni/Agahi/Razeghi) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .46
8461 Spintronics V (Drouhin/Wegrowe/Razeghi) . . . . . . . . . . . . . .49
8462 Carbon Nanotubes, Graphene, and Associated Devices V(Pribat/Lee/Razeghi) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .53
Symposium Chair:
Martha Symko-Davies,NationalRenewableEnergyLab.(USA)
NanoEngineering8463 Nanoengineering: Fabrication, Properties, Optics, and
Devices IX(Dobisz/Eldada) . . . . . . . . . . . . . . . . . . . . . . . . . . .55
8464 Nanobiosystems: Processing, Characterization, and Applications V(Kobayashi/Ouchen/Rau) . . . . . . . . . . . . . . .58
8465 Nanostructured Thin Films V(Mackay/Jen/Martín-Palma).61
8466 Instrumentation, Metrology, and Standards for Nanomanufacturing, Optics, and Semiconductors VI (Postek) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .64
8467 Nanoepitaxy: Materials and Devices IV(Kobayashi/Talin/Islam) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .66
8469 Solar Hydrogen and Nanotechnology VII(Tachibana) . . . . . . . . . . . . . . . . .71
8471 Next Generation (Nano) Photonic and Cell Technologies for Solar Energy Conversion III(Tsakalakos) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .75
8519 Nanophotonics and Macrophotonics for Space Environments VI(Taylor/Cardimona) . . . . . . . . . . . . . . . . .185
NanoScience+ EngineeringSPIEOptics+Photonics
Solar Energy+TechnologySPIEOptics+Photonics
8468 High and Low Concentrator Systems for Solar Electric Applications VII(VanSant/Plesniak) . . . . . . .69
8469 Solar Hydrogen and Nanotechnology VII(Vayssieres). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 71
8470 Thin Film Solar Technology IV(Eldada) . . . . . . . . . . . 73
8471 Next Generation (Nano) Photonic and Cell Technologies for Solar Energy Conversion III(Tsakalakos) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 75
8472 Reliability of Photovoltaic Cells, Modules, Components, and Systems V(Dhere). . . . . . . . . . . . .77
NEW 8473 Laser Material Processing for Solar Energy Devices
(Reutzel) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .80
8477 Organic Photovoltaics XIII (Kafafi) . . . . . . . . . . . . . . .92
8485 Nonimaging Optics: Efficient Design for Illumination and Solar Concentration IX(Winston/Gordon) . . . .111
4 spie.org/opadvance · TEL:+13606763290 · help@spie.org
8474 Optical Processes in Organic Materials and Nanostructures(Jakubiak) . . . . . . . . . . . . . . . . . . . . . . . . . . .83
8475 Liquid Crystals XVI(Khoo) . . . . . . . . . . . . . . . . . . . . . . . . . . .86
8476 Organic Light Emitting Materials and Devices XVI (So). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .88
8477 Organic Photovoltaics XIII (Kafafi) . . . . . . . . . . . . . . .92
8478 Organic Field-Effect Transistors XI(Bao/McCulloch) . . . .96
8479 Organic Semiconductors in Sensors and Bioelectronics V(Shinar). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .98
Symposium Chair:
Zakya H. Kafafi, NationalScienceFoundation(USA)
Technical Conference Index
Organic Photonics + ElectronicsSPIEOptics+Photonics
Special Program 8480 The Nature of Light: Light in Nature IV (Liang). . . . . . . . . 103
8481 Optics Education and Outreach II (Gregory) . . . . . . . . . . . 104
NEW8482 Photonic Innovations and Solutions for Complex
Environments and Systems (PISCES)(Lakhtakia/Todd) .106
8483 Tribute to William Wolfe (Turner) . . . . . . . . . . . . . . . . . . . . . 107
Illumination Engineering Program Chair:Ian T. Ferguson,TheUniv.ofNorthCarolinaatCharlotte(USA)
8484 Twelfth International Conference on Solid State Lighting and Fourth International Conference on White LEDs and Solid State Lighting(Kane/Wetzel/Huang/Ferguson)............................. 108
8485 Nonimaging Optics: Efficient Design for Illumination and Solar Concentration IX(Winston/Gordon) . . . . 111
Optical Design and Systems EngineeringProgram Chairs: José Sasián, CollegeofOpticalSciences,TheUniv.ofArizona(USA)andR. John Koshel, PhotonEngineeringLLC(USA)andCollegeofOpticalSciences,TheUniv.ofArizona(USA)
8486 Current Developments in Lens Design and Optical Engineering XIII(Johnson/Mahajan/Thibault) . . . . . . . . . 113
8487 Novel Optical Systems Design and Optimization XV(Gregory/Davis). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 116
NEW 8488 Zoom Lenses IV(Betensky/Yamanashi) . . . . . . . . . . . . . . . 119
8489 Polymer Optics and Molded Glass Optics: Design, Fabrication, and Materials III(Krevor/Beich/Schaub/Bäumer) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 121
8490 Laser Beam Shaping XIII(Forbes/Lizotte) . . . . . . . . . . . . . 123
8491 Optical System Alignment, Tolerancing, and Verification VI(Sasián/Youngworth). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 124
8492 Optical System Contamination: Effects, Measurements, and Control 2012(Straka/Carosso/Egges) . . . . . . . . . . . 126
8485 Nonimaging Optics: Efficient Design for Illumination and Solar Concentration IX(Winston/Gordon) . . . . 111
Advanced Metrology Program Chair: Katherine Creath,Optineering(USA)andCollegeofOpticalSciences,TheUniv.ofArizona(USA)
8493 Interferometry XVI: Techniques and Analysis (Schmit/Creath/Towers). . . . . . . . . . . . . . . . . . . . . . . . . . . . . 127
8494 Interferometry XVI: Applications(Furlong/Gorecki/Novak)130
8495 Reflection, Scattering, and Diffraction from Surfaces III(Hanssen). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 132
8466 Instrumentation, Metrology, and Standards for Nanomanufacturing, Optics, and Semiconductors VI(Postek) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .64
8501 Advances in Metrology for X-Ray and EUV Optics IV (Assoufid/Takacs/Asundi). . . . . . . . . . . . . . . . . . . . . . . . . . . . 146
Optical Engineering+ ApplicationsSPIEOptics+Photonics
spie.org/opadvance · TEL:+13606763290 · help@spie.org 5
Technical Conference Index
Watch for this icon next to conferences and courses discussing innovative ways to help our planet.
GREEN PHOTONICS
SPIE Optics + Photonics is a leading conference on green photonics technologies such as energy, sustainability, conservation, and environmental monitoring.
Photonic Devices and Applications8496 Terahertz Emitters, Receivers, and Applications III
(Razeghi/Baranov/Everitt/Zavada/Manzur) . . . . . . . . . . . . . . 134
8497 Photonic Fiber and Crystal Devices: Advances in Materials and Innovations in Device Applications VI(Yin/Guo). . . . 136
8484 Twelfth International Conference on Solid State Lighting and Fourth International Conference on White LEDs and Solid State Lighting(Kane/Wetzel/Huang/Ferguson). . . . 108
8512 Infrared Sensors, Devices, and Applications II(LeVan/Sood/Wijewarnasuriya/D’Souza) . . . . . . . . . . . . . . . . . . . . . 172
Image and Signal Processing Program Chair:Khan M. Iftekharuddin,OldDominionUniv.(USA)
8498 Optics and Photonics for Information Processing VI (Awwal/Iftekharuddin) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 139
8499 Applications of Digital Image Processing XXXV(Tescher)141
8500 Image Reconstruction from Incomplete Data VII(Bones/Fiddy/Millane) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 144
X-Ray, Gamma-Ray, and Particle Technologies Program Chair:Carolyn A. MacDonald,Univ.atAlbany(USA)
8501 Advances in Metrology for X-Ray and EUV Optics IV(Assoufid/Takacs/Asundi). . . . . . . . . . . . . . . . . . . . . . . . . . . 146
8502 Advances in X-Ray/EUV Optics and Components VII(Goto/Morawe/Khounsary) . . . . . . . . . . . . . . . . . . . . . . . . . . 148
8503 Adaptive X-Ray Optics II(Khounsary/O’Dell/Bifano). . . . . 150
NEW8504 X-Ray Free-Electron Lasers: Beam Diagnostics, Beamline
Instrumentation, and Applications(Hau-Riege/Moeller/Yabashi) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 152
NEW8505 Target Diagnostics Physics and Engineering for Inertial
Confinement Fusion(Bell/Grim). . . . . . . . . . . . . . . . . . . . . 154
8506 Developments in X-Ray Tomography VIII(Stock). . . . . . 156
8507 Hard X-Ray, Gamma-Ray, and Neutron Detector Physics XIV (James/Burger/Franks/Fiederle). . . . . . . . . . . . . . . . . . . 159
8508 Medical Applications of Radiation Detectors II(Barber/Roehrig) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 162
8509 Penetrating Radiation Systems and Applications XIII (Grim/Barber). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 164
Remote Sensing Program Chair: Allen H.-L. Huang,Univ.ofWisconsin-Madison(USA)
8510 Earth Observing Systems XVII(Butler/Xiong/Gu). . . . . . . 166
8511 Infrared Remote Sensing and Instrumentation XX(Strojnik/PaezPadilla) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 169
8512 Infrared Sensors, Devices, and Applications II(LeVan/Sood/Wijewarnasuriya/D’Souza). . . . . . . . . . . . . . . 172
8513 Remote Sensing and Modeling of Ecosystems for Sustainability IX (Gao/Jackson). . . . . . . . . . . . . . . . . 174
8514 Satellite Data Compression, Communications, and Processing VIII(Huang/Plaza/Thiebaut). . . . . . . . . . . . . . . 176
8515 Imaging Spectrometry XVII(Shen/Lewis) . . . . . . . . . . . . . 178
8516 Remote Sensing System Engineering IV (Ardanuy/Puschell) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 180
Atmospheric and Space Optical Systems Program Chairs: Stephen M. Hammel,SpaceandNavalWarfareSystemsCommand(USA)andAlexander M. J. van Eijk, TNODefence,SecurityandSafety(Netherlands)
8517 Laser Communication and Propagation through the Atmosphere and Oceans(vanEijk/Davis/Hammel/Majumdar). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 181
8518 Quantum Communications and Quantum Imaging X (Meyers/Shih/Deacon) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 183
8519 Nanophotonics and Macrophotonics for Space Environments VI(Taylor/Cardimona). . . . . . . . . . . . . . . . . . 185
8520 Unconventional Imaging and Wavefront Sensing VIII (Dolne/Karr/Gamiz). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 187
8521 Instruments, Methods, and Missions for Astrobiology XV (Hoover/Levin/Rozanov/Davies) . . . . . . . . . . . . . . . . . . . . . . 189
6 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Course Index
Advanced MetrologyMon SC1003Optical Scatter Metrology for Industry(Stover)
1:30to5:30pm,$360/$415 . . . . . . . . . . . . . . . . . . . . . . .p.196
Tue SC213 Introduction to Interferometric Optical Testing(Wyant)8:30amto12:30pm,$330/$385 . . . . . . . . . . . .p.197
Tue SC017 Principles of Fourier Optics and Diffraction(Gaskill)8:30amto5:30pm,$630/$745. . . . . . . . . . . . .p.198
Tue SC492 Predicting, Modeling, and Interpreting Light Scattered by Surfaces(Germer)1:30to5:30pm,$300/$355 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .p.197
Wed NEW SC1080Modeling and Simulation with Computational Fourier Optics(Voelz)8:30amto5:30pm,$525/$640 p.198
Wed SC211 Practical Interferometry and Fringe Analysis(Creath)8:30amto5:30pm,$525/$640. . . . . . . . . . . . .p.196
Atmospheric and Space Optical SystemsSun NEW SC1071Understanding Diffractive Optics
(Soskind)1:30to5:30pm,$335/$390 . . . . . . . . . . . . . . .p.201
Mon NEW SC468Image Enhancement, Deblurring and Super-Resolution(Rabbani)8:30amto5:30pm,$525/$640 .p.199
Mon NEW SC967High Dynamic Range Imaging: Sensors and Architectures(Darmont)1:30to5:30pm,$345/$400. .p.200
Tue SC916 Digital Camera and Sensor Evaluation Using Photon Transfer(Janesick)8:30amto5:30pm,$575/$690. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .p.200
Tue SC1043Shaping Light, with applications in Advanced Microscopy and Optical Trapping(Dholakia, Spalding)1:30to5:30pm,$300/$355. . . . . . . . . . . . . . . . . . . . . . .p.202
Wed NEW SC1080Modeling and Simulation with Computational Fourier Optics(Voelz)8:30amto5:30pm,$525/$640 . . . . . . . . . . . . . . . . . . . . . . . . . . . . .p.201
Wed SC915 Radiometry Revealed(Shaw)8:30amto12:30pm,$300/$355 . . . . . . . . . . . . . . . . . . . . . . . . . . . .p.199
Wed SC567 Introduction to Optical Remote Sensing Systems(Shaw)1:30to5:30pm,$300/$355. . . . . . . . . . . . . . . . .p.199
Detectors and Imaging DevicesMon SC504 Introduction to CCD and CMOS Imaging
Sensors and Applications(Janesick)8:30amto5:30pm,$665/$780. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .p.203
Mon NEW SC967High Dynamic Range Imaging: Sensors and Architectures(Darmont)1:30to5:30pm,$345/$400. .p.202
Tue SC916 Digital Camera and Sensor Evaluation Using Photon Transfer(Janesick)8:30amto5:30pm,$575/$690. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .p.203
Wed SC194 Multispectral and Hyperspectral Image Sensors(Lomheim)8:30amto12:30pm,$380/$435 . . . . . . . . . .p.204
Wed SC915 Radiometry Revealed(Shaw)8:30amto12:30pm,$300/$355 . . . . . . . . . . . . . . . . . . . . . . . . . . . .p.205
Wed SC567 Introduction to Optical Remote Sensing Systems(Shaw)1:30to5:30pm,$300/$355 . . . . . . . . .p.204
Illumination EngineeringSun NEW SC1071Understanding Diffractive Optics
(Soskind)1:30to5:30pm,$335/$390 . . . . . . . . . . . . . . .p.206
Mon SC388 Non-Imaging Optics(Winston)1:30to5:30pm,$300/$355 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .p.205
Tue SC011 Design of Efficient Illumination Systems(Cassarly)8:30amto12:30pm,$300/$355 . . . . . . . . . .p.205
Wed SC915 Radiometry Revealed(Shaw)8:30amto12:30pm,$300/$355 . . . . . . . . . . . . . . . . . . . . . . . . . . . .p.206
Image and Signal ProcessingSun NEW SC1071Understanding Diffractive Optics
(Soskind)1:30to5:30pm,$335/$390 . . . . . . . . . . . . . . .p.208
Mon NEW SC468Image Enhancement, Deblurring and Super-Resolution(Rabbani)8:30amto5:30pm,$525/$640 .p.207
Mon NEW SC967High Dynamic Range Imaging: Sensors and Architectures(Darmont)1:30to5:30pm,$345/$400. .p.207
Tue SC916 Digital Camera and Sensor Evaluation Using Photon Transfer(Janesick)8:30amto5:30pm,$575/$690. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .p.208
Tue SC017 Principles of Fourier Optics and Diffraction(Gaskill)8:30amto5:30pm,$630/$745. . . . . . . . . . . . .p.209
Wed NEW SC1080Modeling and Simulation with Computational Fourier Optics(Voelz)8:30amto5:30pm,$525/$640 . . . . . . . . . . . . . . . . . . . . . . . . . . . . .p.208
NanoEngineeringMon SC1003Optical Scatter Metrology for Industry
(Stover)1:30to5:30pm,$360/$415. . . . . . . . . . . . . . . . .p.210
Mon NEW SC1082Nanophotonics and Metaphotonics(Prasad)2:00to6:00pm,$300/$355. . . . . . . . . . . . . . . .p.209
NanoscienceMon NEW SC1082Nanophotonics and Metaphotonics
(Prasad)2:00to6:00pm,$300/$355. . . . . . . . . . . . . . . . p.211
Tue SC1043Shaping Light, with applications in Advanced Microscopy and Optical Trapping(Dholakia, Spalding)1:30to5:30pm,$300/$355. . . . . . . . . . . . . . . . . . . . . . .p.210
Thurs SC727 Nanoplasmonics(Stockman)8:30amto5:30pm,$525/$640. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . p.211
Optical Design and Systems EngineeringSun SC690 Optical System Design: Layout Principles and
Practice(Greivenkamp)8:30amto5:30pm,$635/$750 p.212
Sun NEW SC1071Understanding Diffractive Optics(Soskind)1:30to5:30pm,$335/$390 . . . . . . . . . . . . . . . p.215
Mon-TuesSC835Infrared Systems - Technology & Design(Daniels)8:30amto5:30pm,$1145/$1400 . . . . . . . . . . . p.214
Wed SC912 Intermediate Lens Design(Bentley)8:30amto5:30pm,$610/$725. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . p.213
Mon-TuesSC010Introduction to Optical Alignment Techniques(Ruda)8:30amto5:30pm,$1000/$1255 . . . . . . . . . . . .p.218
Mon SC221 Optomechanics and Tolerancing of Instruments(Hatheway)8:30amto5:30pm,$525/$640 . . . . . . . . . . p.218
Mon SC321 Thin Film Optical Coatings(Macleod)8:30amto5:30pm,$525/$640. . . . . . . . . . . . . . . . . . . . p.214
Mon SC388 Non-Imaging Optics(Winston)1:30to5:30pm,$300/$355 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . p.215
Mon SC1003Optical Scatter Metrology for Industry(Stover)1:30to5:30pm,$360/$415. . . . . . . . . . . . . . . . . p.217
Tue SC156 Basic Optics for Engineers(Boreman)8:30amto5:30pm,$565/$680 . . . . . . . . . . . . . . . . . . . . p.213
Tue SC947 Cost-Conscious Tolerancing of Optical Systems(Youngworth, Contreras)8:30amto5:30pm,$525/$640p.218
Tue SC017 Principles of Fourier Optics and Diffraction(Gaskill)8:30amto5:30pm,$630/$745. . . . . . . . . . . . .p.216
Tue WS609 Basic Optics for Non-Optics Personnel(Harding)1:30to4:00pm,$100/$150 . . . . . . . . . . . . . . .p.220
spie.org/opadvance · TEL:+13606763290 · help@spie.org 7
Course Index
Solar Energy + TechnologyMon SC321 Thin Film Optical Coatings(Macleod)
8:30amto5:30pm,$525/$640. . . . . . . . . . . . . . . . . . . .p.229
Mon SC388 Non-Imaging Optics(Winston)1:30to5:30pm,$300/$355 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .p.228
Mon SC1003Optical Scatter Metrology for Industry(Stover)1:30to5:30pm,$360/$415. . . . . . . . . . . . . . . . .p.228
Tue SC910 Design and Reliability of Photovoltaic Modules(Dhere, Kempe)8:30amto12:30pm,$300/$355. . . . . .p.228
Tue SC492 Predicting, Modeling, and Interpreting Light Scattered by Surfaces(Germer)1:30to5:30pm,$300/$355 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .p.229
Wed SC915 Radiometry Revealed(Shaw)8:30amto12:30pm,$300/$355 . . . . . . . . . . . . . . . . . . . . . . . . . . . .p.230
X-Ray, Gamma-Ray, and Particle TechnologiesMon SC1003Optical Scatter Metrology for Industry
(Stover)1:30to5:30pm,$360/$415. . . . . . . . . . . . . . . . .p.230
Tue SC213 Introduction to Interferometric Optical Testing(Wyant)8:30amto12:30pm,$330/$385 . . . . . . . . . . . .p.232
Tue SC492 Predicting, Modeling, and Interpreting Light Scattered by Surfaces(Germer)1:30to5:30pm,$300/$355 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .p.231
Wed SC211 Practical Interferometry and Fringe Analysis(Creath)8:30amto5:30pm,$525/$640. . . . . . . . . . . . .p.231
Business + Professional DevelopmentSun NEW WS1058Critical Skills for Compelling Research
Proposals(Diehl)1:30to5:30pm,$75/$125 . . . . . . . . .p.232
Mon WS897 Effective Technical Presentations(Doumont)8:30amto12:30pm,$75/$125 . . . . . . . . . . . . . . . . . . . .p.233
Mon WS908 Effective Scientific Papers(Doumont)1:30to5:30pm,$75/$125. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .p.233
Tue NEW WS1059Resumes to Interviews: Strategies for a Successful Job Search(Lawson, Krinsky)8:30amto12:30pm,$75/$125. . . . . . . . . . . . . . . . . . . . . . . . . . . . . .p.233
Tue WS609 Basic Optics for Non-Optics Personnel(Harding)1:30to4:00pm,$100/$150 . . . . . . . . . . . . . . .p.232
Workshops for Optics EducatorsMon NEW WS1081KHET in the Classroom - Teaching Optics
Principles using The Laser Game: KHET 2.0(Larson)8:30amto12:30pm,$50/$75 . . . . . . . . . . . . . . . . . . . . .p.234
Wed WS961 Optics Magic - Easy Demonstrations from the PHOTON Projects(Donnelly, Magnani)1:30to4:30pm,$10/$20 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .p.234
LegendforEducationProducts:
Price=SPIEMember/Non-MemberSC000=CourseNumberWS000=WorkshopNumber
See Course descriptions on pages 196-234.
Tue SC492 Predicting, Modeling, and Interpreting Light Scattered by Surfaces(Germer)1:30to5:30pm,$300/$355 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . p.217
Tue SC1043Shaping Light, with applications in Advanced Microscopy and Optical Trapping(Dholakia, Spalding)1:30to5:30pm,$300/$355. . . . . . . . . . . . . . . . . . . . . . .p.219
Wed NEW SC1080Modeling and Simulation with Computational Fourier Optics(Voelz)8:30amto5:30pm,$525/$640. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .p.216
Wed SC003 Practical Optical System Design(Youngworth)8:30amto5:30pm,$605/$725. . . . . . . . . . . . . . . . . . . . p.212
Wed SC915 Radiometry Revealed(Shaw)8:30amto12:30pm,$300/$355 . . . . . . . . . . . . . . . . . . . . . . . . . . . . p.215
Wed SC567 Introduction to Optical Remote Sensing Systems(Shaw)1:30to5:30pm,$300/$355 . . . . . . . . .p.219
Optomechanics and Optical ManufacturingSun-MonSC014Introduction to Optomechanical Design
(Vukobratovich)8:30amto5:30pm,$1000/$1255 . . . . .p.220
Mon-TuesSC010Introduction to Optical Alignment Techniques(Ruda)8:30amto5:30pm,$1000/$1255 . . . . . . . . . . . .p.220
Mon SC221 Optomechanics and Tolerancing of Instruments(Hatheway)8:30amto5:30pm,$525/$640 . . . . . . . . . .p.222
Mon SC015 Structural Adhesives for Optical Bonding(Daly)8:30amto12:30pm,$300/$355 . . . . . . . . . . . . . .p.221
Mon SC321 Thin Film Optical Coatings(Macleod)8:30amto5:30pm,$525/$640. . . . . . . . . . . . . . . . . . . . . . . . . . .p.222
Tue SC218 Advanced Composite Materials for Optomechanical Systems(Zweben)8:30amto5:30pm,$525/$640. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .p.221
Tue SC947 Cost-Conscious Tolerancing of Optical Systems(Youngworth, Contreras)8:30amto5:30pm,$525/$640p.221
Tue SC213 Introduction to Interferometric Optical Testing(Wyant)8:30amto12:30pm,$330/$385 . . . . . . . . . . . .p.223
Wed SC211 Practical Interferometry and Fringe Analysis(Creath)8:30amto5:30pm,$525/$640. . . . . . . . . . . . .p.223
Remote SensingMon NEW SC468Image Enhancement, Deblurring and Super-
Resolution(Rabbani)8:30amto5:30pm,$525/$640 .p.224
Mon-TuesSC835Infrared Systems - Technology & Design(Daniels)8:30amto5:30pm,$1145/$1400 . . . . . . . . . . .p.226
Mon SC504 Introduction to CCD and CMOS Imaging Sensors and Applications(Janesick)8:30amto5:30pm,$665/$780. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .p.225
Mon NEW SC967High Dynamic Range Imaging: Sensors and Architectures(Darmont)1:30to5:30pm,$345/$400. .p.224
Tue SC156 Basic Optics for Engineers(Boreman)8:30amto5:30pm,$565/$680 . . . . . . . . . . . . . . . . . . . . p.227
Tue SC916 Digital Camera and Sensor Evaluation Using Photon Transfer(Janesick)8:30amto5:30pm,$575/$690. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .p.226
Wed SC194 Multispectral and Hyperspectral Image Sensors(Lomheim)8:30amto12:30pm,$380/$435 . . . . . . . . . .p.225
Wed SC915 Radiometry Revealed(Shaw)8:30amto12:30pm,$300/$355 . . . . . . . . . . . . . . . . . . . . . . . . . . . .p.227
Wed SC567 Introduction to Optical Remote Sensing Systems(Shaw)1:30to5:30pm,$300/$355 . . . . . . . . .p.223
8 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Plenary Sessions
AllPlenarySessionsareincludedwithyourtechnicalconferenceregistration.
Sunday12August . . . . . . . . . . . . . . . . . . . . . . . . .6:00to7:25pm
6:00to6:05pm: Introduction and Opening Remarks
6:05to6:45pm:
The Exciting Science of Light with Metamaterials
Vladimir M. Shalaev,PurdueUniv.(USA)
Abstract: Recent progress in the developmentof optical metamaterials allows unprecedentedcontrol over the flow of light at both the nano-and macroscopic scales. Metamaterials (MMs)are rationally designed artificial materials withversatile properties that can be tailored to fitalmost any practical need and thus go well
beyondwhatcanbeobtainedwith“natural”materials.Wereviewtheexcitingfieldofopticalmetamaterialsanddiscusstherecentprogress in developing tunable and active MMs, nanolasers,artificial optical magnetism, semiconductor-based and loss-freenegative-indexMMs,andanewmeans for engineering thephotonic density of states with MMs. A powerful paradigm ofshaping space for light with transformation optics, which canenableafamilyofnewapplicationsrangingfromaflatmagnifyinghyperlens to an invisibility cloak, will be also discussed. Finally,wereviewanewapproachforbroadbandlightbendingbyusingmeta-interfaces with plasmonic nanoantennas. The challengesandfuturedirectionsforthefieldwillbeoutlined. Biography: Vladimir (Vlad) M. Shalaev, Scientific Director forNanophotonicsinBirckNanotechnologyCenterandDistinguishedProfessor of Electrical and Computer Engineering at PurdueUniversity,specializesinnanophotonics,plasmonics,andopticalmetamaterials. Vlad Shalaev received several awards for hisresearchinthefieldofnanophotonicsandmetamaterials,includingthe Max Born Award of the Optical Society of America for hispioneeringcontributionstothefieldofopticalmetamaterialsandtheWillisE.LambAwardforLaserScienceandQuantumOptics.He is aFellowof the IEEE,APS,SPIE, andOSA.Prof.Shalaevauthored three books, twenty-one book chapters and over 300researchpublications.
6:45to7:25pm:
Future of Optics and PhotonicsBahaa E. A. Saleh, CREOL,TheCollegeofOpticsandPhotonicsattheUniv.ofCentralFlorida(USA)
Abstract: Morethan50yearsafterthefirstoperationofthelaser,photonicshasbecomeamaturefield.Itwouldbefoolhardytotrytopredictthedisruptivediscoveriesandinventionsthatwillnodoubtcreatenewfuturedirections,butitissurelysafetopredict
steady progress along established R&D directions. Advances inthe underlying fundamental sciences along with improvements intechnologywillenableincreasingnumbersofapplicationsintheuseof lightasacarrierof informationandenergy.Thetransmissionofinformationislimitedbytheresolutionandprecisionwithwhichlightcanbeshapedorconfinedintime,space,andwavelength.Futureadvanceswillnodoubtincludefinerspatialandtemporalresolutionandgreaterprecision,whichwillenablebetter3D,4D,or5Dreading,writing,andcommunicatingwithlightthrough“thicker”media.Itwillalsoenablesourceswithgreaterpowerandmoreefficientconversioninto(orfrom)otherformsofenergy.Theupcomingdecadeswillsurelysee thedevelopmentofnewsyntheticmicro-andnano-structuredmaterialswithunheardofopticalpropertiesandthiswillleadtonewopticsandnewapplications. Biography: Bahaa E. A. Saleh has been Dean of CREOL, TheCollegeofOpticsandPhotonicsattheUniversityofCentralFlorida,since2009.HewasafacultymemberintheDepartmentofElectricalandComputerEngineering(ECE)atBostonUniversityin1994-2008,andheservedasDepartmentChairin1994-2007.HewasalsoDeputyDirectoroftheCenterforSubsurfaceSensingandImagingSystems,anNSFEngineeringResearchCenterin2000-2008.HereceivedthePh.D.inelectricalengineeringfromJohnsHopkinsUniversityin1971andheldfacultyandresearchpositionsatvariousplacesincludingthe University of Wisconsin-Madison where he served as ECEDepartmentChair in1990-1994. Hisresearchcoversmanytopicsinopticsandphotonicsincludingstatistical,nonlinear,andquantumoptics,andimagescience.HeistheauthorofPhotoelectronStatistics(Springer,1978),FundamentalsofPhotonics (withM.Teich,Wiley,1991,2007),IntroductiontoSubsurfaceImaging(Cambridge,2011),and more than 600 papers in technical journals and conferenceproceedings.HeisthefoundingeditorofOSA’sAdvancesinOpticsandPhotonics,andformereditorofJOSAA.SalehisFellowofSPIE,IEEE,OSA,andtheGuggenheimFoundation.Hereceivedthe1999OSABellerAward,the2004SPIEBACUSaward,the2006KuwaitPrize,andthe2008OSADistinguishedServiceAward.
Symposium-wide Plenary Session
spie.org/opadvance · TEL:+13606763290 · help@spie.org 9
Plenary Sessions
NanoScience + Engineering Plenary SessionMonday13August . . . . . . . . . . . . . . . . . . . . . . . . 8:30amto12:00pm
Session Chairs: Satoshi Kawata, OsakaUniv.(Japan)andManijeh Razeghi,NorthwesternUniv.(USA)
The Light and Sound Fantastic: Radiation Pressure at the Nanoscale
Oskar Painter, California Institute of Technology(USA)
Abstract: In the last several years, rapid advanceshavebeenmadeinthefieldofcavityoptomechanics,in which the usually feeble radiation pressure forceof light isusedtomanipulate (andpreciselymonitor)mechanicalmotion.Theseadvanceshavemovedthefieldfromthemulti-kminterferometerofagravitational
waveobservatory,totheopticaltabletop,andnowallthewaydowntoasiliconmicrochip.InthistalkIwilldescribetheseadvances,anddiscussourownwork to realize radiationpressurewithinnanoscalestructures in the form of coupled photonic and phononic crystals(dubbedoptomechanicalcrystals). Biography:Oskar PainterreceivedhisB.S.E.E.fromtheUniversityof British Columbia in 1994, and his Masters Degree of Science(1995) and Ph.D. (2001) in Electrical Engineering from the CaliforniaInstituteofTechnology.In2002hereturnedtotheCaliforniaInstituteofTechnology,whereheiscurrentlyaProfessorofAppliedPhysicsandco-DirectoroftheKavliNanosciencesInstitute.
Organics and Nanostructures for Nonlinear Optics
Nasser Peyghambarian,CollegeofOpticalSciences,TheUniv.ofArizona(USA)
Abstract:Organicandnanostructuresareemployedinvariousnonlinearopticalapplications includingnovelIRmode-lockedfiberlasers,all-opticalswitching,and3Dupdateabledisplay technology.Thispresentationwill focus on our advances in this area including:Sources: Using fiber taper based carbon nanotube
saturableabsorber,wehavedemonstratedanall-fiberthulium-dopedwavelength mode-locked laser operating near 2 µm with over 50nmtuningrange. All-optical switching: Liquids such as CCl4, CS2, and organicsolutionsinliquidcoreopticalfiber(LCOF)offeraneffectiveplatformto study nonlinear optical phenomena, e.g. Raman scattering, four-wavemixingandsupercontinuumgeneration.Inthesedevicesthelonginteractionlengthiscombinedwithastrongfieldconfinementtoenableextremelylowpoweroperation.Ourobservationofall-opticalswitchingusinginverseRamanscatteringinLCOFwith>20dBcontrastatatimescale<5pswillbedescribed. 3Dholographicdisplay:Theuseoforganicsandnanostructuresinholographicupdateable3Ddisplaywillbesummarized(1-2).We acknowledge support from US AFOSR, DARPA and NSFEngineeringResearchCenter,CIAN. References: 1. P. Blanche et al, Nature, Nov 4, 2010.; 2. N.Peyghambarianetal,OpticsandPhotonicsNews,Dec.2011
Biography:Nasser Peyghambarian is currently aProfessor at theCollegeofOpticalSciencesandalsoat theDepartmentofMaterialsScience&EngineeringattheUniversityofArizona.HeistheChairofPhotonics and Lasers and serves as Director of the NSF Center forIntegratedAccessNetworks(CIAN).HeisChairmanoftheBoardandFounderofNPPhotonics, IncandTIPD,LLC.He receivedhisPh.D.in solid-statephysics from IndianaUniversity in 1982, specializing inopticalpropertiesofsemiconductorsbeforejoiningtheopticsprogramattheUniversityofArizona.Hisresearchinterestsincludefiberoptics,fiber lasers and amplifiers, optical components for communication,nonlinear optical materials and devices, integration of polymerswith CMOS circuitry, glass-organic hybrid materials and devices,holographic 3D display, adaptive electro-active lenses for eyewear.He istherecipientof the InternationalFrancquiChair,Belgium1998-1999.HeisaFellowoftheOpticalSocietyofAmerica,theAmericanPhysicalSociety,Societyofopticalengineers,SPIEandtheAmericanAssociationfortheAdvancementofScience.
From Nanophotonics, to Metaphotonics, to Dynamic Photonics: Controlling Light Propagation and Light-Matter Interactions for Emerging Technologies
Paras Prasad, Univ.atBuffalo(USA)
Abstract: An important dimension of Nanophotonics,whichdealswithinteractionbetweenlightandmatteratthenanoscale,iscontrolofexcitationdynamicsbymanipulating local relaxation and energy transfer tojudiciously utilize the excitation energy in a specific,desirable way. Metaphotonics is a rapidly emergingnew direction for Nanophotonics that deals withmanipulationofelectricandmagneticfieldsandtheir
coupling in nanoengineered materials to control the field distributionandpropagationofelectromagneticwaves.DynamicPhotonicsutilizesswitchable/transformable materials in which electrical, optical, andmagneticfieldscanbeusedtoachievedynamicandreversiblecontrolof an optical field as well as linear and nonlinear optical functions.These emerging dimensions of photonics will be presented. Theirapplications, which range from photonics communications, to solarenergyharvesting,tosensortechnology,tobiomedicaltechnologyandhealthcare,willalsobehighlighted.1-3This talkwillconcludewithadiscussionofthevastarrayofnewopportunitiesinthisgrowingfield.1.P.N.Prasad“Nanophotonics”JohnWiley&Sons, (2004).2.P.N.Prasad “Introduction to Biophotonics” John Wiley & Sons, (2003). 3.P.N.Prasad“IntroductiontoNanomedicineandNanobioengineering”JohnWiley&Sons,(2012). Biography: Dr. Paras N. Prasad is a Distinguished Professor ofChemistry, Physics, Medicine and Electrical Engineering, the highestrank in the New York State University system. He also holds theSamuelP.CapenChairattheUniversityatBuffaloandistheExecutiveDirector of the multidisciplinary Institute for Lasers, Photonics andBiophotonics.Dr.Prasadhaspublishedover500scientificpapers,co-editedsixbooks,andco-authoredamonograph (withD.J.Williams),“IntroductiontoNonlinearOpticalEffectsinMoleculesandPolymers.”Dr. Prasad published “Introduction to Biophotonics,” the firstmonographinthisfield,whichauthoritativelydefinesthefield,detailsitsscopeandidentifiesemergingopportunities.Hehasalsopublishedanother monograph, “Nanophotonics,” which includes its impact onNanomedicine.Dr.Prasadalsoholdsanumberofpatents.
Dr. Prasad will teach the short course SC1082 NanophotonicsandMetaphotonicsfollowingthePlenary,from2:00to6:00pmonMonday.Thecourseprovidesamorein-depthexaminationofthetopicsdiscussedinhisPlenarytalk.Formoreinformation,pleaseseep.209.
10 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Plenary Sessions
Global Activities in Novel-Nano Magnetic Materials for Magnetic, Optoelectronics Applications
Misoon Mah, AsianOfficeofAerospaceDevelopment(Japan)
Abstract: Traditionallymagneticpropertieshavebeenobtainedbyusingspinelectronsingroundstatesinbulkmaterials. But recent nanotechnology has developednanostructures that allow exploring the possibility ofsynergistic interactions between magnetic, electronicandopticfunctions.Thismayprovidenewpropertiesand potential applications for detection, sensing,
and renewable energy. Recently, countries such as the US, Japan,China, France, Germany, Brazil and Korea, etc have been investingseriously in the areas of novel magnetic materials, nano-magneticmaterials synthesis, molecular spin physics, and magnetic structure-propertycharacterizations.AFOSRinvestsandsearchesfornewandinnovativeideas,suchasnovel-magneticandmultifunctionalmaterialsthatcanbeimplementedforthefutureAirForceaswellascommercialtechnologyadvancement.ToachievesuchobjectivesAFOSRfacilitatesInternationalcollaborationoftheUSandleadinginternationalscientistsinboththeUSandabroad.Thetalkaddressescurrentstatusandfuturetrend on global activities on novel nanomagnetic and multifunctionalmaterialsthataresupportedbyAFOSR. Biography:Dr. Misoon MahisDirectorofAsianOfficeofAerospaceResearchandDevelopment(AOARD),Tokyo,Japan.ShejoinedAOARD,May2012,andisresponsiblefordevelopingInternationalcollaborationandstrategyintheBasicScienceareawithleadingscientistsintheUS,and inAsiaand thePacificRim.Dr.Mah’sprincipalfieldsof interestare in the areas of basic science including optics and photonics,nanoelectronics,opticalandRFinterconnect,semiconductormaterialsanddevices.
Solar Energy Plenary SessionMonday13August . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1:30to5:00pm
Session Chair: Martha Symko-Davies, NationalRenewableEnergyLab.(USA)
Understanding the Generation of Charge Carriers in Organic Photovoltaic Devices
Garry Rumbles, National Renewable Energy Lab.(USA)andUniv.ofColoradoatBoulder(USA)
Abstract: Thispresentationwilldiscussanalternativeapproach to understanding the important charge-generation step that is critical operation of anorganic photovoltaic device. Instead of consideringthe interface tobeasimple interactionbetweentwosemiconductors,amolecularmodelwillbediscussed.A model that takes advantage of the many years of
studying photo-induced electron transfer in model Donor-Acceptorsystems, where the process of long-lived charge-separation andinhibitedrecombinationprocessarewellknownandcanbedescribedby a Marcus Formulation. Studies of a number of polymer:fullerenesystemswillbereportedeachwithdifferingGibbsenergydrivingforcesand reorganization energies for electron transfer. The implications ofthefindingsonimprovingdeviceperformancewillbediscussed. Biography:Dr. Garry RumblesisaResearchFellowattheU.S.DOENational Renewable Energy Laboratory (NREL). Dr. Rumbles joinedNRELin2000andiswidelyrecognizedforhisresearchinphotochemistryandphotophysicsofconjugatedmolecularsystems,energyconversioninorganiclightemittingdiodesandorganicphotovoltaicdevices,andnanoscalemorphology.InMay2009,hebecameaProfessorAdjointintheDepartmentofChemistryandBiochemistryatCUBoulder;andinOctober2009aFellowofthejointCU/NRELadventure:RenewableandSustainableEnergyInstitute(RASEI).In2004,hewasmadeaFellowoftheRoyalSocietyofChemistry.Dr.Rumbleshaspublishedmorethan130journalarticlesandmorethan10booksections.
Light Management in Single-Junction III-V Solar Cells
Brendan M. Kayes, AltaDevices,Inc.(USA)
Abstract: RecentdevelopmentsatAltaDeviceshavemade clear the importance of paying very closeattention to lightmanagementwithinsolarcells.Ourapproach has pushed the world record for single-junctionsolarcellsunderanon-concentratedAM1.5Gspectrum from its previous value of 26.4% to itscurrent value of 28.8%. This has been enabled byourepitaxialliftoff(ELO)process,whichallowsusto
choose theprecise thicknessof thesemiconductorstack,aswellastooptimizethereflectivityofthebackcontact.Thishasallowedustodemonstrateextremelylowdarkcurrents,leadingtoarecentresultwithopen-circuitvoltageVocof1.126V,previouslyunheardofwithaGaAsabsorbermaterial. Biography: Brendan KayesisamemberofthedevicegroupatAltaDevices, a startup company developing a high-efficiency, flexible,thin-filmPVproduct.AltaDevicescurrentlyholdstheworldrecordforconversionefficiencyofasingle-junctiondevice innon-concentratedsunlight, at 28.8%. Brendan received his PhD. from the CaliforniaInstituteofTechnology,whereheworkedonsiliconnanostructuresforlow-costphotovoltaics.
spie.org/opadvance · TEL:+13606763290 · help@spie.org 11
Plenary Sessions
All Plenary Sessions are included with your technical conference registration.
Carbon Nanotubes for PhotovoltaicsMichael J. Heben,TheUniv.ofToledo(USA)
Abstract: Carbon single-wall nanotubes (SWNTs) areone-dimensionalconductorswithuniqueoptoelectronicproperties.Theycanbeprepared inthin-filmformbyseveral different methods, and hold great promiseas functional components in thin-film photovoltaicdevices.Inparticular,SWNTsarebeingconsideredasreplacementsforconventionaltransparentconductingoxidesandback-contactmaterials, andmayalsobe
used as absorbers. This presentation will review progress in theseareasandhighlightresearchactivitiesattheUniversityofToledo. Biography: Michael Heben is a Professor in the Department ofPhysicsandAstronomyattheUniversityofToledo(UT).Hecurrentlyholds theWrightCenterEndowedChair forPhotovoltaics InnovationandCommercialization.Hecame toUT in2008after eighteenyearsat the U.S. Department of Energy’s National Renewable EnergyLaboratory.
Advanced Solar Cell Technologies for Concentrating Photovoltaics Systems
Vijit Sabnis, SolarJunction(USA)
Abstract: Concentrating photovoltaic (CPV)systems are poised to provide the lowest cost ofelectricity in sunny climates. At the heart of CPVsystems are advanced multijunction solar cellsproviding efficiencies exceeding 40%. Unlike otherPV technologies, multijunction solar cells madefrom group III-V compound semiconductors havetremendous opportunities for significant technology-
drivenimprovementsincellefficiencyandcostreduction.Inthistalk,Iwillprovideanoverviewofthestate-of-the-art inmultijunctionsolarcelldevelopmentanddiscussSolarJunction’sachievementof43.5%efficiencyusingadilute-nitridematerialsplatform. Biography: Dr. Vijit Sabnis co-founded Solar Junction in 2007to manufacture high-efficiency multijunction solar cells for theConcentrating Photovoltaics market. He currently serves as it VicePresidentofTechnology.PriortoSolarJunction,Dr.SabnisworkedasaseniorresearchscientistatTranslucentInc.andreceivedaPh.D.inelectricalengineeringfromStanfordUniversitywithaspecializationinoptoelectronicmaterialsanddevices.
High-Rate Processing and Advanced Emitter Structures for CIGS PV Module Manufacturing
Billy J. Stanbery, HelioVoltCorp.(USA)
Abstract: WedescribeHelioVolt’s recentadvances inReactiveTransferSynthesisofCIGSwhichconsistentlydelivers tight distributions of high efficiency largearea monolithically integrated modules with highyields. We will also contrast the characteristics ofCIGS made from precursors deposited by vacuummethods with precursors synthesized by metal-organic decomposition of liquid inks. Finally, we
will describe our development of innovative alternative materials forthe emitter structure of CIGS devices and compare them with theconventionalcadmiumsulfide/zincoxidestructure.TheimpactofthesedevelopmentsontheprospectsforCIGScompetitivenessinglobalPVmarketswillbediscussed. Biography: Dr. B.J. Stanbery began his career at The BoeingCompany in1978,whereheworked insilicon,galliumarsenide,andCIGSPV,aswellasphotonics.Dr.StanberyreceivedB.S.degreesinbothMathematicsandPhysics fromtheUniversityofTexas,hisM.SPhysicsfromtheUniversityofWashingtonwiththesisworkinorganicPV,andaPh.D.inChemicalEngineeringfromtheUniversityofFlorida.Dr. Stanbery founded HelioVolt Corporation in 2001 and remains itsChairmanandChiefScienceOfficer.
On the Way to Accelerated Life TestingMichael Köhl, Fraunhofer-InstitutfürSolareEnergiesysteme(Germany)
Abstract: The service life of PV modules is limitedby infant mortality failures, hazardous catastrophicfailures and the long-term degradation resulting in asteadydegreaseoftheefficiency,whichiscausedbyweathering.Aservicelifeof25yearsormorerequiresacceleratedtestingofthemodulesbasedonthenatural
stressesinnormaloperation,buttheseloadsneedtobeenhancedtoshortenthedurationofthetests.Amethodologyfortheevaluationofthesestressconditionsbymodelingthemicro-climatic loadsandthedegradationkineticsfordifferentclimateswillbepresented. Biography: Michael Köhl,physicist,isworkinginthefieldofservicelifeanalysiswiththefocusonopticalmeasurementsandweathering.HefundedtheTestLabforPhotovoltaic(typeapprovalofPV-modulesaccording to the IEC standards) at the Fraunhofer Institute for SolarEnergySystemsinFreiburg,Germany,andisleadingaGermanclusterproject “PV-reliability” and the Subproject 5 “Lifetime assessment ofPVmodules”oftheEU-project“Performance”.Heservesasoperatingagent of the Task39 on “Polymeric Materials for Solar-ThermalApplications” of the Solar Heating and Cooling Programme of theInternationalEnergyAgency.
12 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Plenary Sessions
OLEDs and Solid State Lighting Plenary SessionTuesday14August. . . . . . . . . . . . . . . . . . . . . . . . . . . 8:30to10:00am
Session Chairs:Franky So,Univ.ofFlorida(USA)andMatthew H. Kane,MassachusettsMaritimeAcademy(USA)
Development of Charge Generation Layers for Multiphoton Emission OLED
Junji Kido (speaker), Hisahiro Sasabe, Yong-Jin Pu, YamagataUniv.(Japan)
Abstract: Recentry, we succeeded to develop anultra highly efficiency in blue phosphorescent OLEDincorporating a novel charge generation layer unit.This blue OLED showed an extremely high currentefficiencyofanexternalQEofover40%withoutanyout-coupling enhancement. We also developed MPEOLEDshavingtwoemittingunitsbyspin-coating.The
chargegenerationlayerswerecomposedofMoO3whichwerevacuum-evaporated.TheMPEdeviceexhibiteddoublyhigherEQEthanthatofconventionalunstackedsolution-processedsingleOLEDdevice. Biography: Prof. Kido has received his B.S. degree from WasedaUniversity, Japan, in 1984 and the M.S. and Ph. D. degrees fromPolytechnicUniversity,NewYork, in 1987and1989, respectively. In1989, he joined the department of polymer chemistry in YamagataUniversity in Japan as an assistant professor and promoted to anassociateprofessorin1995,andtoafullprofessorin2002.Hebecamea distinguished research professor in 2011. His current researchactivities are focused on OLEDs. He invented white-light-emittingOLEDsin1993,andco-founded“LumiotecInc.”tomanufacturewhiteOLEDpanelsforgenerallightingapplications.
LED Development with Nanostructures and Nanophotonics
Chih-Chung Yang, NationalTaiwanUniv.(Taiwan)
Abstract: To further improve the emission efficiencyandenhancetheoutputpowerlevelofalight-emittingdiode(LED),nanorodstructuresandsurfaceplasmoncoupling mechanism have been introduced to LEDfabrication.AnanorodLEDarrayhastheadvantagesofhighercrystalquality,largeremissionvolume,non-polarquantum well emission, higher indium incorporation,and stronger light extraction, when compared with a
planarLEDstructure.With thesurfaceplasmoncouplingmechanismin an LED, the internal quantum efficiency (IQE) can be increased,particularlyforthoseinthegreen,yellow,andredrangesoflowIQEs.Inthispresentation,thetechniquesofregularlypatternednanorodLEDarrayandsurfaceplasmoncoupledLEDarediscussed. Biography: C.C. (Chih-Chung) Yang received his Ph.D. degree in1984 in electrical engineering from the University of Illinois, Urbana-Champaign. Since 1993, he became a professor in the Institute ofPhotonics and Optoelectronics, and the Department of ElectricalEngineering,NationalTaiwanUniversity,Taipei,Taiwan.His researchareasincludetheMOCVDandMBEgrowthsofGaNandZnO-relatedsemiconductors, light-emitting diode, plasmonics, and biophotonics.HeisafellowofSPIEandafellowoftheOpticalSocietyofAmerica.
Optical Engineering Plenary SessionTuesday14August. . . . . . . . . . . . . . . . . . . . . . . . . . . . 4:00to5:35pm
SessionChairs:José Sasián,CollegeofOpticalSciences,TheUniv.ofArizona(USA);R. John Koshel, PhotonEngineeringLLC(USA)andCollegeofOpticalSciences,TheUniv.ofArizona(USA)
Welcome and Opening RemarksJosé Sasián, CollegeofOpticalSciences,TheUniv.ofArizona(USA)
A New Job for Telescopes: Making Solar Electricity
J. Roger P. Angel, StewardObservatoryMirrorLab.,TheUniv.ofArizonaCollegeofOpticalSciences(UnitedStates)andREhnuLLC(UnitedStates)
Abstract: Roger Angel hasdevelopedconceptsandtechnologyforsomeofthemostpowerfulastronomicaltelescopes, including the Large Binocular Telescopeand the planned Giant Magellan Telescope. Todayhe isworkingonnovelways toharvestsolarenergy
by focusing sunlight onto small but powerful photovoltaic cells, andalsoonto thermal receivers toheat liquid tobestored fornight-timegeneration. Both approaches are designed to use mass-produced,self-supportingglassmirrors.Incombinationtheypromise24/7solarelectricityatacostcompetitivewithfossilfuelgeneration. Biography: Dr. Roger Angel is Regents Professor of Astronomyand Optical Sciences at the University of Arizona, where he directstheStewardObservatoryMirrorLab.HeisamemberoftheNationalAcademyofSciencesandtheAmericanAcademyofArtsandSciences,aFellowoftheRoyalSocietyandaformerMacArthurFellowandaco-recipientof the2010KavliPrize inAstrophysics.He foundedand isCTOofREhnuCorporation.
From Titanic to the Tiny: Three Decades of Underwater Optical Imaging
Jules S. Jaffe, Scripps Institution of Oceanography(USA)
Abstract: Jules Jaffe will recount his experienceas a member of the science team at Woods HoleOceanographic Institution that discovered thewreckageoftheTitanicin1985usinganopticalimagingsystem.SincejoiningScripps,Jaffehasdevelopedanumber of underwater imaging systems that haveoffereduniqueviewsofavarietyoforganismsthatlive
intheocean.Jaffewilldescribehispastandongoingprojects,includingarecentgrantfromtheKeckfoundationtodevelopanunderwater3Dvideoratemicroscopeandexplainhowhisworkprovidesnewinsightsintomarineecosystems. Biography: Dr. Jules Jaffe is a Research Oceanographer at theScripps Institution of Oceanography. Dr. Jaffe received a B.A. fromSUNYBuffalo,anM.S.fromtheGeorgiaInstituteofTechnologyandaPh.D.fromU.C.Berkeley.Afterseveralyearsinindustryhejoinedthe Woods Hole Oceanographic Institution and subsequently joinedScripps.Dr.JaffeisafellowoftheAcousticalSocietyofAmericaandEditorinChiefofMethodsinOceanography.
spie.org/opadvance · TEL:+13606763290 · help@spie.org 13
Plenary Sessions
Organic Photonics + Electronics Plenary SessionWednesday15August . . . . . . . . . . . . . . . . . . . . . . . . 8:15to10:00am
Session Chair: Zakya H. Kafafi, NationalScienceFoundation(USA)
Announcement of the Organic Photonics + Electronics Best Student Paper Award Winner
Liquid Crystal Lasers: From Concepts to Practical Realisation
Harry J. Coles,Univ.ofCambridge(UnitedKingdom)
Abstract: WedescribethebackgroundtoMicroscopicLiquid Crystal lasers and then consider the keyproperties of the liquid crystal host & cavity designthat lead to high slope efficiency (~70%), low laserthresholds(~50nJ/pulse),narrowlinewidths(<0.01nm)andquasi-continuousworking(5kHzpulserate)givingaverage powers of 5mW per pixel, or laser spot,continuouslytunableoverthewholevisiblespectrum.
2-D lenslet arrays, 100 x100, have been used to give high outputpowersand“white”lightlasinginthefarfield.Aprototypedemonstrator(8”x5”x2”) has been built and used for holographic projection andpaintableandink-jetprintedlasershavebeendemonstratedandusedonplastic,paperormetalfoilsubstrates. Biography:Harry Coles is theProfessorofPhotonicsofMolecularMaterialsinCambridgeUniversity,DirectoroftheCMMPEandFellowof St Catharine’s College and the Institute of Physics. His researchinterestsareSynthesisandCharacterisationofOrganicOptoelectronicMaterialsand theirApplications.Hehaspublishedover250 refereedpapers, 35 patents, and 450 conference papers and given over 90invited/plenarylecturesatInternationalConferences.HonoursincludetheBenSturgeonLecturerin2002andthe2003GeorgeGrayMedalforhisresearchonLiquidCrystalsandtheirApplications.
The Role of Solution Processing in the Future of OLED TVs
Marie O’Regan, DuPontDisplays(USA)
Abstract: Solution coating offers the potential forsignificant cost-savings in AMOLED productionthroughefficientmaterialutilizationandtheuseoflargesizeglasssubstrates.TheDuPontapproachtosolutionprocessingisbasedonsmallmoleculeOLEDmaterialsbecauseoftheirsuperiorperformance.Bytailoringthematerialstotoleratesolutioncoatinginambientclean-room conditions, DuPont is able to deliver printed
deviceswith excellent electrical performance.Blanket layers are firstdeposited sequentially via slot die coating. The RGB sub-pixels arepatternedbyprintingwithanozzleprinter,where thepixelsarefilledbycontinuouslyextrudingsolutionfromnozzlesmovingathighspeeds. Biography: Marie O’Regan is the Technology Director at DuPontOLEDsinSantaBarbara,CA,wheresheisresponsibleforresearchanddevelopmentactivities insolutionOLEDs.Prior toworkingatDuPontDisplays,shewasaresearchscientistatEastmanKodakinRochester,NY.MarieholdsaB.Sc.degreeinChemistryfromUniversityCollege,DublinandaPh.D.inInorganicChemistryfromMIT.
Plastic Solar Cells: Breaking the 10% Commercialization Barrier
Yang Yang (speaker), Jingbi You, Letian Dou, Gang Li, Univ.ofCalifornia,LosAngeles(USA)
Abstract: Plasticsolarcellrepresentsagamechangertechnology,sincepotentiallyitcanbemass-productionvia printing technology using earth abundantmaterials.Inthispresentation,Iwillsummarizerecentachievementsof theplastic solarcells, and focusonthe rapidprogresson the tandemstructure. Tandemsolarcellsprovideaneffectivewaytoharvestabroader
spectrumofsolarradiationbycombiningtwoormoresolarcellswithdifferentabsorptionbands.However,forplastic(orpolymer)solarcells,theperformanceoftandemdeviceslagsbehindsingle-layersolarcellsmainlydue to the lackof a suitable low-bandgappolymer.Here,wedemonstrate highly efficient single and tandem polymer solar cellsfeaturinga low-bandgapconjugatedpolymer (PBDTT-DPP:bandgap,∼1.44eV).Asingle-layerdevicebasedonthepolymerprovidesapowerconversionefficiencyof∼6%.Whenthepolymerisappliedtotandemsolar cells, a power conversion efficiency of 8.62% is achieved. Viafurther improving of the IR-absorbing polymer, a recording breakingperformance of 10.6% was achieved. This approach opens a newdirectionforachievinghighperformancepolymersolarcellsforfuturecommercialization. Biography: Prof. Yang Yang is theCarolandLawrenceE.TannasJr. Endowed Chair Professor of UCLA. His main research is in therenewableenergywithfocusonthinfilmsolarcellsbasedonorganicpolymersandCIGS/CZTS.Hisgroupwasamongthetoptenhighestcited groups in 2010, according to the Science Watch published byThomasonReuters’.
14 spie.org/opadvance · TEL:+13606763290 · help@spie.org
SPIE Apps for iPhone®
and Android™
Conference ProgramAndroid and iPhone®
Createyourschedule—searchandbrowsetheTechnicalProgramandspecialevents,participants,andexhibitors.
Profiles iPhone®
Makevaluablepersonalconnections—findandcontactcolleaguesbasedonSPIEresearchpublications,conferenceinvolvement,andcoursestaught.
Field GuidesAndroid and iPhone®
TakeFieldGuidestoanewlevel—accessanduseequations,linkedterms,bookmarks,andinteractivefigures,andtakenotes.
Try Geometrical Optics Field Guide Lite for Free!
Newsroom iPhone®
Thelatestinnovations,news,andmultimediacoverageofOpticsandPhotonics.
iPhoneandiTunesareregisteredtrademarksofAppleInc.
spie.org/opadvance · TEL:+13606763290 · help@spie.org 15
Technical Events
Panel Discussion: Vision 2025Sunday12August . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4:45to5:45pm
Moderators: Akhlesh Lakhtakia, ThePennsylvaniaStateUniv.(UnitedStatesJudith A. Todd, ThePennsylvaniaStateUniv.(UnitedStates)
Panelists: Mathew J. Burrows, CounselortotheNationalIntelligenceCouncil
(UnitedStates)Paul Davis, GoodwinProcterLLP(UnitedStates)Paul F. McManamon, Univ.ofDayton(UnitedStates)andExciting
TechnologyLLC(UnitedStates)MJ Soileau,Univ.ofCentralFloridaOfficeofResearch&
Commercialization(UnitedStates)James D. Trolinger,MetroLaser,Inc.(UnitedStates)
Astheentireworldmovesonatrajectoryforaknowledge-basedglobaleconomy, technoscientific innovation must be promoted for solvingtheproblemsof todayand forestalling thoseof tomorrow.Thepanelmemberswill respond toquestions from theaudienceon university-industry-government partnerships, legal frameworks, and societalincentives to promote photonics innovation. Enhancement of K-16photonicseducationtofostercriticalthinkingandexperientiallearninginplaceofrotelearningwillalsobeontheagenda.
The 2012 Zoom Lens Design ProblemMonday13August . . . . . . . . . . . . . . . . . . . . . . . 11:40amto12:10pm
Thezoomlensdesignproblemforthe2012ZoomLensIVconferenceisafirstofitskind.Thechallengeistodesignalensoperatingatasinglewavelengthof587.6nmwitha20:1zoomratiousingonlyfourelements;akin to the 1990 IODC Monochromatic Quartet design problem. Thelensdesignoffersseveraldegreesoffreedomincludingarangeofglassandasphericelementsinordertoachievethecontinuouszoomthrougheffectivefocallengthsfrom4mmto80mm,withabackfocallength>16mm.Throughoutthezoommotion,thefirstelementandtheaperturestop are kept in fixed positions relative to the image plane and lensoperatesataconstantf/10.Thegoaloftheproblemistominimizethelengthofthesystemasmeasuredfromthevertexofthefrontelementtotheimageplane.ThedesignisrequiredtomeetanRMSWFE<0.07wavestoafieldheightof1.25mm,whilesupportingafullfieldheightof2.5mmwithlessthan5%magnitudedistortion.Thereareadditionalmechanicalconstraints. Allentriesmustbesubmittedby15 May 2012. ForaPDFofthe2012zoomlensdesignproblemstatement:http://spie.org/documents/events/Conf8488_ZoomLens-IV_DesignProblem.pdf If you have any questions about the problem, contact:zoomlensproblem@fivefocal.com or refer to the FAQ section of thelensdesignproblemwebsite:http://www.fivefocal.com/2012/04/2012-zoom-lens-conference-iv-design-problem/.
Poster Session: Solar Energy and Optical Engineering + ApplicationsMonday13August . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5:30to7:30pm
ConferenceattendeesareinvitedtoattendthepostersessiononMondayevening.ComeviewthecollectionofposterswithinSolarEnergyandOptical Engineering + Applications. Enjoy light refreshments, askquestions,andnetworkwithcolleaguesinyourfield.Authorsofposterpapers will be present to answer questions concerning their papers.Attendeesarerequiredtoweartheirconferenceregistrationbadgestothepostersessions.Posterauthors,visithttp://spie.org/x30293.xmlforset-upinstructions.
Illumination Technical EventMonday13August . . . . . . . . . . . . . . . . . . . . . . . . . . . 8:00to10:00pm
Chair: Jake Jacobsen,Synopsys,Inc.(USA)
Interest in free-formopticshasbeen increasing in recentyears.Withadvances in computational methods, the use of such surfaces hasbecome practical for a wide range of applications where precisetailoringtheilluminationpatterniscritical.Atthisyear’stechnicaleventwewilldiscuss issuessurrounding thespecificationanduseof free-formopticsforilluminationsystems. Thefollowingspeakershaveagreedtotalkattheeventandparticipateinapaneldiscussionafterwards:Dr. William Cassarly,Synopsys,Inc.(USA)Prof. Pablo Benítez, Univ.PolitécnicadeMadrid(Spain)andLight
PrescriptionsInnovatorsLLC(USA)Prof. Harald Ries,OpticsandEnergyConceptsAG(Germany)
At theendof theplannedevent, timepermitting,anymemberof theaudiencemaypresentinformationwithinthebroadfieldofillumination.Lightrefreshmentswillbeserved.
Light refreshments sponsored by:
TheOpticalSolutionsGroupat
Panel Discussion: Commercialization of Emerging Photovoltaic TechnologiesTuesday14August. . . . . . . . . . . . . . . . . . . . . . . 10:30amto12:00pm
Moderator: Loucas Tsakalakos, GEGlobalResearch(USA)
Panelists:Vahan Garboushian, AmonixInc.(USA)Garry Rumbles, NationalRenewableEnergyLab.(USA)
andUniv.ofColoradoatBoulder(USA)Brendan M. Kayes,AltaDevices,Inc.(USA)Billy J. Stanbery,HelioVoltCorp.(USA)
Lens Design Technical EventTuesday14August. . . . . . . . . . . . . . . . . . . . . . . . . . . 8:00to10:00pm
Session Chair: Rich Pfisterer,PhotonEngineering,LLC(UnitedStates)
“Let’s Give ‘Em Something to Talk About!”
Lensdesigners!Joinusforourannualgatheringtomeetanddiscuss...lensdesign! Let’s talk aboutwhatwe’redesigning, howwe’regoingaboutdoing it (whatmaterials,software, techniques,etc.),andwhichproblemswe’reencountering.We’llalsoexplorecurrenttechnicalandcommercialtrendsinthemarketplace.
Light refreshments sponsored by:
TheOpticalSolutionsGroupat
16 spie.org/opadvance · TEL:+13606763290 · help@spie.org
An Optical Believe It or Not: Key Lessons Learned Technical EventTuesday14August. . . . . . . . . . . . . . . . . . . . . . . . . . . 8:00to10:00pm
Chair:Mark Kahan, Synopsys,Inc.(UnitedStates)
Thisevent isdedicatedtothesharingofkeyoptical lessons learned.Nearlyallopticalengineers,scientists,researchers,ormanagershavedealt with the unexpected. Many of these situations in hindsight arequitefunny,andhaveburiedwithinthemkeyoptical/manageriallessonslearned. The problem with simply listing lesson learned is that as asimplelisting,theyareclearlyhardtoremember,thushistoryrepeatsitselfmuchtoourcollectivedebit.Thiseventwillhelpusallremembertheimportanttake-awaysbypresentingacollectionofsmallstoriesoropticalparables.Eachmaybesomewhatembellished(withineditoriallimits),andnames,places,anddatesmaybechangedtoprotecttheguilty,butallmust (a)haveabasis in truthasavowedby theauthor(Devil’sAdvocated if/asapropos).Speakersand furtherdetails tobeannounced.
Optomechanical/Instrument Technical Group EventTuesday14August. . . . . . . . . . . . . . . . . . . . . . . . . . . 8:00to10:00pm
Session Chair: Alson E. Hatheway, Alson E. Hatheway Inc. (UnitedStates)
This is the annual meeting of the premier group of optomechanicalengineers that design and analyze the world’s optical instrumentsand systems. This gathering is open to all attendees to the OpticsandPhotonicsSymposium.AnyonewhowishestoputanitemontheagendashouldcontacttheChair,AlHatheway,ataeh@aehinc.com. OurprincipalspeakerwillbeMr.BradSteele,DirectorofEngineeringat Quartus, Inc., San Diego, California. His topic will be “MethodsEmployedinDesignforMountingLargeApertureTransmissiveOptics.”Quartus has successfully designed and deployed numerous opticalsystemsmountinglargetransmissiveoptics.Hewillshareapproachesand insights into system optimization and novel analysis methodsdevelopedtosupportthedesignprocess. FollowingMr.Steele the floorwill beopen forother agenda itemsand our traditional ‘Problems and Solutions Workshop’ session. BepreparedtopresentsomechallengestotheGroup.
Penetrating Radiation Technical EventTuesday14August. . . . . . . . . . . . . . . . . . . . . . . . . . . 8:00to10:00pm
Chair: James E. Baciak,PacificNorthwestNationalLabs.(UnitedStates)
Thiseventbringstogethertechnologistsandscientistswithinterestsinneutron,x-andgamma-raydetection,spectroscopy,andimagingforallapplications.Speakertobeannounced.
Workshop on X-Ray MirrorsTuesday14August. . . . . . . . . . . . . . . . . . . . . . . . . . . . 8:15to9:15pm
Chair: Ali M. Khounsary,ArgonneNationalLab.(UnitedStates)
The X-ray Mirror Working Group provides an informal setting for theinterestedengineersandscientiststomeetanddiscussissuesrelatedto the design, analysis, cooling, fabrication, and metrology of x-raymirrors.Topicsfordiscussioncanbee-mailedtotheorganizer,Dr.AliKhounsary(amk@aps.anl.gov),priortothemeeting.
Panel Discussion: Life in the CosmosTuesday14August. . . . . . . . . . . . . . . . . . . . . . . . . . . 8:00to10:00pm
Panel Moderators: Richard B. Hoover,NASAMarshallSpaceFlightCtr.; N. Chandra Wickramasinghe, Univ.ofBuckingham(UnitedKingdom)
Panelists: Michael H. Engel, TheUniv.ofOklahoma;George E. Fox, Univ.ofHouston(UnitedStates); Gilbert V. Levin, ArizonaStateUniv.;Joseph D. Miller, The Univ. of Southern California (United States);Alexei Yu. Rozanov, Paleontological Institute (Russian Federation);Charles V. Rice, TheUniv.ofOklahoma;Michael C. Storrie-Lombardi, KinohiInstitute(UnitedStates)
Does lifeexistonlyonEarth,or is it acosmic imperativeandwidelydistributedthroughouttheCosmos?Thisisthefundamentalquestionof Astrobiology. It is now well established that life exists in Earthwherever liquidwater,biogenicelementsandasourceofenergyco-exist. A recent study of red dwarf stars carried out at the EuropeanSouthernObservatoryhasrevealedthattensofbillionsofrocky,Earth-sizedplanetswith thepotential for liquidwaterprobably exist in theMilkyWaygalaxyalone.Astrobiologists,biochemists,microbiologists,andpaleontologistscontinuetoinvestigatetheoriginofpre-bioticandchiral biomolecules and life and the distribution of water and life onEarthandintheCosmos.The2012SPIELifeintheCosmosPanelwillreviewrecentdiscoveriesinAstronomy,Microbiology,andAstrobiologyanddiscusstheirimplicationswithmembersoftheaudience. Biographies:Richard B. Hoover isanAstrobiologistat theNASA/Marshall Space Flight Center, where he has worked since 1966. Hisinitialworkwasonx-rayopticalsystemsandhewasMSFCInventoroftheYear(1991,1992)andNASAInventoroftheYear(1992).Hisresearchondiatomsandothermicroscopicalgaebeganin1968.AttheInvitationoftheRoyalSocietyofAntwerp,BelgiumheconductedtheInventoryoftheHenrivanHeurck,AlbertGrunowandtheReverendWilliamSmithdiatomcollections.Hisarticle“ThoseMarvelousMyriadDiatoms”waspublished in the June, 1979 issue of “National Geographic”. Hooverwas co-investigator on two proposals selected in 1997 by NASA forthe initial Virtual Astrobiology Institute: the study of microfossils andbiomarkers in astromaterials with David McKay-PI and the study ofmicrobialextremophileswithKennethNealson-PI.Duringthisworkhedetected evidence for microfossils in carbonaceous meteorites andpioneeredtheuseofenergydispersivex-rayspectroscopyanalysisofnitrogencontenttodistinguishmodernbio-contaminantsforindigenousmicrofossils. He led scientific expeditions to Alaska, Antarctica,California,Iceland,PatagoniaandSiberiatocollectnovelextremophilesfromsomeoftheEarth’smosthostileenvironments.Studyofsamplesreturnedfromtheseexpeditionsresulted inthediscoveryoftwonewgenera (Anaerovirgula and Proteocatella) and nine new species ofbacteria and archaea. In recognition of the contributions from theseexpeditions, he was elected a Fellow National of the Explorers Club(2001).HewasmadeanHonoraryLifeMemberofthePlanetaryStudiesFoundation (2003) in recognition of his research on microfossils incarbonaceousmeteorites.RichardB.Hooverhasauthored/edited39volumes and over 300 scientific papers, encyclopedia articles, andbook chapters on x-ray/EUV optics, x-ray astronomy, solar physics,astrobiology, extremophiles, and diatoms. His research on microbialextremophilesandmicrofossilsinmeteoriteshasbeenfeaturedinfilmsbytheNationalScienceFoundation,BBC,NKV,DiscoveryChanneland“NationalGeographic”.RichardB.HooverisaFellowofSPIE.HewasthePresidentofSPIE in2001andwasawardedthe2009SPIEGoldMedaloftheSociety.
Technical Events
spie.org/opadvance · TEL:+13606763290 · help@spie.org 17
Technical Events
All technical special events are included with your technical conference registration.
Tribute to William WolfeWednesday15August . . . . . . . . . . . . . . . . . . . . . . 8:00amto2:40pm
Chair: Mary G. Turner, BreaultResearchOrganization,Inc.
In thepast fewyears,SPIEhaspaid tribute toa few individuals thathavehelpedmake research in theirfieldsmoreproductiveandmoreenjoyable. Starting with Adolf Lohmann, some other honorees haveincludedRobertShannonandRolandShack,WarrenSmith,andJoeGoodman.ThisconferenceandresultingpublicationwilladdBillWolfeto that list. The authors within this conference will present for theenjoyment(and,hopefullyamusement)ofProf.Wolfe. Pleasejoinotherstudents,friendsandcolleaguesinthankingProf.Wolfeforallhehasdonetohelpallofuspersonallyandprofessionally.
Panel Discussion: Polymers vs. Glass... and Other Questions Concerning Polymer Optics and Molded GlassWednesday15August . . . . . . . . . . . . . . . . . . . . . . . . . 4:30to5:30pm
Moderator: David H. Krevor,TactusTechnology,Inc.(UnitedStates)
Panelists:William S. Beich, G-SPlasticOptics(UnitedStates);Michael P. Schaub, Raytheon Missile Systems (United States) Stefan M. Bäumer, PhilipsLightingB.V.(Netherlands)Alan Symmons, LightPathTechnologies,Inc.(UnitedStates)
Thispaneldiscussionwillofferallparticipants theopportunity toaskquestionsonanyaspectofpolymeropticsandmoldedglassoptics.Aprimarydiscussionsubjectwillbethediscriminatorsbetweenpolymersandinorganicglass.Wewilldiscussboththedesignandmanufacturinglimitations and freedoms when choosing between polymeric andinorganicglassmaterials.Therewillalsobetheopportunitytodiscussyour design or production question with the experts in the field.Featuredpanelists includeMichaelSchaub,authorof“TheDesignofPlastic Optical Systems” and editor of “Molded Optics: Design andManufacture,” and Stefan Bäumer, editor of “Handbook of PlasticOptics.”
Poster Session: Nanotechnology, Organic Photonics + Electronics, and Digital Image ProcessingWednesday15August . . . . . . . . . . . . . . . . . . . . . . . . . 5:30to7:30pm
Conference attendees are invited to attend the poster session onWednesday evening. Come view the collection of posters within thetopicsofNanotechnology,OrganicPhotonics+Electronics,andDigitalImageProcessing.Enjoylightrefreshments,askquestions,andnetworkwithcolleaguesinyourfield.Authorsofposterpaperswillbepresenttoanswerquestionsconcerning theirpapers.Attendeesare requiredto wear their conference registration badges to the poster sessions.Posterauthors,visithttp://spie.org/x30293.xmlforset-upinstructions.
18 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Special and Networking Events
Women in Optics Presentation and ReceptionMonday13August . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5:00to6:30pm
Gender Diversity
Dr. Theodore W. Hodapp, Director of Education andDiversity,TheAmericanPhysicalSociety
Theodore Hodapp is the Director of Education andDiversity for the American Physical Society (APS)in College Park, Maryland. The APS Department ofEducation and Diversity runs programs that advocate
issuesrelevanttominoritiesandwomen,andinareasofeducationandcareers.TedisalsoPrincipalInvestigatorofalargeNSFandAPS-fundednationaleffort,thePhysicsTeacherEducationCoalition,whichseekstoimprove the quality and quantity of physics and physical science K-12teachers.Dr.HodappwaspreviouslytheProgramDirectorintheNationalScienceFoundation’sDivisionofUndergraduateEducation,andprofessorand chair of the Hamline University Physics Department in St. Paul,Minnesotapriortothat.HeservedaschairofthePhysicsandAstronomyDivisionoftheCouncilonUndergraduateResearch,andisaFellowoftheAmericanPhysicalSociety.His research interests include lasercooling,opticalmodeling,andphysicseducationresearch.
All-Conference Welcome ReceptionMonday13August . . . . . . . . . . . . . . . . . . . . . . . . . . . . 7:00to8:30pm
All registered conference attendees are invited to relax, socialize, andenjoy refreshments. Please remember to wear your SPIE registrationbadge(required).Dressiscasual.Guestbadgemaybepurchasedduringtheregistrationprocessorattheregistrationdeskonsite.
Student Chapter Exhibit MixerTuesday14August. . . . . . . . . . . . . . . . . . . . . . . . . . . . 4:00to5:00pm
Exhibitors, join us for refreshments and a late-afternoon mixer in theStudentChaptersectionoftheExhibitionHall.MeetouramazingstudentsandlearnabouttheinnovativeactivitiesofsomeofthebestandbrightestStudentChaptersacrosstheglobe!
SPIE Fellows LuncheonTuesday14August. . . . . . . . . . . . . . . . . . . . . . . . . . . 12:00to1:30pm
AllSPIEFellowsare invitedto joinyourcolleaguesforthisSPIEhostedluncheon.ThenewOpticsandPhotonicsfellowswillbeintroducedandreceive their fellow plaques and pins. Please join us for this informalgatheringandachancetointeractwithotherfellows. FellowsplanningtoattendareaskedtoRSVPtoBrentJohnson.
Fellows Luncheon Presentation:Critical Issues in Physics EducationDr. Theodore W. Hodapp, Director of Education andDiversity,TheAmericanPhysicalSociety
Physicseducationinthiscountryfacesmanychallengeswith ramifications for the entire science enterprise. Dr.Hodappwillpresentdataoncurrentissues,andwhatis
beingdonetounderstandtherootcausesandaddressthem. Theodore Hodapp is the Director of Education and Diversity for theAmerican Physical Society (APS) in College Park, Maryland. The APSDepartment of Education and Diversity runs programs that advocateissuesrelevanttominoritiesandwomen,andinareasofeducationandcareers.TedisalsoPrincipalInvestigatorofalargeNSFandAPS-fundednationaleffort,thePhysicsTeacherEducationCoalition,whichseekstoimprove the quality and quantity of physics and physical science K-12teachers.Dr.HodappwaspreviouslytheProgramDirectorintheNationalScienceFoundation’sDivisionofUndergraduateEducation,andprofessorand chair of the Hamline University Physics Department in St. Paul,Minnesotapriortothat.HeservedaschairofthePhysicsandAstronomyDivisionoftheCouncilonUndergraduateResearch,andisaFellowoftheAmericanPhysicalSociety.His research interests include lasercooling,opticalmodeling,andphysicseducationresearch.
SPIE Members ReceptionTuesday14August. . . . . . . . . . . . . . . . . . . . . . . . . . . . 7:00to8:30pm
For SPIE Members Only. (Membership will be checked at the entrance for admission)
All SPIE Members are invited to this reception in their honor. Comerelaxandtalkwithyourcolleagues.Refreshmentswillbeserved.Pleasenote:thisreceptionislimitedtoSPIEMembersonly.Membershipcardsorinvitationswillberequestedattheentrance.IfyoujoinSPIEon-site,pleasebringyourregistrationreceipt.Dressiscasualorbusinessattire.
Speed Networking SocialWednesday15August . . . . . . . . . . . . . . . . . . . . . . . . . 5:00to6:30pm
Joinus for thenextgenerationofnetworking.Addanewcontact toyournetworkeverythreeminuteswhileenjoyingappetizersatanoff-site venue. Bring plenty of business cards, practice your pitch, andpreparetoexpandyournetwork.
Annual General Meeting of the SPIE CorporationTuesday14August. . . . . . . . . . . . . 6:00to7:00pm
TheSocietyofPhoto-OpticalInstrumentationEngineers(SPIE)
San Diego Marriott Marquis and Marina
Agenda1. 2012 Election Results2. Report on the “State of the Society”3. Treasurer’s Report4. Q & A with SPIE Officers
ThisisthegeneralbusinessmeetingoftheSociety.AllSPIEMembersarewelcomeandencouragedtoattend.ThisisyourforumforexpressingyourideasabouttheSociety.Resultsofthe2012electionwillbeannounced,andthePresidentandExecutiveDirectorwillreportonthe“StateoftheSociety.”ThismeetingwillbefollowedbytheMembersReception.BotheventsareopentoMembersonly.
spie.org/opadvance · TEL:+13606763290 · help@spie.org 19
Special and Networking Events
SPIE Senior Members BreakfastWednesday15August . . . . . . . . . . . . . . . . . . . . . . . . . 8:00to9:00am
All SPIE Senior Members are invited to join your colleagues for thissecond annual SPIE hosted buffet breakfast. Please join us for thisinformalgatheringandachancetointeractwithotherSeniorMembers.Pleaseplan towearyouryellowSeniorMember ribbon forentry intothisevent. Senior Members planning to attend are asked to RSVP to BrentJohnson.
SPIE 2012 Annual Awards Banquet San Diego Marriott Marquis and Marina, Marina BallroomWednesday15August . . . . . . . . . . . . . . . . . . . . . . . . 7:30to10:00pm
SPIE President Eustace Dereniak will preside over the 2012 AwardsBanquetthatwillincludethepresentationofthe2012Societyawards. Enjoyaneveningofhonoringcolleagues,socializingwithfriends,andoutstandingentertainment. TicketsforthebanquetmaybeorderedontheregistrationformorpurchasedonsiteattheSPIECashierDeskuntil12noononTuesday14August,spacepermitting.Cost$85.
Guest Hospitality SuiteSan Diego Marriott Hotel and MarinaMonday-Thursday13-16August2012 . . . . . . . . . . . 8:30to10:00am
Guestsofattendeesareinvitedtomeet,relax,andenjoyacupofcoffeeandlightbreakfastintheSPIEGuestHospitalitySuite.Thissuiteisforguestsofattendeesonly.Thehotelconciergewillbeavailableduringaportionofthistimetoanswertravel,shopping,andtouristquestions.
Press RoomThe on-site Press Room provides media representatives withconference space, refreshments, convenient one-stop-shopping forpressreleases,andallowsnewstobecommunicatedviaphoneandhigh-speedinternetconnections.Credentialedmembersofthepressareurgedtopre-registerbyemailing:name,organization,andcontactinformationtomedia@spie.org Registrationandexhibitionfeesarewaivedformediarepresentatives.FormoreinformationaboutSPIEmediaservices,seehttp://spie.org/x2997.xml
SPIEthanksoursponsorsfortheirgeneroussupportofOptics+Photonics2012
Promotional PartnersAmerican Institute of Physics
At-Fachverlag GmbH
Cambridge University Press
Carl Hanser Verlag GmbH & Co KG
Electro Optics Magazine
Federal Laboratory Consortium for Technology Transfer (FLC)
IOP Publishing Ltd.
Laser Focus World
Materials Today
optics.org
The Optronics Company, Ltd.
Photonics Online
Spectroscopy Magazine
Conference Bag Inserts
www.americanelements.com
Booth #837www.cvimellesgriot.com
Lanyards
Booth #735www.trioptics.com
Meter Board
Booth #528www.lambdares.com
Booth #435http://www.photonengr.com
General Refreshments
Booth #1025www.photonengr.com
20 spie.org/opadvance · TEL:+13606763290 · help@spie.org
TheSPIECareerCenteristheidealplacetobeseenbyemployerswhoarespecificallylookingforopticsandphotonicsprofessionals.Checkingthejoblistingsisagreatwaytoseewhatishotandwhatisnotinthejobmarket,andwhetheryourparticularskillsareamongthosemostindemand.
TheSPIECareerCenteroffers:Freeonlinejobsearch—Alljobseekerfunctionsareavailableatnocharge.
ContactSaraLiebertforinformation.+13607153705 jobsales@spie.org
✔ CONfIDENTIaL rESumE POSTINg Makeyourresumeavailabletoemployers,andreleaseyourcontactinformationonlywhenyouareready.
✔ JOb SEarCh agENT Createapassword-protectedaccountandreceiveautomaticemailnotificationofnewjobsthatmatchyoursearchcriteria.
✔ SavED JObS CaPabILITy Saveupto100jobstoafolderinyouraccountsoyoucomebacktoapplywhenyouareready.
SPIE Career Center makes finding the perfect job easy.
SPIE Career Center
Career Advancement Made Easy
spie.org/careercenter
Post Your Resume Today.
spie.org/opadvance · TEL:+13606763290 · help@spie.org 21
Events for Students/Early Career Professionals
Student Chapter Leadership WorkshopSaturday11August. . . . . . . . . . . . . . . . . . . . . . . . 8:00amto5:00pm
Open to SPIE Student Chapter members.
Participate inthe leadershipworkshopwith200student leadersfromaround the world and network with alumni from the past decade ofworkshops. You’ll also learn the basics of SPIE Student Membership Benefitssuch as Student Chapter funding, scholarships, travel grants, andvisitinglecturers. Pleaseemailstudents@spie.orgformoreinformation.
Optics Outreach OlympicsSunday12August . . . . . . . . . . . . . . . . . . . . . . . . . . . 7:30to11:30pm
View optics and photonics demonstrations from student chaptersworldwide while enjoying refreshments and networking in a casualatmosphere.
Lunch with the Experts - A Student Networking EventMonday13August . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:30to1:30pm
Open to Student Attendees
Enjoy a casual meal with colleagues at this engaging networkingopportunity.Thiseventfeaturesexpertswillingtosharetheirexperienceandwisdomoncareerpaths inopticsandphotonicsandanawardspresentationforNewportSpectra-Physicstravelgrantwinners.Seatingislimitedandwillbegrantedonafirst-come,first-servedbasis.
Sponsored by:
Newport Spectra-Physics Research Excellence Travel AwardsThe Newport Spectra-Physics Research Excellence Travel AwardsProgram provides financial support for university students to attendthetwolargestSPIEmeetingsinordertopresenttheirresearch.ThesetravelgrantsareopentoanystudentwhohasanacceptedpaperforpresentationatPhotonicsWestorOptics+Photonics.Recipientswillbeselectedbasedonboththequalityoftheoriginalresearchdescribedinthesubmittedpaper(s)andfinancialneed. ForapplicationinformationforthisandotherSPIEtravelgrantsvisitScholarshipsandGrantsonlineatspie.org/scholarships
Student Chapter ExhibitsTuesdaytoThursday. . . . . . . . . . . . . . . . . . . . . . . . . .ExhibitionHours
DiscovertheresearchofsomeofthebrightestSPIEstudentgroupsandtheprogramstheyhavedevelopedtoincreasescienceawarenessandliteracyintheirregions.
See us in the Exhibition HallSanDiegoConventionCenter,SanDiego,California,USA
Tuesday 14 August, 10:00 am to 5:00 pmWednesday 15 August, 10:00 am to 5:00 pm
spie.org/opjobfair
JOB FAIRSPIE Optics+Photonics
SponsoredbySPIE Career Center
Meet. Discuss. Impress.
Talkwithrepresentativesfromcompaniescurrentlylookingtohire.Students
Did you know all courses are 50% off for SPIE Student Members? Takeadvantageof your timeatOptics+Photonicsby takingacoursefromexpertswithreal-worldjobexperienceinyourspecificareaofinterest.It’sagreatopportunitytomakeconnectionswithinstructorsandotherattendeeswhileexpandingonyouruniversityeducation.Anddon’tmiss thegreatworkshops that are free toStudentMembersonpages22-23.
Not a member yet? Visit the Student Member page at http://spie.org/x1721.xml. Membership is only $20 and provides you with a wealth of benefits in addition to the course discounts.
22 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Professional Development Events
Professional Skills WorkshopSunday12August . . . . . . . . . . . . . . . . . . . . . . . . 9:00amto12:30pm
Open to all Students and Early Career Professionals.
Joinusforanexcitingpaneldiscussionandbreak-outsessionsfocusingoneducationandprofessionalskillsdevelopment.Comereadytoshareyourthoughtsandideas!
Panel Discussion:
Getting Hired in 2012 and BeyondTuesday14August. . . . . . . . . . . . . . . . . . . . . . . . . . . . 2:30to3:30pm
Learnaboutthecorporatehiringprocessdirectlyfromprofessionalsintheopticsandphotonicssector.
Basic Optics for Non-Optics PersonnelWS609Introductory, CEU .30 $100 / $150 USD, Tuesday 1:30 to 4:00 pmThis course will provide the technical manager, sales engineering,marketing staff, or other non-optics personnel with a basic, non-mathematical introduction to the terms,specifications,andconceptsused in optical technology to facilitate effective communication withopticsprofessionalsonafunctionallevel.Topicstobecoveredincludebasicconceptssuchasimaging,interference,diffraction,polarizationandaberrations,definitionsrelatingtocolorandopticalquality,andanoverviewofthebasicmeasuresofopticalperformancesuchasMTFandwavefronterror.Thematerialwillbepresentedwithaminimalamountof math, rather emphasizing working concepts, definitions, rules ofthumb,andvisualinterpretationofspecifications.Specificapplicationswillincludedefiningbasicimagingneedssuchasmagnification,depth-of-field,andMTFaswellasthedefinitionsofradiometricterms.
LEARNING OUTCOMESThiscoursewillenableyouto:• readopticalsystemdescriptionsandpapers• asktherightquestionsaboutopticalcomponentperformance• describebasicopticalspecificationsforlenses,filters,andother
components• assessdifferencesintypesoffilters,mirrorsandbeamdirecting
optics• knowhowopticsisusedinoureverydaylives
INTENDED AUDIENCEThiscourseisintendedforthenon-opticalprofessionalwhoneedstounderstandbasicopticsandinterfacewithopticsprofessionals.
INSTRUCTORKevin Harding has been active in the optics industry for over 30years, and has taught machine vision and optical methods for over25 years in over 70 workshops and tutorials, including engineeringworkshopsonmachinevision,metrology,NDT,andinterferometryusedby vendors and system houses to train their own engineers. He hasbeenrecognizedforhisleadershipinopticsandmachinevisionbytheSocietyofManufacturingEngineers,AutomatedImagingAssociation,andEngineeringSocietyofDetroit.KevinisaFellowofSPIEandwasthe2008PresidentoftheSociety.Thiscourseisalsoavailableinonlineformat.
Critical Skills for Compelling Research ProposalsWS1058 NEWIntroductory, CEU .35 $75 / $125 USD, Sunday 1:30 to 5:30 pmResearch costs money. The good news is that there are thousandsof avenues of financial support. The bad news is that hundreds ofthousands of proposals are competing for those funds. This classwillteachyoutocrafthigh-qualityproposalsthatstandoutfromthemasses.Wewill focusonfive fundamentalskills thatwillbolster thesubstance,structure,andappearanceofyourproposals.Adheringtothesepracticeswilldramaticallyincreaseyouroddsofwinningfundingforyourresearch.
LEARNING OUTCOMESThiscoursewillenableyouto:• identifyfundingopportunitiesthatalignwithyourresearchgoals• developsolidresearchplansandbelievablebudgets• communicateyourresearchtoageneralaudience• writeinaclear,concise,andcompellingmanner• formatyourproposalforvisualappeal
INTENDED AUDIENCEThis course is intended for all scientists and engineers seeking toimprovethequalityoftheirresearchproposals.
INSTRUCTORDamon Diehl isAssistantProfessorandCoordinatorfortheOpticalSystems Technology program at Monroe Community College inRochester,NYandalsothefounderandownerofDiehlResearchGrantServices.HehasaPh.D.inopticalengineeringfromtheUniversityofRochesterInstituteofOpticsandaB.A.inphysicsfromtheUniversityof Chicago. His class is based on fifteen years of academic andindustrialresearchexperience.ThiscourseisfreetoSPIEStudentMembers,butyoumustregistertoattend.
Resumes to Interviews: Strategies for a Successful Job SearchWS1059 NEWIntroductory, CEU .35 $75 / $125 USD, Tuesday 8:30 am to 12:30 pmThiscoursereviewseffectivestrategiesandtechniquesforasuccessfuljob search such as: compiling resumes, writing cover letters, andinterviewingtips.Theprimarygoalofthecourseistoprovidecreativeandproventechniquesfornewcollegegraduatesandprofessionalstoplanandconducttheirjobsearchandsecureajob.Creativeandcomprehensivejobsearchtechniqueswillbediscussedaswellasactualresumeandinterviewingexamplesandtips.Anyonewho is getting ready to enter the work force who wants to answerquestionssuchas,“whenandhowdoIstartmyjobsearch?,”“whatkindofcoverletterandresumegetsnoticed?”or“howdoIsellmyselfinaninterview?”willbenefitfromtakingthiscourse.
LEARNING OUTCOMESThiscoursewillenableyouto:• startandcreateyourjobsearchplan• createanonlinenetworkingpresence• buildandwriteeffectivecoverlettersandresumesthatgetnoticed• avoidcommonresumeandcoverlettermistakes• interviewwithconfidence
spie.org/opadvance · TEL:+13606763290 · help@spie.org 23
Professional Development Events
INTENDED AUDIENCEGraduate students, new graduates, engineers and technicians whowishtolearnmoreaboutcreatingajobsearchplan,writinganeffectivecover letter and resume that gets you noticed, and techniques forsuccessfulinterviews.
INSTRUCTORSPaige Lawson has been in professional recruiting for more than 20years. She has extensive experience with both in-house corporateenvironmentsaswellasoutsideagency/consultingenvironments.PaigeiscurrentlytheExecutiveRecruiterforExoticElectroOpticsinMurrieta,CA, and a member of the local networking group Professionals inHumanResources(PHIRA).Suzanne Krinsky has been in human resources and corporaterecruiting formore than15years.Shehasextensiveexperiencewithboth in-house corporate environments as well as outside agency/consulting environments. Suzanne is currently the Human ResourceDirectorforDaylightSolutionsinSanDiego,andalsoalong-timeBoardmember for the Biotech Human Resource Development Coalition(BEDC)andHumanResourceRoundtablemember.ThiscourseisfreetoSPIEStudentMembers,butyoumustregistertoattend.
Effective Technical PresentationsWS897Introductory, CEU .35 $75 / $125 USD, Monday 8:30 am to 12:30 pmOralpresentationskillsareakeytosuccessforresearchers.Thiscourseproposesafive-stepmethodologythatwilltakeyoufromscratchtoaneffectivetechnicalpresentation.Italsoofferstipsonhowtomanagethenervousnessassociatedwithspeakinginpublic.
LEARNING OUTCOMESThiscoursewillenableyouto:• planyourpresentationefficiently• organizeyourmaterialintoaneffectivestructure• createslidesthatgetthemessageacross• deliveryourpresentationeffectively,bothverballyandnonverbally• handleeventhemostdifficultquestions
INTENDED AUDIENCEThismaterialisintendedforanyonewhomustprepareanddeliveroralpresentations.Bothnoviceandexperienced speakers canexpect tolearnmuchfromit.
INSTRUCTORJean-luc Doumont runs lectures,workshops,andtrainingprogramsinoral,written,andgraphicalcommunicationforengineers,scientists,and managers worldwide. He is an engineer from the University ofLouvainandadoctorinappliedphysicsfromStanfordUniversity.Thiscourseisbasedonhispopularlectureonoralpresentationsatover15top-rankedengineeringschools(MIT,StanfordU,UCBerkeley,Caltech,Harvard,etc.).ThiscourseisfreetoSPIEStudentMembers,butyoumustregistertoattend.
Effective Scientific PapersWS908Introductory, CEU .35 $75 / $125 USD, Monday 1:30 to 5:30 pmStrongwritingskillsareakeytosuccessforresearchers.Thiscourseproposesamethodologythatwilltakeyoufromscratchtoaneffectivescientific or technical document-a question of structure, not style.Theapproachisapplicableacrosslanguagesandforawiderangeofdocumenttypesbeyondscientificpapers,too.
LEARNING OUTCOMESThiscoursewillenableyouto:• planyourdocumentefficiently• createaneffectiveabstract,introduction,andconclusion• organizeyourmaterialintoanaccessiblestructure• constructparagraphsthatgetthemessageacross• writesentencesthatareeasytoread
INTENDED AUDIENCEThismaterial is intendedforanyonewhomustwriteoredit technicaldocuments ingeneralandscientificpapers inparticular.Bothnoviceandexperiencedwriterscanexpecttolearnmuchfromit.
INSTRUCTORJean-luc Doumontrunslectures,workshops,andtrainingprogramsinoral,written,andgraphicalcommunicationforengineers,scientists,and managers worldwide. He is an engineer from the University ofLouvain and a doctor in applied physics from Stanford University.Thiscourseisbasedonhislecturesandworkshopsonscientificandtechnicalwritingatuniversitiesandresearchcentersaroundtheworld(MIT,Shell,Johnson&Johnson,etc.).ThiscourseisfreetoSPIEStudentMembers,butyoumustregistertoattend.
24 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Make time for the Free Exhibition SPIEOptics+Photonicsshowcasesthenewestproducts,latestinnovations,andcutting-edgetechnologies.
Join these companies! Asof3/30/12companiesinclude:
InfiniteOpticsInc.InradOptics,Inc.InstrumentTechnologyResearchCtr.
IOPPublishingLtd.IsuzuGlass,Inc.JENOPTIKOpticalSystems,Inc.
L-3CommunicationsTinsleyLabs.Inc.
Labsphere,Inc.LakeShoreCryotronics,Inc.
LambdaResearchCorp.
LaserFocusWorldLEONIFiberOptics,Inc.MadCityLabs.,Inc.MaterialsTodayMediVisionOptics
MicroLaserSystems,Inc.
Mildex,Inc.MindrumPrecision,Inc.MinusKTechnologyInc.MOXTEK,Inc.NakedOpticsCorp.NationalAperture,Inc.NationalReconnaissanceOffice
NewportCorp.NittoOpticalCo.,Ltd.NorenProductsInc.OceanOptics,Inc.OceanThinFilms,Inc.OharaCorp.OlympusAmericaInc.OpticalSupport,Inc.optics.org
CarlHanserVerlagGmbH&Co.KG
ChromaTechnologyCorp.
CollegeofOpticalSciences,TheUniv.ofArizona
CRCPressCVIMellesGriotDepositionSciences,Inc.
DiverseOpticsInc.e2ve2vtechnologiesplcEdmundOpticsInc.EDPSciencesElconInc.ElectroOpticsMagazineElementSixTechnologiesU.S.Corp
EnergetiqTechnology,Inc.
Entegris,Inc.EpnerTechnologyInc.Filmetrics,Inc.FlexibleOpticalBV(OKOTech)
FotofabGoodrichCorporationG-SPlasticOpticsHamamatsuCorp.HardinOpticalCo.HeidelbergInstrumentsInc.
HellmaUSA,Inc.HeraeusQuartzAmericaLLC
HindsInstruments,Inc.HitachiHighTechnologiesAmerica,Inc.
4DTechnologyCorp.AbetTechnologies,Inc.AccuCoatInc.AccumoldADITElectronTubesAdlOpticaOpticalSystemsGmbH
Aerotech,Inc.AgilentTechnologies,Inc.
ALIOIndustriesAndoverCorp.ASD,Inc.ASMLOpticsattocubesystemsAGAvantes,Inc.B&WTek,Inc.BoulderNonlinearSystems
CambridgeUniv.Press
See top vendors in: •Opticalcomponents•Detectors,sensorsand
cameras•Lasersandaccessories•Computerhardwareand
software•Imagingequipment•Testandanalysisequipment•Opticalfabricationand
designservices
•Materialsandchemicals•Lenses•Fiberoptics•Electronicsandsignal-
analysisequipment•Displays•Positioningsystems•Vibration-isolation
equipment
More than 240 companies on the floor in 2012
spie.org/opadvance · TEL:+13606763290 · help@spie.org 25
OptiformsOptikosCorp.OptimaxSystems,Inc.OptiProSystemsOptoSigmaCorp.PerkinElmer,Inc.PhotonEngineeringLLCPhotonetc.Inc.PhotonicsMedia/Laurin
PublishingPhotonicsOnlinePhysicsTodayPI(PhysikInstrumente)
L.P.piezosystemjena,Inc.PoggisoftwarePolymicro
Technologies,ASubsidiaryofMolexIncorporated
PrecisionGlass&Optics
PrecisionOpticsGeraCorp.
ProtoLabs,Inc.QioptiqS.A.S.QuartusEngineering
Inc.RPMCLasers,Inc.SandiaNationalLabs.SCHOTTNorth
America,Inc.SEMICOREEquipment,
Inc.SierraPrecisionOpticsSiskiyouCorporationSouthwestResearch
Institute
ThorlabsInc.TRIOPTICSGmbHVincentAssociatesWordinghamT
echnologiesZygoCorporation
SpectralInstruments,Inc.
SpectrogonUS,Inc.SpectroscopyMagazineSPIECareerCenterStellarNet,Inc.SutterInstrumentCo.Synopsys,Inc.Syntronics,LLCTDK-LambdaAmericas
Inc.tec5USA,Inc.TeledyneJudson
TechnologiesThermoFisherScientific
-CIDTECThere is still time to sign up as an exhibitorContactTeresaR@spie.org
Exhibition Hours: Tuesday14August,10:00amto5:00pm
Wednesday15August,10:00amto5:00pm
Thursday16August,10:00amto2:00pm
More than 240 companies on the floor in 2012
26 spie.org/opadvance · TEL:+13606763290 · help@spie.org
NanoScience+ EngineeringSPIEOptics+Photonics
NanoScience8455 Metamaterials: Fundamentals and Applications V
(Boardman/Engheta/Noginov/Zheludev) . . . . . . . . . . . . . . . .27
8456 Nanophotonic Materials IX(Cabrini/Mokari). . . . . . . . . . . .31
8457 Plasmonics: Metallic Nanostructures and Their Optical Properties X(Stockman) . . . . . . . . . . . . . . . . . . . . . . . . . . . .33
8458 Optical Trapping and Optical Micromanipulation IX(Dholakia/Spalding). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .39
8459 Physical Chemistry of Interfaces and Nanomaterials XI (Clark/Silva). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .44
8460 Biosensing and Nanomedicine II(Mohseni/Agahi/Razeghi) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .46
8461 Spintronics V (Drouhin/Wegrowe/Razeghi) . . . . . . . . . . . . . .49
8462 Carbon Nanotubes, Graphene, and Associated Devices V(Pribat/Lee/Razeghi) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .53
NanoEngineering8463 Nanoengineering: Fabrication, Properties, Optics, and
Devices IX(Dobisz/Eldada) . . . . . . . . . . . . . . . . . . . . . . . . . . .55
8464 Nanobiosystems: Processing, Characterization, and Applications V(Kobayashi/Ouchen/Rau) . . . . . . . . . . . . . . .58
8465 Nanostructured Thin Films V(Mackay/Jen/Martín-Palma).61
8466 Instrumentation, Metrology, and Standards for Nanomanufacturing, Optics, and Semiconductors VI (Postek) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .64
8467 Nanoepitaxy: Materials and Devices IV(Kobayashi/Talin/Islam) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .66
8469 Solar Hydrogen and Nanotechnology VII(Tachibana) . . . . . . . . . . . . . . . . .71
8471 Next Generation (Nano) Photonic and Cell Technologies for Solar Energy Conversion III(Tsakalakos) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .75
8519 Nanophotonics and Macrophotonics for Space Environments VI(Taylor/Cardimona) . . . . . . . . . . . . . . . . .185
Symposium Chairs
David L. Andrews,Univ.ofEastAngliaNorwich(UnitedKingdom)
James G. Grote,AirForceResearchLab.(USA)
Symposium Cochairs
Satoshi Kawata,OsakaUniv.(Japan)
Manijeh Razeghi,NorthwesternUniv.(USA)
Nanotechnologyholdsthekeytosolvingmanyglobalissues,especiallyinenergy,manufacturingandmedicine.Thisconferencewilldiscussthelatestresearchintheseimportantareas:
- Metamaterials
- Plasmonics
- CNTs
- Graphene
- Thin Films
- Spintronics
- Nanoengineering
Technical Organizing CommitteeMassoud Agahi, Harbor-UCLAMedicalCtr.andCedars-SinaiMedicalCtr.
(USA)Allan D. Boardman, Univ.ofSalford(UnitedKingdom)Stefano Cabrini,LawrenceBerkeleyNationalLab.(USA)Jenny Clark, Univ.ofCambridge(UnitedKingdom)Kishan Dholakia, Univ.ofSt.Andrews(UnitedKingdom)Elizabeth A. Dobisz, HitachiGlobalStorageTechnologies,Inc.(USA)Henri-Jean M. Drouhin, EcolePolytechnique(France)Louay A. Eldada, Amprius,Inc.(USA)Nader Engheta, Univ.ofPennsylvania(USA)M. Saif Islam, Univ.ofCalifornia,Davis(USA)Yi-Jun Jen, NationalTaipeiUniv.ofTechnology(Taiwan)Nobuhiko P. Kobayashi, Univ.ofCalifornia,SantaCruz(USA)Norihisa Kobayashi, ChibaUniv.(Japan)Young-Hee Lee, SungkyunkwanUniv.(Korea,Republicof)Tom G. Mackay, TheUniv.ofEdinburgh(UnitedKingdom)Raúl J. Martín-Palma, Univ.AutónomadeMadrid(Spain)Hooman Mohseni,NorthwesternUniv.(USA)Taleb Mokari, Ben-GurionUniv.oftheNegev(Israel)Mikhail A. Noginov, NorfolkStateUniv.(USA)Fahima Ouchen, AirForceResearchLab.(USA)Michael T. Postek, NationalInstituteofStandardsandTechnology(USA)Didier Pribat,SungkyunkwanUniv.(Korea,Republicof)Ileana Rau, PolytechnicalUniv.ofBucharest(Romania)Manijeh Razeghi, NorthwesternUniv.(USA)Carlos Silva, Univ.deMontréal(Canada)Gabriel C. Spalding, IllinoisWesleyanUniv.(USA)Mark I. Stockman, GeorgiaStateUniv.(USA)A. Alec Talin, NationalInstituteofStandardsandTechnology(USA)Jean-Eric Wegrowe, EcolePolytechnique(France)Nikolay I. Zheludev,Univ.ofSouthampton(UnitedKingdom)
spie.org/opadvance · TEL:+13606763290 · help@spie.org 27
Conference 8455Sunday-Thursday 12-16 August 2012 • Proceedings of SPIE Vol. 8455
Metamaterials: Fundamentals and Applications VConference Chairs:Allan D. Boardman, Univ.ofSalford(UnitedKingdom);Nader Engheta, Univ.ofPennsylvania(UnitedStates);Mikhail A. Noginov, NorfolkStateUniv.(UnitedStates);Nikolay I. Zheludev, Univ.ofSouthampton(UnitedKingdom)
Program Committee:David L. Andrews, Univ.ofEastAngliaNorwich(UnitedKingdom);Koray Aydin, NorthwesternUniv.(UnitedStates);Rola Aylo, Univ.ofDayton(UnitedStates);Igal Brener, SandiaNationalLabs.(UnitedStates);Larry R. Dalton, Univ.ofWashington(UnitedStates);Ildar R. Gabitov, TheUniv.ofArizona(UnitedStates);Javier García de Abajo, ConsejoSuperiordeInvestigacionesCientíficas(Spain);Satoshi Kawata, OsakaUniv.(Japan);Jacob B. Khurgin, TheJohnsHopkinsUniv.(UnitedStates);Yuri S. Kivshar, TheAustralianNationalUniv.(Australia);Joachim R. Krenn, Karl-Franzens-Univ.Graz(Austria);Akhlesh Lakhtakia, ThePennsylvaniaStateUniv.(UnitedStates);Ulf Leonhardt, Univ.ofSt.Andrews(UnitedKingdom);Natalia M. Litchinitser, Univ.atBuffalo(UnitedStates);Martin W. McCall, ImperialCollegeLondon(UnitedKingdom);Martin Moskovits, APINanotronicsCorp.(UnitedStates)andUniv.ofCalifornia,SantaBarbara(UnitedStates);Evgenii E. Narimanov, PurdueUniv.(UnitedStates);Vladimir M. Shalaev, PurdueUniv.(UnitedStates);Gennady B. Shvets, TheUniv.ofTexasatAustin(UnitedStates);David R. Smith, DukeUniv.(UnitedStates);Costas M. Soukoulis, IowaStateUniv.(UnitedStates);Mark I. Stockman, GeorgiaStateUniv.(UnitedStates);Sergei Tretyakov, AaltoUniv.SchoolofScienceandTechnology(Finland);Din Ping Tsai, NationalTaiwanUniv.(Taiwan);Augustine M. Urbas, AirForceResearchLab.(UnitedStates);Martin Wegener, KarlsruherInstitutfürTechnologie(Germany)
Sunday 12 AugustOpening Remarks . . . . . . . . . . . . . . . . . . Sun. 8:30 to 8:35 am
Session Chair: Mikhail A. Noginov, NorfolkStateUniv.(UnitedStates)
SESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 8:35 to 10:15 am
NanoantennasQuantitative measurement of scattering and absorption cross sections of individual metal nano-antennas (Keynote Paper),MartinWegener,MartinHusnik,RichardDiehl,JensNiegemann,KarlsruherInstitutfürTechnologie(Germany);KurtBusch,Humboldt-Univ.zuBerlin(Germany);StefanLinden,RheinischeFriedrich-Wilhelms-Univ.Bonn(Germany). . . . . . . . . . . . . [8455-01]
Plasmonic nanoantennas and their applications (Invited Paper),ErtugrulCubukcu,Univ.ofPennsylvania(UnitedStates). . . . . . . . . . . . . . . . . . [8455-02]
Luminescence in the array of plasmonic nanoantennas,AndreyK.Sarychev,InstituteforTheoreticalandAppliedElectrodynamics(RussianFederation);IlyaA.Fyodorov,MoscowInstituteofPhysicsandTechnology(RussianFederation);AndreyN.Lagarkov,InstituteforTheoreticalandAppliedElectrodynamics(RussianFederation);GenaTartakovsky,DelMarPhotonics,Inc.(UnitedStates);AlexeiBogdanov,HitachiGlobalStorageTechnologies,Inc.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-03]
Spectral properties of V- and Y-shaped plasmonic antennas with widely tailorable amplitude and phase control for birefringent surface optics,MikhailA.Kats,HarvardSchoolofEngineeringandAppliedSciences(UnitedStates);PatriceGenevet,HarvardSchoolofEngineeringandAppliedSciences(UnitedStates)andTexasA&MUniv.(UnitedStates);NanfangYu,HarvardSchoolofEngineeringandAppliedSciences(UnitedStates);GuillaumeAoust,HarvardSchoolofEngineeringandAppliedSciences(UnitedStates)andEcolePolytechnique(France);RomainBlanchard,HarvardSchoolofEngineeringandAppliedSciences(UnitedStates);FrancescoAieta,HarvardSchoolofEngineeringandAppliedSciences(UnitedStates)andUniv.PolitecnicadelleMarche(Italy);ZenoGaburro,HarvardSchoolofEngineeringandAppliedSciences(UnitedStates)andUniv.degliStudidiTrento(Italy);FedericoCapasso,HarvardSchoolofEngineeringandAppliedSciences(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-04]
SESSION 2 . . . . . . . . . . . . . . . . . . . . . . . . Sun. 10:45 to 11:55 am
Hyperbolic Metamaterials IThermal hyper-conductivity: beyond Stefan-Boltzmann law (Invited Paper),EvgeniiE.Narimanov,PurdueUniv.(UnitedStates);IgorI.Smolyaninov,Univ.ofMaryland,CollegePark(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . [8455-05]
Control of reflectance and transmittance in hyperbolic metamaterials with scatterers and curvilinear geometries,ThejaswiU.Tumkur,JohnK.Kitur,LeiGu,NorfolkStateUniv.(UnitedStates);BrennanChu,CornellUniv.(UnitedStates);Evgeniie.Narimanov,PurdueUniv.(UnitedStates);MikhailA.Noginov,NorfolkStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-06]
Single photon resonance cone in hyperbolic metamaterials,WardD.Newman,ZubinJacob,Univ.ofAlberta(Canada) . . . . . . . . . . . . . . . . [8455-07]
Modeling of the optical properties of periodic arrays of metal-coated Si nanopillars,RonaldRendell,U.S.NavalResearchLab.(UnitedStates);OrestJ.Glembocki,JamesP.Long,U.S.NavalResearchLab.(UnitedStates);JunpengGao,TheUniv.ofAlabamainHuntsville(UnitedStates);JoshuaD.Caldwell,U.S.NavalResearchLab.(UnitedStates);FranciscoJ.Bezares,AmericanSocietyforEngineeringEducation(UnitedStates). . . . . . . . . . . . . . . . [8455-08]
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11:55amto1:20pm
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 1:20 to 3:15 pm
Nonlinear Metamaterials IMetadevices (Keynote Paper),NikolayI.Zheludev,OptoelectronicsResearchCtr.(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-09]
Nonlocal and nonlinear optical plasmonic metamaterials (Invited Paper),DavidR.Smith,CristianCiracì,AntoineMoreau,DukeUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-10]
Nonlinear and active RF metamaterial applications using embedded devices,AlexanderR.Katko,AllenM.Hawkes,StevenA.Cummer,DukeUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-11]
Variable focus nonlinear lens via transformation optics,ApraPandey,NataliaM.Litchinitser,Univ.atBuffalo(UnitedStates)................... [8455-12]
Nonlinear response of high-temperature superconducting terahertz metamaterials,NathanielK.Grady,LosAlamosNationalLab.(UnitedStates);BradfordG.Perkins,Jr.,HaroldY.Hwang,MassachusettsInstituteofTechnology(UnitedStates);RanjanSingh,HaoYang,JieXiong,LiYan,QuanxiJia,AntoinetteJ.Taylor,LosAlamosNationalLab.(UnitedStates);KeithA.Nelson,MassachusettsInstituteofTechnology(UnitedStates);Hou-TongChen,LosAlamosNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . [8455-13]
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 3:45 to 6:00 pm
Plasmonic Metamaterials IPlasmonic and semiconductor building blocks for metadevices (Invited Paper),MarkL.Brongersma,StanfordUniv.(UnitedStates). . . . . . . . [8455-14]
Plasmon-induced transparency and plasmonic toroidal lasing spaser in three-dimensional metamaterials (Invited Paper),DinPingTsai,WeiTingChen,PinChiehWu,ChihTingHsiao,Kuang-YuYang,Yao-WeiHuang,ChunYenLiao,NationalTaiwanUniv.(Taiwan);VassiliA.Fedotov,VassiliSavinov,NikolayI.Zheludev,OptoelectronicsResearchCtr.(UnitedKingdom) [8455-15]
Various approaches to loss mitigation in nanoplasmonics and their limitations (Invited Paper),JacobB.Khurgin,JohnsHopkinsUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-16]
Plasmon excitation between adjoining metal nanorods: field enhancement and optical sensing,AndreyK.Sarychev,InstituteforTheoreticalandAppliedElectrodynamics(RussianFederation);AndreyIvanov,AlexanderShalygin,LomonosovMoscowStateUniv.(RussianFederation);PetrVorobev,SergeyVergiles,L.D.LandauInstituteforTheoreticalPhysics(RussianFederation) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-17]
28 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Probing plasmonic and dielectric resonances within periodic and random arrays of Ag- and Au-coated Si nanopillars,JoshuaD.Caldwell,FranciscoJ.Bezares,JamesP.Long,OrestJ.Glembocki,RonaldW.Rendell,SharkaM.Prokes,ErinCleveland,HaydenChun,U.S.NavalResearchLab.(UnitedStates);RichardKasica,NationalInstituteofStandardsandTechnology(UnitedStates);LorettaShirey,U.S.NavalResearchLab.(Afghanistan). . . . . . . . . . . . [8455-18]
Local density of states in lossy plasmonic nanostructures,YaroslavA.Urzhumov,DavidR.Smith,DukeUniv.(UnitedStates). . . . . . . . . . . . [8455-19]
Surface-plasmon holography with white light illumination,MiyuOzaki,RIKEN(Japan)andTokyoDenkiUniv.(Japan);Jun-ichiKato,RIKEN(Japan);SatoshiKawata,RIKEN(Japan)andOsakaUniv.(Japan). . . . . . . . . . . . . . . . . [8455-20]
Symposium-Wide Plenary Session . . . . . . . . . . . . . . . . . . . . Sun. 6:00 to 7:25 pm6:00pm: Introduction and Opening Remarks
6:05pm: The Exciting Science of Light with Metamaterials, VladimirM.Shalaev,PurdueUniv.(USA)
6:45pm:Future of Optics and Photonics, BahaaE.A.Saleh,CREOL,TheCollegeofOpitcsandPhotonicsattheUniv.ofCentralFlorida(USA)
Monday 13 AugustNanoScience + Engineering Plenary Session . . . . . . . . . . . . . . . Mon. 8:30 am to 12:00 pm
Session Chairs:Satoshi Kawata,OsakaUniv.(Japan)and Manijeh Razeghi, NorthwesternUniv.(USA)
8:30am:The Light and Sound Fantastic: Radiation Pressure at the Nanoscale, OskarPainter,CaliforniaInstituteofTechnology(USA)
9:15am:Organics and Nanostructures for Nonlinear Optics, NasserPeyghambarian,CollegeofOpticalSciences,TheUniv.ofArizona(USA)
CoffeeBreak . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10:00to10:30am
10:30am:From Nanophotonics, to Metaphotonics, to Dynamic Photonics: Controlling Light Propagation and Light-Matter Interactions for Emerging Technologies, ParasPrasad,Univ.atBuffalo(USA)
11:15am:Global Activities in Novel-Nano Magnetic Materials for Magnetic, Optoelectronics Applications,MisoonMah,AsianOfficeofAerospaceDevelopment(Japan)
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:00to1:30pm
SESSION 5 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 1:30 to 2:55 pm
Hyperbolic Metamaterials IIOptical properties of hyperbolic metamaterial interfaces (Invited Paper),IgorI.Smolyaninov,BAESystems(UnitedStates) . . . . . . . . . . . . . . . . . . . [8455-21]
Enhancing absorption using metamaterials with hyperbolic dispersion,ThejaswiU.Tumkur,LeiGu,JohnK.Kitur,NorfolkStateUniv.(UnitedStates);EvgeniiE.Narimanov,PurdueUniv.(UnitedStates);MikhailA.Noginov,NorfolkStateUniv.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-22]
Coupling nitrogen vacancy centers in diamond to hyperbolic metamaterials,SamanJahani,ZubinJacob,Univ.ofAlberta(Canada). . . . . . . . . . . . [8455-23]
Giant photonic lamb shift in hyperbolic metamaterials,CristianCortes,ZubinJacob,Univ.ofAlberta(Canada) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-24]
Effects of nonlocal response on the density of states of hyperbolic metamaterials,WeiYan,NielsA.Mortensen,MartijnWubs,TechnicalUniv.ofDenmark(Denmark). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-25]
SESSION 6 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 3:25 to 5:40 pm
Novel Trends and ConceptsControlling electromagnetic fields with phase discontinuities (Invited Paper),PatriceGenevet,NanfangYu,MikhailA.Kats,FrancescoAieta,ZenoGaburro,FedericoCapasso,HarvardSchoolofEngineeringandAppliedSciences(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-26]
Electron energy loss spectroscopy on photonic metamaterials (Invited Paper),StefanLinden,FelixvonCube,RheinischeFriedrich-Wilhelms-Univ.Bonn(Germany);StephanH.Irsen,Ctr.ofAdvancedEuropeanStudiesandResearch(Germany). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-27]
Symmetry breaking and negative coupling leads to optical negative index of closed rings (Invited Paper),BoubacarKante,YongshikPark,DanielShuldman,NorbertoD.Lanzillotti,ZiJingWong,XiaoboYin,XiangZhang,Univ.ofCalifornia,Berkeley(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . [8455-28]
Metamaterial thermal antenna,SeanMolesky,ZubinJacob,Univ.ofAlberta(Canada) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-29]
Casimir force reversal using metamaterials,VenkateshK.Pappakrishnan,PattabhirajuC.Mundru,DentchoA.Genov,LouisianaTechUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-30]
Radiation pressure and photon momentum in negative-index media,MasudMansuripur,CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates);ArmisR.Zakharian,CorningIncorporated(UnitedStates). . . . . . . . . . [8455-31]
The trouble with the Lorentz law of force,MasudMansuripur,CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates) . . . . . . . . . . . . [8455-32]
Tuesday 14 AugustSESSION 7 . . . . . . . . . . . . . . . . . . . . . . . . Tues. 8:00 to 10:05 am
Making MetamaterialsRealization of metamaterial structures by non-lithographic processes (Invited Paper),AlbertoPiqué,NicholasA.Charipar,HeungsooKim,MatthewA.Kirleis,ScottA.Mathews,U.S.NavalResearchLab.(UnitedStates). . . . . [8455-33]
All dielectric optical metamaterials (Invited Paper),JasonG.Valentine,JoyGarnett,ParikshitMoitra,VanderbiltUniv.(UnitedStates). . . . . . . . . . [8455-34]
3D plasmonic and metamaterial structures,DavidB.Burckel,SandiaNationalLabs.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-35]
Natural metamaterials: volume plasmons in manganites with nanoscale phase separation,AndreyK.Sarychev,InstituteforTheoreticalandAppliedElectrodynamics(RussianFederation);SergeyO.Boyarintsev,InstituteforTheoreticalandAppliedElectromagnetics(RussianFederation)andMoscowInstituteofPhysicsandTechnology(RussianFederation);AndreyL.Rakhmanov,KlimentI.Kugel,InstituteforTheoreticalandAppliedElectromagnetics(RussianFederation);YuriyP.Sukhorukov,InstituteofMetalPhysics(RussianFederation) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-36]
Observation of spoof-like field enhancements in Ag thin films deposited by plasma enhanced ALD,SharkaM.Prokes,OrestJ.Glembocki,U.S.NavalResearchLab.(UnitedStates);ErinCleveland,AmericanSocietyforEngineeringEducation(UnitedStates);JoshuaD.Caldwell,EdwardE.Foos,U.S.NavalResearchLab.(UnitedStates);JaakkoNiinistö,MikkoRitala,Univ.ofHelsinki(Finland). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-37]
Atomic layer deposition silver: a natural metamaterial?,OrestJ.Glembocki,SharkaM.Prokes,U.S.NavalResearchLab.(UnitedStates);ErinCleveland,U.S.NavalResearchLab(UnitedStates);RonaldW.Rendell,JoshuaD.Caldwell,EdwardE.Foos,U.S.NavalResearchLab.(UnitedStates);JaakkoNiinistö,MikkoRitala,Univ.ofHelsinki(Finland) . . . . . . . . . . . . . . . . . [8455-38]
Three-dimensional optical metamaterials made by self-assembly,FuMinHuang,SilviaVignolini,Univ.ofCambridge(UnitedKingdom);JatinSinha,Univ.ofSouthampton(UnitedKingdom);UllrichSteiner,Univ.ofCambridge(UnitedKingdom);PhilipN.Bartlett,Univ.ofSouthampton(UnitedKingdom);JeremyJ.Baumberg,Univ.ofCambridge(UnitedKingdom). . . . . . . . . . . . . . . . [8455-39]
SESSION 8 . . . . . . . . . . . . . . . . . . . . Tues. 10:35 am to 12:15 pm
Magnetic MetamaterialsAtomic probes for optical magnetic fields: natural magnetic emitters from the UV to the near IR (Invited Paper),RashidZia,BrownUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-40]
Modification of electric and magnetic dipole emission in anisotropic plasmonic systems,NataliaNoginova,RabiaHussain,MikhailA.Noginov,NorfolkStateUniv.(UnitedStates);JarrettVella,AugustineM.Urbas,AirForceResearchLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-41]
Experimental demonstration of magnetic response of silicon nanoparticles at visible frequencies,ArseniyI.Kuznetsov,A*STAR-DataStorageInstitute(Singapore);AndreyE.Miroshnichenko,TheAustralianNationalUniv.(Australia);YuanHsingFu,JingBoZhang,BorisS.Luk’yanchuk,A*STAR-DataStorageInstitute(Singapore) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-42]
Experimental evidence for natural homogeneous magnetic semiconductor with negative refractive index,Adil-GeraiKussow,AlkimAkyurtlu,YassineAitElAoud,Univ.ofMassachusettsLowell(UnitedStates) . . . . . . . . . . . [8455-43]
Conference 8455
spie.org/opadvance · TEL:+13606763290 · help@spie.org 29
Bottom-up metamaterials with an isotropic magnetic response in the visible,StefanMühlig,Friedrich-Schiller-Univ.Jena(Germany);JoséDintinger,EcolePolytechniqueFédéraledeLausanne(Switzerland);AlastairCunningham,Univ.ofGeneva(Switzerland);ToralfScharf,EcolePolytechniqueFédéraledeLausanne(Switzerland);ThomasBürgi,Univ.ofGeneva(Switzerland);CarstenRockstuhl,FalkL.Lederer,Friedrich-Schiller-Univ.Jena(Germany). . [8455-44]
The two-photon interference mediated by the magnetic resonances in optical metamaterials,ShumingWang,NanjingUniv.(China) . . . . . [8455-45]
Lunch/Exhibition Break.............................. 12:15to1:45pm
SESSION 9 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 1:45 to 3:20 pm
Metamaterials, Lenses, and FocusingControlling transmission, dispersion, and focusing of light using periodic and semi-periodic metamaterials (Invited Paper),UrielLevy,IlyaGoykhman,BorisDesiatov,AvnerYanai,MeirGrajower,TheHebrewUniv.ofJerusalem(Israel) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-46]
Diffraction and sub-diffraction optics of planar metal lenses (Invited Paper),AlexanderV.Kildishev,SatoshiIshii,XingjieNi,VladimirM.Shalaev,VladimirP.Drachev,PurdueUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . [8455-47]
Super-resolution for a point source using positive refraction,JuanCarlosMiñano,PabloBenitez,JuanCarlosGonzález,DejanGrabovickic,HamedAhmadpanahi,Univ.PolitécnicadeMadrid(Spain) . . . . . . . . . . . . . . . [8455-48]
Three-dimensional terahertz Luneburg lens,FanZhou,NorthwesternUniv.(UnitedStates);WeiCao,WeiliZhang,OklahomaStateUniv.(UnitedStates);ChengSun,NorthwesternUniv.(UnitedStates). . . . . . . . . . . . . . . . . . [8455-49]
Acoustic resonators for far-field control of sound on a subwavelength scale,FabriceLemoult,MathiasFink,GeoffroyLerosey,EcoleSupérieuredePhysiqueetdeChimieIndustrielles(France) . . . . . . . . . . . . . . . . . . . . [8455-50]
SESSION 10 . . . . . . . . . . . . . . . . . . . . . . . . Tues. 3:50 to 5:05 pm
NIMs, Cloaks, and Transformation OpticsSymmetry/parity of ring-resonators and optical isotropy of metamaterials,BoubacarKante,KevinO’Brien,AviNiv,XiaoboYin,XiangZhang,Univ.ofCalifornia,Berkeley(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-51]
A non-magnetic invisibility cloak in air,BoubacarKante,DylanGermain,AndrédeLustrac,Institutd’ÉlectroniqueFondamentale(France). . . . [8455-52]
An innovative cloak enables arbitrary objects hidden with visions and movements,Tsung-YuHuang,Ta-JenYen,NationalTsingHuaUniv.(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-53]
Optical zero index metamaterials for transformation optics applications,SeokhoYun,LanLin,ZhiHaoJiang,DingMa,ZhiwenLiu,DouglasH.Werner,TheresaS.Mayer,ThePennsylvaniaStateUniv.(UnitedStates). . . . . [8455-54]
Hybrid metal/semiconductor nanostructures for optoelectronics,PengyuFan,StanfordUniv.(UnitedStates);UdayK.Chettiar,NaderEngheta,Univ.ofPennsylvania(UnitedStates);MarkL.Brongersma,StanfordUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-55]
Wednesday 15 AugustSESSION 11 . . . . . . . . . . . . . . . . . . . . . . . .Wed. 8:00 to 10:05 am
Metamaterial AbsorbersComplete optical absorption in graphene (Invited Paper),SukosinThongrattanasiri,ConsejoSuperiordeInvestigacionesCientíficas(Spain);FrankH.L.Koppens,ICFO-InstitutdeCiènciesFotòniques(Spain);JavierF.GarcíadeAbajo,ConsejoSuperiordeInvestigacionesCientíficas(Spain). . . [8455-56]
Electromagnetically induced absorption in metamaterials (Invited Paper),PhilippeTassin,LeiZhang,AdityaJain,RongkuoZhao,ThomasKoschny,CostasM.Soukoulis,AmesLab.(UnitedStates). . . . . . . . . . . . . . . . . [8455-57]
Isotropic and anisotropic continuous index photon traps based on composite optical materials,DentchoA.Genov,LouisianaTechUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-58]
Light absorption enhancement using resonant dielectric structures for photovoltaics,JonathanGrandidier,RaymondA.Weitekamp,ColtonBukowsky,CaliforniaInstituteofTechnology(UnitedStates);AgustinMihi,Univ.ofIllinoisatUrbana-Champaign(UnitedStates);MichaelG.Deceglie,DennisM.Callahan,CaliforniaInstituteofTechnology(UnitedStates);PaulV.Braun,Univ.ofIllinoisatUrbana-Champaign(UnitedStates);RobertH.Grubbs,HarryA.Atwater,CaliforniaInstituteofTechnology(UnitedStates). . . . . . . . . . [8455-59]
Wideband perfect light absorber and identification of the absorption mechanism,JoshuaR.Hendrickson,AirForceResearchLab.(UnitedStates);BoyangZhang,JunpengGuo,TheUniv.ofAlabamainHuntsville(UnitedStates);WalterBuchwald,SolidStateScientificCorp.(UnitedStates);RichardSoref,UniversityofMassachusettsBoston(UnitedStates) . . . . . . . . . . . . . . [8455-60]
Dynamic metamaterial electromagnetic wave absorbers,WillieJ.Padilla,BostonCollege(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-61]
Plamonic metamaterials as designable perfect absorber at visible frequencies,Hung-YingChen,Chun-YuanWang,Meng-HsienLin,NationalTsingHuaUniv.(Taiwan);UdayK.Chettiar,NaderEngheta,Univ.ofPennsylvania(UnitedStates);ShangjrGwo,NationalTsingHuaUniv.(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-62]
SESSION 12 . . . . . . . . . . . . . . . . . . . . . . .Wed. 10:35 to 11:50 am
Gain and Stimulated EmissionAmplification and spasing (Invited Paper),MarkI.Stockman,GeorgiaStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-63]
Amplification and lasing in nanoplasmonic metamaterials (Invited Paper),SebastianWuestner,AndreasPusch,JoachimM.Hamm,KosmasL.Tsakmakidis,OrtwinHess,ImperialCollegeLondon(UnitedKingdom)[8455-64]
Bringing gain in metamaterials (Invited Paper),CostasM.Soukoulis,IowaStateUniv.(UnitedStates)andFoundationforResearchandTechnology-Hellas(Greece). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-65]
Lunch/Exhibition Break........................... 11:50amto1:20pm
SESSION 13 . . . . . . . . . . . . . . . . . . . . . . . . Wed. 1:20 to 3:10 pm
Chirality and VortixesChiral and multifunctional metamaterials (Invited Paper),ThierryVerbiest,KatholiekeUniv.Leuven(Belgium). . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-66]
A transparent, polarization-independent, ultrathin, and chiral 90 degrees polarization rotator using electromagnetic wave tunneling,MehmetMutlu,EkmelOzbay,BilkentUniv.(Turkey). . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-67]
Demonstration of diode-like asymmetric transmission of linearly polarized waves in a chiral structure supported by electromagnetic tunneling,MehmetMutlu,AhmetEminAkosman,BilkentUniv.(Turkey);AndriyE.Serebryannikov,TechnischeUniv.Hamburg-Harburg(Germany);EkmelOzbay,BilkentUniv.(Turkey). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-68]
Time-resolved pump-probe measurement of polarization rotation in nano-structured chiral metamaterial,Jae-HeunWoo,Hae-youngShin,MinjiGwon,EwhaWomansUniv.(Korea,Republicof);MirceaVomir,MarieBarthelemy,InstitutdePhysiqueetChimiedesMatériauxdeStrasbourg(France);Dong-WookKim,SeokhyunYoon,EwhaWomansUniv.(Korea,Republicof);Jean-YvesBigot,InstitutdePhysiqueetChimiedesMatériauxdeStrasbourg(France);Jeong-WeonWu,EwhaWomansUniv.(Korea,Republicof). . . . . . . . [8455-69]
Unconventional light in unconventional materials (Invited Paper),NataliaM.Litchinitser,ApraPandey,JinweiZeng,XiWang,StevenShipsey,AlexanderN.Cartwright,Univ.atBuffalo(UnitedStates) . . . . . . . . . . . . . . . . . . . . . [8455-70]
Optical vortices in metamaterials,JinweiZeng,ApraPandey,XiWang,StevenShipsey,AlexanderN.Cartwright,NataliaM.Litchinitser,Univ.atBuffalo(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-71]
SESSION 14 . . . . . . . . . . . . . . . . . . . . . . . . Wed. 3:40 to 5:20 pm
Theory and ModelingMetamaterials can suppress Anderson localization of light in one-dimension (Invited Paper),FelipeA.deAraújoPinheiro,Univ.FederaldoRiodeJaneiro(Brazil);DmitriMogilevtsev,B.I.StepanovInstituteofPhysics(Belarus);RaimundoR.dosSantos,Univ.FederaldoRiodeJaneiro(Brazil);SolangeB.Cavalcanti,Univ.FederaldeAlagoas(Brazil);LuizE.M.Oliveira,Univ.EstadualdeCampinas(Brazil). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-72]
Dispersion in media containing resonant inclusions: where does it come from?,FabriceLemoult,MathiasFink,GeoffroyLerosey,EcoleSupérieuredePhysiqueetdeChimieIndustrielles(France) . . . . . . . . . . . . . . . . . . . . [8455-73]
Anderson localization effects via the invariant measure for discretely disordered negative and positive index structures,GlenJ.Kissel,Univ.ofSouthernIndiana(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-74]
Anisotropic spatial harmonic analysis,XingjieNi,AlexanderV.Kildishev,PurdueUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-75]
Conference 8455
30 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Optical functions of nanocrystalline ZnO containing voids,AlexanderV.Gavrilenko,KrishnaveniDondapati,VladimirI.Gavrilenko,NorfolkStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-76]
Generalized Fresnel coefficients of anomalous reflection and refraction from metainterfaces,ZenoGaburro,HarvardSchoolofEngineeringandAppliedSciences(UnitedStates)andUniv.degliStudidiTrento(Italy);FedericoCapasso,HarvardSchoolofEngineeringandAppliedSciences(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-77]
Posters-Wednesday . . . . . . . . . . . . . . . . . Wed. 5:30 to 7:30 pmConference attendees are invited to attend the poster session on Wednesday evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
Interaction of Tm3+ ions electronic excitations with low frequency acoustic phonons in crystal KTm(MoO 4) 2,SergeyPoperezhai,VladimirKut’ko,InstituteforLowTemperaturePhysicsandEngineering(Ukraine);DmytroKamenskyi,ForschungszentrumRossendorf(Germany). . . . . . . . . . . . . . . . . . . . . [8455-99]
Thermal analysis of energetic materials,HuishengZhou,AnhuiUniv.ofScienceandTechnology(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-100]
The invariant measure for Anderson localized negative index metamaterials continuously disordered,GlenJ.Kissel,AaronWilliams,Univ.ofSouthernIndiana(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-101]
Magnetic nanoparticles for tunable microwave metamaterials,NataliaNoginova,NorfolkStateUniv.(UnitedStates)andCornellUniv.(UnitedStates);QuincyWilliams,NorfolkStateUniv.(UnitedStates);PanagiotisDallas,EmmanuelP.Giannelis,CornellUniv.(UnitedStates) . . . . . . . . . . . . [8455-103]
Nonlinear cloaking at microwave frequencies,MikhailK.Khodzitskiy,EgorSedykh,EgorGurvitz,NationalResearchUniv.ofInformationTechnologies,MechanicsandOptics(RussianFederation). . . . . . . . . . . . . . . . . . . . [8455-104]
Thursday 16 AugustSESSION 15 . . . . . . . . . . . . . . . . . . . . . . Thurs. 8:00 to 10:15 am
Plasmonic Metamaterials IIDirect assembly of 3D metamaterials and plasmonics at nm and sub-nm regimes (Invited Paper),JeremyJ.Baumberg,FuMinHuang,SilviaVignolini,RichardTaylor,MatthewMillyard,MatthewHawkeye,Univ.ofCambridge(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-78]
Strongly coupled nanorod arrays: a multifaceted plasmonic metamaterial (Invited Paper),WayneDickson,GregoryA.Wurtz,AnatolyV.Zayats,King’sCollegeLondon(UnitedKingdom) . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-79]
Plasmonic metamaterials: beyond noble metals (Invited Paper),AlexandraBoltasseva,PurdueUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . [8455-80]
Controlling light with a plasmonic meta-surface,XingjieNi,NareshK.Emani,AlexanderV.Kildishev,AlexandraBoltasseva,VladimirM.Shalaev,PurdueUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-81]
Plasmon induced transparency in cascaded π-shaped structures,ArifEnginÇetin,AlpA.Artar,MustafaTurkmen,AhmetA.Yanik,HaticeAltug,BostonUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-82]
Metal, concentric, gradient, indexed, dielectric metamaterials: plasmonic Roche limit in metal-dielectric-metal structure and plasmonic microdisk resonator filter/coupler,Yung-ChiangLan,BoHanCheng,Ruei-ChengShiu,NationalChengKungUniv.(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-83]
Engineering dispersion in omnidirectional single-layer plasmonic metamaterials at visible frequencies,StanleyP.Burgos,RyanBriggs,HarryA.Atwater,CaliforniaInstituteofTechnology(UnitedStates). . . . . . . . . . [8455-84]
SESSION 16 . . . . . . . . . . . . . . . . . . Thurs. 10:45 am to 12:15 pm
Applications of MetamaterialsMetamaterial based biosensors and photodetectors (Invited Paper),EkmelOzbay,BilkentUniv.(Turkey) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-85]
Applied metamaterials: functional metaphotonic devices for energy and sensing (Invited Paper),KorayAydin,NorthwesternUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-86]
Applied metamaterials (Invited Paper),AugustineM.Urbas,AirForceResearchLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-87]
Photothermal studies on infrared plasmonic metamaterials for biosensing using a tunable quantum cascade laser,AlketMertiri,RonenAdato,MiKyungHong,HaticeAltug,ShyamsunderErramilli,BostonUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-88]
Lunch/Exhibition Break.............................. 12:15to1:30pm
SESSION 17 . . . . . . . . . . . . . . . . . . . . . . . Thurs. 1:30 to 3:05 pm
Nonlinear Metamaterials IITunable and nonlinear metamaterials based on liquid crystals (Invited Paper),DragomirN.Neshev,TheAustralianNationalUniv.(Australia) [8455-89]
Nonlocal optical phenomena in metamaterials (Invited Paper),ViktorA.Podolskiy,BrianWells,Univ.ofMassachusettsLowell(UnitedStates);GregoryA.Wurtz,King’sCollegeLondon(UnitedKingdom);RobertJ.Pollard,WilliamHendren,Queen’sUniv.Belfast(UnitedKingdom);GaryP.Wiederrecht,DavidGosztola,ArgonneNationalLab.(UnitedStates);AnatolyV.Zayats,King’sCollegeLondon(UnitedKingdom) . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-90]
Active nonlinear metamaterials loaded with negative differential resistance elements and circuits,JohnP.BarrettIII,StevenA.Cummer,DukeUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-91]
Nonlinear imaging with four-wave mixing: image enhancement and non-reciprocal possibilities,EkaterinaPoutrina,CristianCiracì,DavidR.Smith,DukeUniv.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-92]
Tailoring optical nonlinearities of metamaterials by means of symmetric and antisymmetric modes,MaximR.Shcherbakov,LomonosovMoscowStateUniv.(RussianFederation);JörgReinhold,ArkadiChipouline,ChristianHelgert,ThomasPertsch,Friedrich-Schiller-Univ.Jena(Germany);AndreyA.Fedyanin,LomonosovMoscowStateUniv.(RussianFederation) . . . . . . . . . . . . [8455-93]
SESSION 18 . . . . . . . . . . . . . . . . . . . . . . . Thurs. 3:35 to 5:20 pm
Active and Tunable MetamaterialsElectronically switchable terahertz metamaterial devices (Invited Paper),KimReichel,NicholasKarl,WaiLamChan,DanielM.Mittleman,RiceUniv.(UnitedStates);Hou-TongChen,AntoinetteJ.Taylor,TheCtr.forIntegratedNanotechnologies(UnitedStates);IgalBrener,MichaelJ.Cich,SandiaNationalLabs.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-94]
Active negative index metamaterial powered by an electron beam (Invited Paper),GennadyB.Shvets,SimeonTrendafilov,AndreaAlù,TheUniv.ofTexasatAustin(UnitedStates);MichaelA.Shapiro,RichardJ.Temkin,PlasmaScienceandFusionCtr.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8455-95]
Electrical tuning of mid-infrared metamaterials based on semiconductor device structures (Invited Paper),YoungChulJun,JohnL.Reno,EricA.Shaner,IgalBrener,SandiaNationalLabs.(UnitedStates). . . . . . . . . [8455-96]
Reconfigurable gradient index using VO 2 memory metamaterials,MichaelD.Goldflam,Univ.ofCalifornia,SanDiego(UnitedStates);TomDriscoll,Univ.ofCalifornia,SanDiego(UnitedStates)andDukeUniv.(UnitedStates);BrianChapler,OmarKhatib,Univ.ofCalifornia,SanDiego(UnitedStates);NanM.Jokerst,SabarniPalit,DavidR.Smith,DukeUniv.(UnitedStates);Bong-JunKim,ElectronicsandTelecommunicationsResearchInstitute(Korea,Republicof);GiwanSeo,Univ.ofScienceandTechnology(Korea,Republicof);HyunTakKim,ElectronicsandTelecommunicationsResearchInstitute(Korea,Republicof)andUniv.ofScienceandTechnology(Korea,Republicof);MassimilianoDiVentra,DimitriN.Basov,Univ.ofCalifornia,SanDiego(UnitedStates)[8455-97]
Tunable quantum metamaterials,RuzanSokhoyan,HarryA.Atwater,CaliforniaInstituteofTechnology(UnitedStates). . . . . . . . . . . . . . . . . [8455-98]
Closing Remarks . . . . . . . . . . . . . . . . . . . Thurs. 5:20 to 5:25 pm
Session Chair: Mikhail A. Noginov, NorfolkStateUniv.(UnitedStates)
Conference 8455
spie.org/opadvance · TEL:+13606763290 · help@spie.org 31
Conference 8456Wednesday-Thursday 15-16 August 2012 • Proceedings of SPIE Vol. 8456
Nanophotonic Materials IXConference Chairs:Stefano Cabrini, LawrenceBerkeleyNationalLab.(UnitedStates);Taleb Mokari, Ben-GurionUniv.oftheNegev(Israel)
Program Committee:David L. Andrews, Univ.ofEastAngliaNorwich(UnitedKingdom);Angus J. Bain, Univ.CollegeLondon(UnitedKingdom);Mireille H. Blanchard-Desce, Univ.deRennes1(France);Robert W. Boyd, Univ.ofRochester(Canada);Zeno Gaburro, Univ.degliStudidiTrento(Italy);Aaron W. Harper, TheUniv.ofSouthernCalifornia(UnitedStates);Ghassan E. Jabbour, ArizonaStateUniv.(UnitedStates);François Kajzar, PolytechnicalUniv.ofBucharest(Romania);Dmitri I. Kovalev, Univ.ofBath(UnitedKingdom);Paras N. Prasad, Univ.atBuffalo(UnitedStates);Dmitri Talapin, TheUniv.ofChicago(UnitedStates);Younan Xia, WashingtonUniv.inSt.Louis(UnitedStates)
Sunday 12 AugustSymposium-Wide Plenary Session . . . . . . . . . . . . . . . . . . . . Sun. 6:00 to 7:25 pm6:00pm: Introduction and Opening Remarks
6:05pm: The Exciting Science of Light with Metamaterials, VladimirM.Shalaev,PurdueUniv.(USA)
6:45pm:Future of Optics and Photonics, BahaaE.A.Saleh,CREOL,TheCollegeofOpitcsandPhotonicsattheUniv.ofCentralFlorida(USA)
Monday 13 AugustNanoScience + Engineering Plenary Session . . . . . . . . . . . . . . . Mon. 8:30 am to 12:00 pm
Session Chairs:Satoshi Kawata,OsakaUniv.(Japan)and Manijeh Razeghi, NorthwesternUniv.(USA)
8:30am:The Light and Sound Fantastic: Radiation Pressure at the Nanoscale, OskarPainter,CaliforniaInstituteofTechnology(USA)
9:15am:Organics and Nanostructures for Nonlinear Optics, NasserPeyghambarian,CollegeofOpticalSciences,TheUniv.ofArizona(USA)
CoffeeBreak . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10:00to10:30am
10:30am:From Nanophotonics, to Metaphotonics, to Dynamic Photonics: Controlling Light Propagation and Light-Matter Interactions for Emerging Technologies, ParasPrasad,Univ.atBuffalo(USA)
11:15am:Global Activities in Novel-Nano Magnetic Materials for Magnetic, Optoelectronics Applications,MisoonMah,AsianOfficeofAerospaceDevelopment(Japan)
Wednesday 15 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 1:40 to 3:30 pm
Synthesis and Characterization ISession Chair: Stefano Cabrini, LawrenceBerkeleyNationalLab.
(UnitedStates)
Understanding the dynamic modulation of surface plasmon resonance in degenerately doped semiconducting nanocrystals (Invited Paper),RuebenJ.Mendelsberg,GuillermoGarcia,BrettA.Helms,DeliaJ.Milliron,LawrenceBerkeleyNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . [8456-01]
Eu3+ as optical probe of the structure in amorphous and nanocrystalline ZnO sol-gel films,JorgeA.García-Macedo,Univ.NacionalAutónomadeMéxico(Mexico);EstrellaTerán-Hinojosa,Univ.NacionalAutónomadeMexico(Mexico);GuadalupeValverde-Aguilar,InstitutoPolitécnicoNacional(Mexico). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8456-02]
Optical properties of nanocrystalline Ce-doped LSO,SudesnaRoy,BostonUniv.(UnitedStates);HelmutLingertat,CharlesBrecher,ALEMAssociates(UnitedStates);VinodSarin,BostonUniv.(UnitedStates). . . . . . . . . . [8456-03]
A purely optical method for the determination of the geometrical dimensions of semiconductor nanowire arrays,NicklasAnttu,MagnusHeurlin,MagnusT.Borgström,Mats-ErikPistol,LarsSamuelson,LundUniv.(Sweden);HongqiXu,LundUniv.(Sweden)andPekingUniv.(China). [8456-04]
Composite oxides from explosive,XinghuaXie,GenshanTang,AnhuiUniv.ofScienceandTechnology(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8456-05]
SESSION 2 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 4:00 to 5:20 pm
Fabrication and Applications ISession Chair: Adam M. Schwartzberg, LawrenceBerkeleyNational
Lab.(UnitedStates)
Antenna integrated quantum cascade laser switchable via telecommunications wavelength probe beam,JohnKohoutek,RyanGelfand,DibyenduDey,AlirezaBonakdar,ImanHassaniNia,OmerG.Memis,ValaFathipour,HoomanMohseni,NorthwesternUniv.(UnitedStates). . . . [8456-06]
Fluorescent enhancement of ultrathin polymer layers for sensing applications,RoyAad,ChristopheCouteau,Univ.deTechnologieTroyes(France);LaurentDivay,ChristopheGalindo,PierreL.LeBarny,ThalesResearch&Technology(France);CorinneSartel,VincentSallet,GEMaC(France);GillesLérondel,Univ.deTechnologieTroyes(France). . . . . . . . . . . . . . . . . . [8456-07]
Optical thin films for gas sensing in advanced coal-fired power plants,PaulOhodnicki,Jr.,NationalEnergyTechnologyLab.(UnitedStates);CongjunWang,URSCorp.(UnitedStates);ThomasBrown,JohnBaltrus,ChristopherMatranga,MichaelP.Buric,BenjaminT.Chorpening,NationalEnergyTechnologyLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8456-08]
Optical processors using quantum dot semiconductor optical amplifiers,WenboLi,ShaozhenMa,HongyuHu,NiloyK.Dutta,Univ.ofConnecticut(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8456-09]
Posters-Wednesday . . . . . . . . . . . . . . . . . Wed. 5:30 to 7:30 pmConference attendees are invited to attend the poster session on Wednesday evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
Diffusion of dye solution in the intermolecular nanostructure of polydimethylsiloxane,MitsunoriSaito,TatsuyaNishimura,KoheiSakiyama,MichinoriNakagawa,RyukokuUniv.(Japan). . . . . . . . . . . . . . . . . . . . [8456-21]
Influence of the preparation condition on the properties of BiVO 4 and its photocatalytic reduction of carbon dioxide,QingyunChen,XianJiaotongUniv.(China) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8456-22]
The origin and carrier dynamics of green emission in ZnO nanowires studied by femtosecond spectroscopy,MingjieLi,GuichuanXing,GuozhongXing,TzeChienSum,NanyangTechnologicalUniv.(Singapore). . . . . [8456-23]
Fluorescence quenching due to graphene and silver nanoparticles,Cheng-WenHuang,Kai-HongLuo,Chih-YiLiu,YonhuaTzeng,Hsiang-ChenChui,NationalChengKungUniv.(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . [8456-24]
Photoconductivity studies on amorphous and crystalline TiO 2 and TiO 2:Eu3+ thin films synthesized by sol-gel,PedroFrancisco-Santiago,JorgeA.García-Macedo,Univ.NacionalAutónomadeMéxico(Mexico);GuadalupeValverde-Aguilar,InstitutoPolitécnicoNacional(Mexico). . . . . . . . . . . [8456-25]
Photoluminescence of porous silicon doped with rare earth from solutions followed by high-temperature annealing,SergeyA.Sokolov,LomonosovMoscowStateUniv.(RussianFederation);NataliaV.Latukhina,SamaraStateUniv.(RussianFederation);MargaritaV.Stepikhova,InstituteforPhysicsofMicrostructures(RussianFederation);DenisM.Zhigunov,VictorY.Timoshenko,LomonosovMoscowStateUniv.(RussianFederation) . . . . . . . . . . . . [8456-26]
Spherical mesoporous TiO 2:Yb,Er nanoparticles and their photoluminescence properties,LorenaM.García-Benjume,Ctr.deinvestigacionesenÓpticaA.C.(Mexico);ElderDelaRosaCruz,AlejandraUrbinaFrías,Ctr.deInvestigacionesenÓptica,A.C.(Mexico);MiguelAvalos-Borja,InstitutoPotosinodeInvestigaciónCientíficayTecnológica(Mexico);PedroSalas,Univ.NacionalAutónomadeMéxico(Mexico);M.EugeniaContreras-Garcia,Univ.MichoacanadeSanNicolásdeHidalgo(Mexico). . . . . . [8456-27]
32 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Preparation of flexible optical waveguide film with refractive index tunability,YongKuKwon,SeungJooNoh,JinYoungHan,MinKyunMin,SeongIkHeo,SunJinJin,HangHeeAhn,InhaUniv.(Korea,Republicof);Cheol-HeeAhn,SeoulNationalUniv.(Korea,Republicof). . . . . . . . . . [8456-28]
The effectiveness of metal oxide nanocrystal-enhanced polymers,MaryAnnHockey,QinLin,BrewerScience,Inc.(UnitedStates). . . . . . . . . . . . . [8456-29]
Oxide powders in emulsion explosive soot,HuishengZhou,AnhuiUniv.ofScienceandTechnology(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8456-30]
Thursday 16 AugustSESSION 3 . . . . . . . . . . . . . . . . . . . . . . . Thurs. 8:00 to 10:10 am
Fabrication and Applications IISession Chair: Rueben J. Mendelsberg, LawrenceBerkeleyNational
Lab.(UnitedStates)
Wavelength tunable properties of the perpendicular dual-grating guided-mode resonance filter,YonggangWu,ZihuanXia,ZhenhuaWang,RenchenLiu,PinglinTang,GangLv,HeyunWu,TongjiUniv.(China)......... [8456-10]
A dielectric broadband photonic nano-capacitor,HanLin,QimingZhang,MinGu,SwinburneUniv.ofTechnology(Australia). . . . . . . . . . . . . . . . . . . [8456-11]
Optomechanical beam steering by surface plasmon nanoantenna,AlirezaBonakdar,HoomanMohseni,NorthwesternUniv.(UnitedStates). . . . [8456-12]
Photoconductivity and stabilization of DA embedded in amorphous sol-gel TiO 2 matrix,GuadalupeValverde-Aguilar,InstitutoPolitécnicoNacional(Mexico);GinaPrado-Prone,JorgeA.García-Macedo,PatriciaVergara-Aragón,Univ.NacionalAutónomadeMexico(Mexico). . . . . . . . . . . . . . . . . . . [8456-13]
High-resolution 3D woodpile structures by direct fs laser writing,IoannaSakellari,Univ.ofCalifornia,Berkeley(UnitedStates);ElminaKabouraki,Univ.ofCrete(Greece);DavidGray,CostasFotakis,FoundationforResearchandTechnologyHellas(Greece);MariaVamvakaki,Univ.ofCrete(Greece);MariaFarsari,FoundationforResearchandTechnologyHellas(Greece). . . [8456-14]
Fabrication of large area photonic crystal with surface modified silica spheres (Invited Paper),KwangSunKang,KyungilUniv.(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8456-15]
SESSION 4 . . . . . . . . . . . . . . . . . . . Thurs. 10:40 am to 12:30 pm
Synthesis and Characterization IISession Chair: Stefano Cabrini, LawrenceBerkeleyNationalLab.
(UnitedStates)
Sub-diffraction crystallography of gallium nitride nanowires via diffraction limited Raman imaging (Invited Paper),AdamM.Schwartzberg,ShaulAloni,JeffreyJ.Urban,LawrenceBerkeleyNationalLab.(UnitedStates). . . [8456-16]
Low-temperature photocarrier dynamics in single-layer MoS 2 flakes,TobiasKorn,GerdPlechinger,StefanieC.Heydrich,MichaelHirmer,FranzX.Schrettenbrunner,DieterK.Weiss,JonathanEroms,ChristianSchüller,Univ.Regensburg(Germany). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8456-17]
Engineered dark states for super-resolution imaging with nanodiamonds,BettyP.Kouskousis,XiangpingLi,MinGu,SwinburneUniv.ofTechnology(Australia). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8456-18]
An investigation of surface-plasmon mediated emission from GLAD functionalized ZnO nanowires,DanielMayo,FiskUniv.(UnitedStates)andVanderbiltUniv.(UnitedStates);AnthonyMayo,AkiraUeda,ZhengdaPan,RichardMu,FiskUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . [8456-19]
Demonstration of multicolour In(Ga)As/GaAs-based quantum dot infrared photoetectors with quaternary (InAlGaAs) capping operating at low bias voltage,SaumyaSengupta,SouravAdhikary,SubhanandaChakrabarti,IndianInstituteofTechnologyBombay(India);YigitAytac,UnilA.Perera,GeorgiaStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8456-20]
Conference 8456
spie.org/opadvance · TEL:+13606763290 · help@spie.org 33
Conference 8457Sunday-Thursday 12-16 August 2012 • Proceedings of SPIE Vol. 8457
Plasmonics: Metallic Nanostructures and Their Optical Properties XConference Chair:Mark I. Stockman, GeorgiaStateUniv.(UnitedStates)
Program Committee:Martin Aeschlimann, TechnischeUniv.Kaiserslautern(Germany);Harry A. Atwater, Caltech(UnitedStates);David J. Bergman, TelAvivUniv.(Israel);Harald W. Giessen, Univ.Stuttgart(Germany);Jean-Jacques Greffet, InstitutOptique,Paris(France);Naomi J. Halas, RiceUniv.(UnitedStates);Martti Kauranen, TampereUniv.ofTechnology(Finland);Satoshi Kawata, OsakaUniv.(Japan);Fritz Keilmann, Max-Planck-InstitutfürQuantenoptik(Germany);Dai-Sik Kim, SeoulNationalUniv.(Korea,Republicof);Laurens Kuipers, FOMInstituteforAtomicandMolecularPhysics(AMOLF),Amsterdam(Netherlands);Olivier J. Martin, EcolePolytechniqueFédéraledeLausanne(Switzerland);Peter J. Nordlander, RiceUniv.(UnitedStates);Lukas Novotny, Univ.ofRochester(UnitedStates);Vahid Sandoghdar, ETHZurich(Switzerland);George C. Schatz, NorthwesternUniv.(UnitedStates);Tigran V. Shahbazyan, JacksonStateUniv.(UnitedStates);Vladimir M. Shalaev, PurdueUniv.(UnitedStates);Gennady B. Shvets, TheUniv.ofTexasatAustin(UnitedStates);Din Ping Tsai, NationalTaiwanUniv.(Taiwan);Niek F. van Hulst, ICFO-InstituteofPhotonicSciences(Spain);Hongxing Xu, InstituteofPhysics(China);Nikolay I. Zheludev, Univ.ofSouthampton(UnitedKingdom);Joseph Zyss, EcoleNormaleSupérieuredeCachan(France)
Sunday 12 AugustIntroduction and Foreword by the Chair . . Sun. 8:30 to 8:50 am
SESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 8:50 to 10:20 am
Special Keynote Session: Latest Progress in Nanoplasmonics
Session Chair: Mark I. Stockman, GeorgiaStateUniv.(UnitedStates)
Super-oscillatory lens far-field to far-field optical microscope: breaking diffraction limit (Keynote Presentation),E.T.F.Rogers,JariLindberg,T.Roy,SalvatoreSavo,OptoelectronicsResearchCtr.(UnitedKingdom);J.E.Chad,Univ.ofSouthampton(UnitedKingdom);MarkDennis,Univ.ofBristol(UnitedKingdom);NikolayI.Zheludev,OptoelectronicsResearchCtr.(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-01]
Graphene nanoplasmonics (Keynote Presentation),SashaGrigorenko,KostyaNovoselov,TheUniv.ofManchester(UnitedKingdom). . . . . . . . . . . . [8457-02]
SESSION 2 . . . . . . . . . . . . . . . . . . . . . Sun. 10:50 am to 12:45 pm
Graphene Plasmonics ISession Chair: Nikolay I. Zheludev, Univ.ofSouthampton(United
Kingdom)
Graphene plasmonics: from quantum phenomena to extraordinary nanooptics (Keynote Presentation),JavierF.GarcíadeAbajo,SukosinThongrattanasiri,AlejandroManjavacas,JohanChristensen,ConsejoSuperiordeInvestigacionesCientíficas(Spain);FrankH.L.Koppens,DarrickE.Chang,ICFO-InstitutdeCiènciesFotòniques(Spain). . . . . . . . . . . . . . . . . . . [8457-03]
Photovoltaic devices based on 2D heterostructures,KostyaS.Novoselov,SashaGrigorenko,LiamBritnell,AndreK.Geim,Univ.ofManchester(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-04]
Edge-to-edge interaction of graphene nanostructures,SukosinThongrattanasiri,F.JavierGarcíadeAbajo,ConsejoSuperiordeInvestigacionesCientíficas(Spain). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-05]
Manipulation of graphene plasmons by electrostatic gating, scanned probes, and sample geometry (Invited Paper),MichaelM.Fogler,Univ.ofCalifornia,SanDiego(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-06]
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:45to1:50pm
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 1:50 to 3:10 pm
Active, Quantum, and Gain Plasmonics, Spasers ISession Chair: F. Javier García de Abajo, ConsejoSuperiorde
InvestigacionesCientíficas(Spain)
Scaling down the photonics beyond diffraction limit: plasmon waveguide, cavities, and integrated laser circuits (Invited Paper),XiangZhang,Univ.ofCalifornia,Berkeley(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-07]
Low-loss and broadband surface plasmon amplification at visible wavelengths,XiangengMeng,KojiFujita,KatsuhisaTanaka,KyotoUniv.(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-08]
Integrated coherent plasmon sources operating near 1.5 microns (Invited Paper),JamesP.Long,RichardA.Flynn,ChulSooKim,IgorVurgaftman,AnttiJ.Mäkinen,MijinKim,KonradBussmann,JamesR.Lindle,WilliamW.Bewley,NavalResearchLab.(UnitedStates);LiweiCheng,Fow-SenChoa,Univ.ofMaryland,BaltimoreCounty(UnitedStates);JerryR.Meyer,NavalResearchLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-09]
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 3:40 to 6:00 pm
Novel Plasmonic Systems and ApplicationsSession Chair: Xiang Zhang, Univ.ofCalifornia,Berkeley(UnitedStates)
Holographic design for plasmonic couplers and non-diffracting surface waves (Invited Paper),FedericoCapasso,JiaoLin,PatriceGenevet,HarvardSchoolofEngineeringandAppliedSciences(UnitedStates). . . . . . . . [8457-10]
An invisible hybrid metal/semiconductor photodetector,PengyuFan,GeballeLab.forAdvancedMaterials(GLAM)(UnitedStates);UdayChettiar,NaderEngheta,Univ.ofPennsylvania(UnitedStates);MarkBrongersma,GeballeLab.forAdvancedMaterials(GLAM)(UnitedStates). . . . . . . . . . . . . . . . . . [8457-11]
Superhydrofobicity, plasmonics, and Raman spectroscopy for few/single molecule detection down to attomolar concentration (Invited Paper),EnzoM.DiFabrizio,IstitutoItalianodiTecnologia(Italy)andUniv.deglistudiMagnaGræciadiCatanzaro(Italy) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-12]
Taking cascaded plasmonic field enhancement to the ultimate limit in silver nanoparticle dimers,SeyfollahToroghi,CREOL,TheCollegeofOpticsandPhotonics,Univ.ofCentralFlorida(UnitedStates);PieterG.Kik,CREOL,TheCollegeofOpticsandPhotonics,UnivofCentralFlorida(UnitedStates)[8457-13]
An ultra-compact Si-based plasmonic modulator,VolkerJ.Sorger,EnergyFrontiersResearchCtr.(UnitedStates);NorberoD.Lanzillotti-Kimura,Ren-MinMa,Univ.ofCalifornia,Berkeley(UnitedStates);XiangZhang,Univ.ofCalifornia,Berkeley(UnitedStates)andLawrenceBerkeleyNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-14]
Towards the holy grail of near-field optics via reproducibly fabricated optical nano antennae on scanning probe tips,MauroMelli,WeiBao,TheMolecularFoundry(UnitedStates);FrancescaIntonti,DiederikWiersma,EuropeanLab.forNon-LinearSpectroscopy(Italy);P.JamesSchuck,StefanoCabrini,TheMolecularFoundry(UnitedStates);AlexanderWeber-Bargioni,TheMolecularFoundry(UnitedStates)andEuropeanLab.forNon-LinearSpectroscopy(Italy). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-15]
Symposium-Wide Plenary Session . . . . . . . . . . . . . . . . . . . . Sun. 6:00 to 7:25 pm6:00pm: Introduction and Opening Remarks
6:05pm: The Exciting Science of Light with Metamaterials, VladimirM.Shalaev,PurdueUniv.(USA)
6:45pm:Future of Optics and Photonics, BahaaE.A.Saleh,CREOL,TheCollegeofOpitcsandPhotonicsattheUniv.ofCentralFlorida(USA)
34 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Monday 13 AugustNanoScience + Engineering Plenary Session . . . . . . . . . . . . . . . Mon. 8:30 am to 12:00 pm
Session Chairs:Satoshi Kawata,OsakaUniv.(Japan)and Manijeh Razeghi, NorthwesternUniv.(USA)
8:30am:The Light and Sound Fantastic: Radiation Pressure at the Nanoscale, OskarPainter,CaliforniaInstituteofTechnology(USA)
9:15am:Organics and Nanostructures for Nonlinear Optics, NasserPeyghambarian,CollegeofOpticalSciences,TheUniv.ofArizona(USA)
CoffeeBreak . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10:00to10:30am
10:30am:From Nanophotonics, to Metaphotonics, to Dynamic Photonics: Controlling Light Propagation and Light-Matter Interactions for Emerging Technologies, ParasPrasad,Univ.atBuffalo(USA)
11:15am:Global Activities in Novel-Nano Magnetic Materials for Magnetic, Optoelectronics Applications,MisoonMah,AsianOfficeofAerospaceDevelopment(Japan)
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:00to1:30pm
SESSION 5 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 1:30 to 3:25 pm
Plasmonic Sensing ISession Chair: Enzo Mario Di Fabrizio, IstitutoItalianodiTecnologia
(Italy)
Complex plasmon sensors (Keynote Presentation),HaraldW.Giessen,Univ.Stuttgart(Germany). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-16]
Large-area plasmonic hot-spot arrays: sub-2nm interparticle separations with plasma-enhanced atomic layer deposition of Ag on Si nanopillar arrays,JoshuaCaldwell,OrestJ.Glembocki,FranciscoJ.Bezares,ErinCleveland,U.S.NavalResearchLab.(UnitedStates);MaaritKariniemi,Univ.ofHelsinki(Denmark);SharkaM.Prokes,EdwardFoos,U.S.NavalResearchLab.(UnitedStates);JaakkoNiinisto,TimoHatanpaa,MikkoRitala,MarkkuLeskela,Univ.ofHelsinki(Denmark). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-17]
Optical sensing with spiked particles (Invited Paper),RamonA.Alvarez-Puebla,Univ.deVigo(Spain) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-18]
Chip-based plasmonic monopole antennas and circuits for ultra-sensitive infrared spectroscopy,RonenAdato,HaticeAltug,BostonUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-19]
SESSION 6 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 3:55 to 6:10 pm
Active, Quantum, and Gain Plasmonics Spasers IISession Chair: Federico Capasso, HarvardSchoolofEngineeringand
AppliedSciences(UnitedStates)
Active nanodevices: on the use of plasmonics to manipulate optical signals at the nanoscale (Keynote Presentation),GregoryWurtz,AnatolyV.Zayats,King’sCollegeLondon(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . [8457-20]
Quantum treatment for cylindrical surface plasmons using the hydrodynamical model,JacobBen-Yakar,DavidBergman,TelAvivUniv.(Israel) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-21]
Active plasmonics: from gain to nonlinearity (Invited Paper),M.Mayy,J.K.Kitur,G.Zhu,M.Noginov,NorfolkStateUniv.(UnitedStates)....... [8457-22]
An integrated subwavelength surface plasmon light source and in-plane waveguide with GaAs nanowire LED,PengyuFan,GeballeLab.forAdvancedMaterials(GLAM)(UnitedStates);CarloColombo,ÉcolePolytechniqueFédéraledeLausanne(Switzerland);KevinC.Huang,GeballeLab.forAdvancedMaterials(GLAM)(UnitedStates);AnnaFontcubertaiMorral,ÉcolePolytechniqueFédéraledeLausanne(Switzerland);MarkBrongersma,GeballeLab.forAdvancedMaterials(GLAM)(UnitedStates). . . . . . . . . . . . . . . . . . . . . [8457-23]
Subwavelength mapping of spontaneous emission in plasmonic nano-bubble cavity probed by cathodoluminescence,JunXu,NicholasFang,MassachusettsInstituteofTechnology(UnitedStates);HyungjinMa,Univ.ofIllinoisatUrbana-Champaign(UnitedStates). . . . . . . . . . . . . . . . . . . . [8457-24]
Tuesday 14 AugustSESSION 7 . . . . . . . . . . . . . . . . . . . . . . . . Tues. 8:00 to 10:30 am
Novel Plasmonic Systems and Phenomena ISession Chair: Harald W. Giessen, Univ.Stuttgart(Germany)
Quantum plasmonics and plexcitonics (Invited Paper),PeterJ.Nordlander,RiceUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-25]
Silicon plasmonics as a platform for active devices (Invited Paper),UrielLevy,BorisDesiatov,IlyaGoykhman,JosephShappir,TheHebrewUniv.ofJerusalem(Israel);JacobB.Khurgin,JohnsHopkinsUniv.(UnitedStates) . . . . . [8457-26]
Surface plasmon polariton generation and waveguiding by organic nanofibers,TillLeißner,Christian-Albrechts-Univ.zuKiel(Germany);JacekFiutowski,Univ.ofSouthernDenmark(Denmark);ChristophLemke,Christian-Albrechts-Univ.zuKiel(Germany);KasperThilsing-Hansen,Univ.ofSouthernDenmark(Denmark);StephanJauernik,Christian-Albrechts-Univ.zuKiel(Germany);JakobKjelstrup-Hansen,Univ.ofSouthernDenmark(Denmark);MichaelBauer,Christian-Albrechts-Univ.zuKiel(Germany);Horst-GünterRubahn,Univ.ofSouthernDenmark(Denmark). . . . . . . . . . . . . . . . . . [8457-27]
Plasmonic near-field antenna probing of defects in thin film photovoltaic materials,EdwardS.Barnard,WeiBao,MauroMelli,StefanoCabrini,AlexanderWeber-Bargioni,P.JamesSchuck,TheMolecularFoundry(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-28]
Voltage controlled nanoparticle plasmon resonance tuning through anodization,ChatdanaiLumdee,PieterG.Kik,CREOL,TheCollegeofOpticsandPhotonics,Univ.ofCentralFlorida(UnitedStates). . . . . . . . . . . . [8457-29]
Plasmonic systems: new phenomena and applications (Invited Paper),GuyBartal,Technion-IsraelInstituteofTechnology(Israel). . . . . . . . . . . . . [8457-30]
SESSION 8 . . . . . . . . . . . . . . . . . . . . Tues. 11:00 am to 12:30 pm
Active, Quantum, and Gain Plasmonics, Spasers IIISession Chair: Anatoly V. Zayats, King’sCollegeLondon(United
Kingdom)
Plasmonic nanoantennas and nanolasers (Invited Paper),ShangjrGwo,NationalTsingHuaUniv.(Taiwan)............................. [8457-31]
Launching surface plasmon polaritons with semiconductor nanowires (Invited Paper),PatrickLandreman,StanfordUniv.(UnitedStates). . . [8457-32]
Forced spaser oscillations (Invited Paper),AlexanderA.Lisyansky,QueensCollegeofCUNY(UnitedStates);EugeneyS.Andrianov,AlexanderV.Dorofeenko,AlexanderA.Pukhov,AlexeyP.Vinogradov,InstituteforTheoreticalandAppliedElectromagnetics(RussianFederation) . . . . . . . . . . . . . . [8457-33]
Lunch/Exhibition Break.............................. 12:30to2:00pm
SESSION 9 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 2:00 to 3:25 pm
Graphene Plasmonics IIGraphene: a novel platform for capturing and manipulating light at the nanoscale (Keynote Presentation),FrankKoppens,ICFO-InstitutdeCiènciesFotòniques(Spain). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-34]
The smallest plasmonic resonators: graphene nanocavities at near-infrared telecom wavelengths,MinSeokJang,VictorBrar,StanleyBurgos,HarryA.Atwater,CaliforniaInstituteofTechnology(UnitedStates). . . . . . . . . . [8457-35]
Plasmon blockade in nanostructured graphene,AlejandroManjavacas,ConsejoSuperiordeInvestigacionesCientíficas(Spain);PeterJ.Nordlander,RiceUniv.(UnitedStates);F.JavierGarciadeAbajo,ConsejoSuperiordeInvestigacionesCientíficas(Spain). . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-36]
SESSION 10 . . . . . . . . . . . . . . . . . . . . . . . . Tues. 3:55 to 6:10 pm
Nonlinear, Ultrafast, and Strong Field Plasmonics ISession Chair: Peter J. Nordlander, RiceUniv.(UnitedStates)
Coherent two-dimensional nanoscopy (Keynote Presentation),MartinAeschlimann,TechnischeUniv.Kaiserslautern(Germany). . . . . . . . . . [8457-37]
The plasmoelectric effect: conversion of optical power into DC electrical power by plasmonic nanostructures in all-metal circuits,MatthewT.Sheldon,HarryA.Atwater,CaliforniaInstituteofTechnology(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-38]
Saturable scattering of localized surface plasmon resonance in a single gold nanoparticle,Tung-YuSu,NationalTaiwanUniv.(Taiwan);YasuoYonemaru,OsakaUniv.(Taiwan);MasahitoYamanaka,SatoshiKawata,OsakaUniv.(Japan);Shi-WeiChu,NationalTaiwanUniv.(Taiwan) . . . . . . . . [8457-39]
Conference 8457
spie.org/opadvance · TEL:+13606763290 · help@spie.org 35
Second order nonlinear optics with surface plasmon polariton gap waveguides (Invited Paper),JacobB.Khurgin,JohnsHopkinsUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-40]
Enhanced optical properties of single upconverting nanoparticles with plasmonic nanostructures,DanielJ.Gargas,LawrenceBerkeleyNationalLab.(UnitedStates);AlexisOstrowski,EmoryChan,TheMolecularFoundry(UnitedStates);DeliaMilliron,LawrenceBerkeleyNationalLab.(UnitedStates);BruceCohen,P.JamesSchuck,TheMolecularFoundry(UnitedStates) . . . [8457-41]
Wednesday 15 AugustSESSION 11 . . . . . . . . . . . . . . . . . . . . . . . .Wed. 8:00 to 10:30 am
Novel Plasmonic Systems and Phenomena IISession Chair: Uriel Levy, TheHebrewUniv.ofJerusalem(Israel)
Fano-resonant metamaterials for sensing and vibrational fingerprinting: from protein monolayers to single-layer graphene (Keynote Presentation),GennadyB.Shvets,ChihhuiWu,AlexanderKhanikaev,InstituteforFusionStudies(UnitedStates);NihalArju,TheUniv.ofTexasatAustin(UnitedStates);KamilAlici,InstituteforFusionStudies(UnitedStates);IgnacioGallardo,LaurenWebb,TheUniv.ofTexasatAustin(UnitedStates);RonenAdato,AhmetA.Yanik,HaticeAltug,BostonUniv.(UnitedStates)................. [8457-42]
Tuning Fano resonance in quasi-3D gold plasmonic nanostructures for surface-enhanced Raman scattering,DaqianWang,Univ.ofWashington(UnitedStates)andTsinghuaUniv.(China);XinglongYu,TsinghuaUniv.(China);QiumingYu,Univ.ofWashington(UnitedStates). . . . . . . . . . . . . . . . . [8457-43]
Flexible and stretchable plasmonics and metamaterials (Keynote Presentation),HaticeAltug,BostonUniv.(UnitedStates) . . . . . . . . . . [8457-44]
Stretch-tuneable plasmonic mats of self-assembled gold nanoparticles,FuMinHuang,MatthewMillyard,Univ.ofCambridge(UnitedKingdom);RichardWhite,ElisabettaSpigone,JaniKivioja,NokiaResearchCtr.(UnitedKingdom);JeremyBaumberg,Univ.ofCambridge(UnitedKingdom). . . . . . . . . . [8457-45]
Leakage radiation spectroscopy of organic nanofibers and metal nanostructure: evidence for exciton-surface plasmon polariton interaction,LeszekJozefowski,JagiellonianUniv.inKrakow(Poland);JacekFiutowski,VladimirBordo,Horst-GünterRubahn,Univ.ofSouthernDenmark(Denmark) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-46]
SESSION 12 . . . . . . . . . . . . . . . . . . . Wed. 11:00 am to 12:50 pm
Nonlinear, Ultrafast, and Strong Field Plasmonics IISession Chair: Martin Aeschlimann, TechnischeUniv.Kaiserslautern
(Germany)
Nanoplasmonic generation of ultrashort EUV pulses (Invited Paper),JoonheeChoi,In-YongPark,Dong-HyubLee,HyunjinKim,KAIST(Korea,Republicof);SeungchulKim,PohangUniv.ofScienceandTechnology(Korea,Republicof);Seung-WooKim,KAIST(Korea,Republicof). . . . . . . . . . . . . . . . . . . . [8457-47]
Spatiotemporal characterization and control of lightfield nanolocalization in metallic nanostructures by 2P-PEEM,UlfKleineberg,SooHoonChew,KelliePearce,ChristianSpäth,JürgenSchmidt,Ludwig-Maximilians-Univ.München(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-48]
Strong-field effects at metallic nanostructures (Invited Paper),ClausRopers,Univ.Göttingen(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-49]
Ultrafast nano-optics with optical antennas (Invited Paper),MarkusB.Raschke,Univ.ofColorado(UnitedStates). . . . . . . . . . . . . . . . . . . . . [8457-50]
Lunch/Exhibition Break.............................. 12:50to2:20pm
SESSION 13 . . . . . . . . . . . . . . . . . . . . . . . . Wed. 2:20 to 3:35 pm
Invited Session: Coherent, Hybrid, and Active PlasmonicsSession Chair: Hatice Altug, BostonUniv.(UnitedStates)
Coherent, hybrid, and active plasmonics (Keynote Presentation),NaomiJ.Halas,RiceUniv.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-51]
Light emission from metal (Invited Paper),MeirOrenstein,Technion-IsraelInstituteofTechnology(Israel) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-52]
SESSION 14 . . . . . . . . . . . . . . . . . . . . . . . . Wed. 4:05 to 6:00 pm
Controlling Light in PlasmonicsSession Chair: Markus B. Raschke, Univ.ofColoradoatBoulder
(UnitedStates)
Controlling light fields with metals (Keynote Presentation),LaurensK.Kuipers,FOMInstituteforAtomicandMolecularPhysics(Netherlands). . . . . . [8457-53]
Enhanced THz transmission through periodic subwavelength aperture arrays fabricated in graphite,ShuchangLiu,ThoDucNguyen,Z.ValyVardeny,AjayNahata,TheUniv.ofUtah(UnitedStates) . . . . . . . . . . . . . . . . . . [8457-54]
Spinoptical metamaterials (Invited Paper),ErezHasman,Technion-IsraelInstituteofTechnology(Israel) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-55]
Spectral and directional fluorescence modification by hybrid plasmonic-dielectric structures,CalinHrelescu,BoyangDing,MartinDjiango,NikitaArnold,KlausPiglmayer,ThomasA.Klar,JohannesKeplerUniv.Linz(Austria). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-56]
Posters-Wednesday . . . . . . . . . . . . . . . . . Wed. 5:30 to 7:30 pmConference attendees are invited to attend the poster session on Wednesday evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
Spectrally tunable nanoplasmonic reflector for thin-film Si solar cells,RufinaS.A.Sesuraj,Univ.ofSouthampton(UnitedKingdom). . . . . . . . . . . . [8457-73]
Mach-Zehnder interferometer using a long-range surface plasmon polariton coupler,TakahideSakaidani,NihonUniv.(Japan);GoFujii,NihonUniv.(Japan)andNationalInstituteofAdvancedIndustrialScienceandTechnology(Japan);AkitoFujikake,NaotoNamekata,NihonUniv.(Japan);DaijiFukuda,NationalInstituteofAdvancedIndustrialScienceandTechnology(Japan);ShuichiroInoue,NihonUniv.(Japan) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-74]
Development of plasmonic racetrack resonators with a trench structure,HiroyukiOkamoto,AnanNationalCollegeofTechnology(Japan);KenzoYamaguchi,KagawaUniv.(Japan);MasanobuHaraguchi,ToshihiroOkamoto,Univ.ofTokushima(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-75]
Large-scale first principles configuration interaction calculations of optical absorption of small aluminium clusters,RavindraL.Shinde,AlokShukla,IndianInstituteofTechnologyBombay(India) . . . . . . . . . . . . . . . . . . . [8457-76]
Material dependence of the distributed bolometric effect in resonant metallic nanostructures,AlexanderCuadrado,Univ.ComplutensedeMadrid(Spain);F.JavierGonzalez,Univ.AutónomadeSanLuisPotosi(Mexico);JuanCarlosMartinez-Anton,JavierAlda,Univ.ComplutensedeMadrid(Spain). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-77]
Surface plasmon resonances in defect periodic metal nanostructures,BoyangZhang,HaishengLeong,JunpengGuo,TheUniv.ofAlabamainHuntsville(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-78]
Subwavelength plasmonic metallic nanopillar-based coupler,VenusDillu,ShrutiSingh,RavindraK.Sinha,DelhiTechnologicalUniv.(India). . . . [8457-79]
Nonlinear response of 2D plasmonic gold patches for SERS applications,MarcoGrande,PolitecnicodiBari(Italy);MariaAntoniettaVincenti,TheAEgisTechnologiesGroup,Inc.(UnitedStates);GiuseppeV.Bianco,IstitutodiMetodologieInorganicheeDeiPlasmi(Italy);TizianaStomeo,IstitutoItalianodiTecnologia(Italy);DomenicodeCeglia,TheAEgisTechnologiesGroup,Inc.(UnitedStates);MassimoDeVittorio,IstitutoItalianodiTecnologia(Italy);VincenzoPetruzzelli,PolitecnicodiBari(Italy);GiovanniBruno,IstitutodiMetodologieInorganicheeDeiPlasmi(Italy);MichaelScalora,U.S.ArmyAviationandMissileCommand(UnitedStates);AntonellaD’Orazio,PolitecnicodiBari(Italy). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-80]
Surface patterning using femtosecond laser for sensing and opto-fluidics,RicardasBuividas,DanielDay,SauliusJuodkazis,SwinburneUniv.ofTechnology(Australia). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-81]
Low-field magnetic circular dichroism in silver and gold colloidal nanoparticles of different size, shape, and aggregation,MikhailArtemyev,BelarusianStateUniv.(Belarus);AlyonaSukhanova,MoscowStateEngineeringPhysicsInstitute(RussianFederation);RomanKrutokhvostov,CICnanoGUNE(Spain);DmitryMelnikau,CICnanoGUNEConsolider(Spain);VladimirOleinikov,Shemyakin-OvchinnikovInstituteofBioorganicChemistryoftheRussianAcademyofSciences(RussianFederation);IgorR.Nabiev,MoscowStateEngineeringPhysicsInstitute(RussianFederation) . . . . . . . . . . . . . . . [8457-82]
Enhanced light absorption in an ultrathin silicon solar cell utilizing plasmonic nanostructures,SanshuiXiao,ErikStassen,NielsA.Mortensen,TechnicalUniv.ofDenmark(Denmark). . . . . . . . . . . . . . . . . . . . . . . . . [8457-83]
Conference 8457
36 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Coherent detection of multiband terahertz radiation using a surface plasmon-polariton based photoconductive antenna,ShuchangLiu,XiangShou,AjayNahata,TheUniv.ofUtah(UnitedStates) . . . . . . . . . . . . . [8457-84]
Surface plasmon-induced absorption enhancement of silicon nanowire array,EunsongyiLee,MinjiGwon,Dong-WookKim,EwhaWomansUniv.(Korea,Republicof);KeyaZhou,Jin-YoungJung,Jung-HoLee,HanyangUniv.(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-85]
Huge SERS enhancement via ZnO nanowires on gold nanoislands,MohammadT.Yaseen,Yia-ChungChang,AcademiaSinica(Taiwan) [8457-86]
A fork-shaped plasmonic device with polarization-controllable optical confinement,MohammedN.Abbas,Min-HsiungShih,Yia-ChungChang,AcademiaSinica(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-87]
Identifying near-field versus far-field spectral shifts in plasmonic nanoantennas,PabloAlbellaEchave,CentrodeFisicadeMateriales(Spain);PabloAlonso-González,CICnanoGUNEConsolider(Spain);FrankNeubrech,Ruprecht-Karls-Univ.Heidelberg(Germany);JavierAizpurua,CentrodeFisicadeMateriales(Spain);AnnemariePucci,Ruprecht-Karls-Univ.Heidelberg(Germany);RainerHillenbrand,CICnanoGUNEConsolider(Spain). . . [8457-88]
Widely-tunable optical bandpass filter based on long-range surface plasmon polaritons,JongwonLee,FengLu,MikhailBelkin,TheUniv.ofTexasatAustin(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-89]
Linear and nonlinear Fano resonance on two-dimensional magnetic plasmon crystal,HuiLiu,NanjingUniv.(China)andHongKongBaptistUniv.(HongKong,China);GuixinLi,KokWaiCheah,HongKongBaptistUniv.(HongKong,China);ShiningZhu,NanjingUniv.(China). . . . . . . . . . . . . . . . . [8457-90]
Optical attenuation and heating across a metal grid,MichaelM.Tilleman,ElbitSystemsofAmerica(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . [8457-91]
Tunable optical coupling in regular arrays of gold nanoparticles,AnatoliyPinchuk,DavidA.Smith,Univ.ofColoradoatColoradoSprings(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-92]
Surface plasmon enhanced two photon absorption,AlirezaBonakdar,HoomanMohseni,NorthwesternUniv.(UnitedStates) . . . . . . . . . . . . [8457-93]
Fabrication of wedges nanostructures for plasmonic nanofocusing,PierfrancescoZilio,TommasoOngarello,Univ.degliStudidiPadova(Italy);DenisGaroli,IlLaNN-Lab.diricercaperlaNanofabbricazioneeiNanodispositivi(Italy);MarcoNatali,IstitutodiChimicaInorganicaeDelleSuperfici(Italy);FilippoRomanato,IlLaNN-Lab.diricercaperlaNanofabbricazioneeiNanodispositivi(Italy) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-94]
Fundamental characteristics of femtosecond laser-induced aggregation and adhesion of gold nanorods assisted by two-photon polymerization,SatoruShoji,KyokoMasui,ShotaUshiba,OsakaUniv.(Japan);Xuan-MingDuan,TechnicalInstituteofPhysicsandChemistry(China);SatoshiKawata,OsakaUniv.(Japan)andRIKEN(Japan). . . . . . . . . . . . . . . . . . . . . . . . [8457-95]
Design of planar metamaterial optical antenna,KamalKishor,RavindraK.Sinha,DelhiTechnologicalUniv.(India) . . . . . . . . . . . . . . . . . . . . . . . . [8457-96]
Localized surface plasmon resonance sensor with a vertical conductive bridge,KyeongSeokLee,WonMokKim,KoreaInstituteofScienceandTechnology(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-97]
Three-dimensional light manipulation by plasmonic nanostructure,HungGueiTsai,ChiaMinChang,MingLunTseng,ChengHungChu,HsinWeiHuang,Yao-WeiHuang,BoHanChen,Ding-WeiHuang,DinPingTsai,NationalTaiwanUniv.(Taiwan) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-98]
Transmission and reflection spectra of photonic crystal with plasmonic defect,SergeyG.Moiseev,InstituteofRadioEngineeringandElectronics(RussianFederation)andUlyanovskStateUniv.(RussianFederation)andUlyanovskStateTechnicalUniv.(RussianFederation);VladimirOstatochnikov,DmitrySementsov,MarinaYavtushenko,UlyanovskStateUniv.(RussianFederation) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-99]
Extremal features of plasmon fields propagating on roughness surfaces,J.C.Juarez-MoralesM.D.,InstitutoNacionaldeAstrofísica,ÓpticayElectrónica(Mexico);G.Martinez-Niconoff,InstitutoNacionladeAstrofísica,Ópticayelectrónica(Mexico);J.Munoz-Lopez,InstitutoNacionaldeAstrofísica,Ópticayelectrónica(Mexico) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-100]
Excitation of surface plasmons in Al-coated SNOM tips,ViktorPalm,MihkelRähn,JoonasJäme,VladimirHizhnyakov,Univ.ofTartu(Estonia). . [8457-101]
Synthesis of silver nanowires via solvothermal method: active substrate for surface enhanced Raman scattering,HasnaKudilatt,SaranyaBabu,MajeeshMangalassery,RajeevKumar,M.K.Jayaraj,CochinUniv.ofScience&Technology(India). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-102]
Plasmonic properties and sizing of core-shell Cu-Cu 2O nanoparticles fabricated by femtosecond laser ablation in liquids,JesicaM.J.Santillán,Ctr.deInvestigacionesenOptica(CIOp)(Argentina);FabiánVidela,DanielC.Schinca,LucíaB.Scaffardi,Ctr.deInvestigacionesenOptica(CIOp)(Argentina)andUniv.NacionaldeLaPlata(Argentina). . . . . . . . . . . . . . . . . . . . . [8457-103]
Blinking of hotspots at laser patterned AgOx thin film,MingLunTseng,KuangShengChung,YaoWeiHuang,YuHsaunLin,ChiaMinChang,DinPingTsai,NationalTaiwanUniv.(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . [8457-104]
Harmonic generation from nanocrescent antennas,XiaoJinJiao,CaraM.Barnes,JenniferS.Shumaker-Parry,SteveBlair,TheUniv.ofUtah(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-105]
Three-dimensional nanoscale far-field focusing by scattering SPPs,ShaoyunYin,InstituteofOpticsandElectronics(China);JingleiDu,FuhuaGao,SichuanUniv.(China);ChunleiDu,InstituteofOpticsandElectronics(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-106]
Integrated hybrid photonic-plasmonic cavity with in-plane photon-plasmon coupling for luminescence enhancement,SergioPauloA.Osório,OtavioSilvadeBrito,FabioA.Ferri,VictorA.GarciaRivera,AntonioR.Zanatta,EuclydesMarega,Jr.,Univ.deSãoPaulo(Brazil). . . . . . . . . . . . . . . . . . . . . . . [8457-107]
Optical properties of silver nanoparticles coated by cyanine dyes molecular overlayers,TigranA.Vartanyan,NikitaB.Leonov,ElenaN.Kaliteevskaya,NikitaA.Toropov,AntonA.Starovoytov,NationalResearchUniv.ofInformationTechnologies,MechanicsandOptics(RussianFederation). . . . . . . . [8457-108]
Phase detection sensitivity enhancement of grating-coupled surface plasmon resonance (SPR) sensor using nonzero azimuth angle incident light,Wen-KaiKuo,Chih-HaoChang,NationalFormosaUniv.(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-109]
Homologous optical transmission properties of variforms metamaterials in infrared wavelength,YongQianLi,NingboWang,XiaoyingLi,NorthwesternPolytechnicalUniv.(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-110]
Coherent magnetic plasmon modes in a contacting gold nano-sphere chain on a gold slab,HuiLiu,KanuoChen,ShumingWang,ShiningZhu,NanjingUniv.(China) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-111]
Rolling up gold nanoparticle-dressed DNA origami into three-dimensional plasmonic chiral nanostructures,NaLiu,RiceUniv.(UnitedStates);XiboShen,ChenSong,JinyeWang,DangweiShi,ZhengangWang,BaoquanDing,NationalCtr.forNanoscienceandTechnology(China) . . . . . . . . . . . [8457-112]
Correlated electron, plasmon coupling in gold: vanadium dioxide nanocomposites,DavonW.Ferrara,JoyeetaNag,EvanR.MacQuarrie,RichardF.Haglund,Jr.,VanderbiltUniv.(UnitedStates). . . . . . . . . . . . . . . . . [8457-113]
An effective cavity resonance model for enhanced optical transmission,EliLansey,TheCityCollegeofNewYork(UnitedStates)andTheGraduateCtr.oftheCityUniv.ofNewYork(UnitedStates);IsroelM.Mandel,TheCityCollegeofNewYork(UnitedStates);JonahN.Gollub,PhoebusOptoelectronics,LLC(UnitedStates);DavidT.Crouse,TheCityCollegeofNewYork(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-114]
Spectral coherent emission of thermal radiation in the far-field from a truncated resonator,ShaneMcConnell,MichaelD.Seal,StephenE.Nauyoks,AirForceInstituteofTechnology(UnitedStates);NeilR.Murphy,LirongSun,AirForceResearchLab.(UnitedStates);MichaelA.Marciniak,AirForceInstituteofTechnology(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-115]
Self-assembled plasmonic crystals for enhanced light-nanomaterial interaction,MahdiFarrokh-Baroughi,KhadijehBayat,DilipDachhepati,UmeshGautam,JunWang,SouthDakotaStateUniv.(UnitedStates) . . . . . [8457-116]
Energy generation from plasmonic Ag nanorectennas,RichardM.Osgood,StephenGiardini,JoelCarlson,U.S.ArmyNatickSoldierResearch,DevelopmentandEngineeringCtr.(UnitedStates);GustavoFernandes,JimmyXu,BrownUniv.(UnitedStates);PrakashPeriasamy,ColoradoSchoolofMines(UnitedStates);PhilipParilla,NationalRenewableEnergyLab.(UnitedStates);MatthewChin,MadanDubey,BarbaraNichols,U.S.ArmyResearchLab.(UnitedStates);JinHoKim,BrownUniv.(UnitedStates);RyanO’Hayre,ColoradoSchoolofMines(UnitedStates);JosephBerry,DavidGinley,NationalRenewableEnergyLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . [8457-117]
Radiative heat transfer between nanoparticles,AlejandroManjavacas,F.JavierGarciadeAbajo,ConsejoSuperiordeInvestigacionesCientíficas(Spain). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-118]
Quantum finite-size effects in the plasmons of nanostructured graphene,SukosinThongrattanasiri,AlejandroManjavacas,F.JavierGarcíadeAbajo,ConsejoSuperiordeInvestigacionesCientíficas(Spain). . . . . . . . . . [8457-119]
Conference 8457
spie.org/opadvance · TEL:+13606763290 · help@spie.org 37
Chiral nanostructures of gold nanorods and their optical activity,PengWang,BeijingInstituteofTechnology(China);ShunpingZhang,CASInstituteofPhysics(China);YingluJi,NationalCtr.forNanoscienceandTechnology(China);HongWei,CASInstituteofPhysics(China);JianboLiu,XiaochunWu,NationalCtr.forNanoscienceandTechnology(China);BinShao,RongyaoWang,BeijingInstituteofTechnology(China);HongxingXu,CASInstituteofPhysics(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-120]
Reversibly deformable and tunable liquid-metal based plasmonics,JinqiWang,ShuchangLiu,Z.ValyVardeny,AjayNahata,TheUniv.ofUtah(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-121]
Polarization modulation the plasmonic response of nanospirals,JedI.Ziegler,RichardF.Haglund,Jr.,VanderbiltUniv.(UnitedStates) . . . [8457-122]
Local Raman field in semicontinuous metal films and SERS,AndreyK.Sarychev,InstituteforTheoreticalandAppliedElectrodynamics(RussianFederation);SergeiBoyarintsev,MoscowInstituteofPhysicsandTechnology(RussianFederation). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-123]
Engineering SERS substrates with tolerance towards disorder using coupled plasmonic resonators with a refractive index gradient that spans negative to positive values,ZacharyA.Sechrist,NavalAirWarfareCtr.WeaponsDiv.(UnitedStates);RonaldJ.Tonucci,NavyResearchLab.(UnitedStates);LeeR.Cambrea,NavalAirWarfareCtr.WeaponsDiv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-124]
Multispectral Fano resonances in hybridized metamaterials,AlpArtar,AhmetA.Yanik,HaticeAltug,BostonUniv.(UnitedStates) . . . . . . . . . . . . . [8457-125]
Hollow, gold−silica, double-shell nanospheres: synthesis, optical characterization, and β-glucose detection utilizing surface enhanced Raman scattering,TzararaLópez-Luke,Ctr.deInvestigacionesenÓptica,A.C.(Mexico);DamonA.Wheeler,Univ.ofCalifornia,SantaCruz(UnitedStates);ElderDelaRosa,Ctr.deInvestigacionesenÓptica,A.C.(Mexico);StaciA.Adams,Univ.ofCalifornia,SantaCruz(UnitedStates);AlejandroTorres,Univ.AutonaomadeNuevoLeon(Mexico);BrucePhebus,Univ.AutónomadeNuevoLeón(Mexico);JinZ.Zhang,Univ.ofCalifornia,SantaCruz(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-126]
Dielectric-plasmon coupling effects to enhance molecular displacement measurements within the near-field of subwavelength optical waveguides,DonaldSirbuly,IlsunYoon,Univ.ofCalifornia,SanDiego(UnitedStates);SarahBaker,LawrenceLivermoreNationalLab.(UnitedStates). . . . . . . . . [8457-127]
Large-area self-assembly of anisotropic nanoparticle arrays for plasmonically enhanced Raman scattering,RichardM.Osgood,PeterStenhouse,CaitlinQuigley,JoelCarlson,MeganHoey,KatarinaLopez,U.S.ArmyNatickSoldierResearch,DevelopmentandEngineeringCtr.(UnitedStates);StevenKooi,MITInstituteforSoldierNanotechnologies(UnitedStates);MirceaCotlet,OlegGang,BrookhavenNationalLab.(UnitedStates);LaurenArmstrong,ChristopherHaines,DeepakKapoor,U.S.ArmyArmamentResearch,DevelopmentandEngineeringCtr.(UnitedStates)............... [8457-128]
Hybrid metal-photonic crystal-based waveguide and cavities,ShrutiSingh,VenusDillu,RavindraK.Sinha,DelhiTechnologicalUniv.(India). . . . [8457-129]
Investigation of surface plasmonic extraordinary transmission for spectral, polarimetric, and off-normal incidence,SpencerR.Sellers,JasonC.Vap,StephenE.Nauyoks,MichaelA.Marciniak,AirForceInstituteofTechnology(UnitedStates);ZahyunKu,AirForceResearchLab.(UnitedStates) [8457-130]
Pitch-dependent resonances and near-field coupling in nanoantenna arrays,BlakeS.Simpkins,JeffOwrutsky,JamesP.Long,NavalResearchLab.(UnitedStates);JunpengGuo,Univ.ofAlabama,Huntsville(UnitedStates);JoshuaCaldwell,NavalResearchLab.(UnitedStates) . . . . . . . . . . . [8457-131]
Free-standing guided-mode resonance band-pass filters: from 1D to 2D structures,EmilieSakat,GrégoryVincent,ONERA(France);PetruGhenuche,NathalieBardou,StéphaneCollin,FabricePardo,Jean-LucPelouard,Lab.dePhotoniqueetdeNanostructures(France);RiadHaïdar,ONERA(France). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-132]
Metamaterials with multiple resonances towards complex optical functionalities,Ta-JenYen,NationalTsingHuaUniv.(Taiwan). . . . [8457-133]
Control of plasmon dynamics in coupled hybrid-mode microcavities,NorbertoD.LanzillottiKimura,Univ.ofCalifornia,Berkeley(UnitedStates);ThomasZentgraf,Univ.ofPaderborn(Germany);XiangZhang,Univ.ofCalifornia,Berkeley(UnitedStates)andLawrenceBerkeleyNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-134]
A polychromatic approach to far-field superlensing in the visible,FabriceLemoult,MathiasFink,GeoffroyLerosey,L’InstitutLangevin(France)[8457-135]
Fabrication of metallic nanostructures by multi-photon direct writing technique,Hong-ZhongCao,Wei-ErLu,Yong-LiangZhang,TechnicalInstituteofPhysicsandChemistry(China);Mei-LingZheng,TchenicalInstituteofPhysicsandChemistry(China);Zhen-ShengZhao,Xuan-MingDuan,TechnicalInstituteofPhysicsandChemistry(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-136]
Angular momentum control of enhancement and torque at nano-scale,LorenzoRosa,SwinburneUniv.ofTechnology(Australia);EtienneBrasselet,Univ.deBordeaux(France);SauliusJuodkazis,SwinburneUniv.ofTechnology(Australia)andMelbourneCtr.forNanofabrication(Australia) . . . . . . [8457-137]
Towards plasmonic metamaterials with tailorable nonlinear properties,MarttiKauranen,RobertCzaplicki,HannuHusu,JouniMäkitalo,TampereUniv.ofTechnology(Finland);MarkkuKuittinen,JanneLaukkanen,JoonasLehtolahti,Univ.ofEasternFinland(Finland). . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-138]
Long-range coupling of single atoms mediated by metallic nano-wires and metamaterials: collective decay rate modifications and level shifts,DavidDzsotjan,ResearchInstituteforSolidStatePhysicsandOptics(Hungary);MichaelFleischhauer,TechnischeUniv.Kaiserslautern(Germany). . [8457-139]
Investigation of surface-plasmon propagation in gold nanowires by combined dark-field spectroscopy and surface-enhanced Raman scattering,AnneDébarre,PriyaVasanthakumar,Lab.AiméCotton(France);MatthieuLoumaigne,Lab.deSpectrométrieIoniqueetMoléculaire(France). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-140]
Experimental demonstration of plasmonic-grating-assisted optical biosensor,MariaAntoniettaVincenti,TheAEgisTechnologiesGroup,Inc.(UnitedStates);MarcoGrande,PolitecnicodiBari(Italy);DomenicodeCeglia,TheAEgisTechnologiesGroup,Inc.(UnitedStates);TizianaStomeo,IstitutoItalianodiTecnologia(Italy);MassimoDeVittorio,ItalianInstituteofTechnology(Italy);VincenzoPetruzzelli,AntonellaD’Orazio,PolitecnicodiBari(Italy);MichaelScalora,U.S.ArmyAviationandMissileCommand(UnitedStates) . [8457-141]
Near-field switching and focusing using half spiral nanoslit for circular polarization,EngHuatKhoo,VivekDixit,A*STARInstituteofHighPerformanceComputing(Singapore). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-142]
Surface plasmon enhancement of photon extraction efficiency by silver nanoparticles: with applications in laser cooling of semiconductors,ImanHassaniNia,OmerG.Memis,HoomanMohseni,NorthwesternUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-143]
Plasmonic anti-Hermitian coupling for light nano-manipulation,ZiliangYe,ShuangZhang,YuanWang,YongshikPark,GuyBartal,XiaoboYin,XiangZhang,Univ.ofCalifornia,Berkeley(UnitedStates). . . . . . . . . . . . . . [8457-144]
Material- and geometry-independent multishell cloaking device,PattabhirajuC.Mundru,VenkateshK.Pappakrishnan,DentchoA.Genov,LouisianaTechUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-145]
Far-field nano-focusing of radially polarised light using a plasmonic lens,PriyamvadaVenugopalan,XiangpingLi,QimingZhang,SwinburneUniv.ofTechnology(Australia);HaofeiShi,Univ.ofMichigan(UnitedStates);MinGu,SwinburneUniv.ofTechnology(Australia). . . . . . . . . . . . . . . . . . . . . [8457-146]
Power-independent wavelength determination and multi-spectral deconvolution in metal-insulator-metal devices,FumingWang,StanfordUniv.(UnitedStates);NicholasMelosh,StanfordUniv(UnitedStates). . . . [8457-147]
Plasmon mapping of individual ion-shaped nanoparticles,AbdallahSlablab,Pierre-EugèneCoulon,GiancarloRizza,SandrinePerruchas,ThierryGacoin,Ecolepolytechnique(France);ArthurLosquin,Univ.ParisSudXI(France);IsabelleMonnet,JulienCardin,ChristianDufour,CIMAP(France). . . [8457-148]
Mueller matrix ellipsometry on closed-ring and split-ring resonators,BrunoGompf,BarbaraKrausz,BettinaFrank,MartinDressel,Univ.Stuttgart(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-149]
Active resonance tuning of stretchable plasmonic structures,XiaolongZhu,SanshuiXiao,TechnicalUniv.ofDenmark(Denmark);N.AsgerMortensen,TechnicalUniv.ofDenmark(UnitedStates). . . . . . . . . . . . . . . . . . . . [8457-150]
Thursday 16 AugustSESSION 15 . . . . . . . . . . . . . . . . . . . . . . Thurs. 8:00 to 10:25 am
Novel Plasmonic Systems and Phenomena IIISession Chair: Meir Orenstein, Technion-IsraelInstituteofTechnology
(Israel)
Active nanophotonics: in a search for a small laser (Keynote Presentation),YeshaiahuFainman,Univ.ofCalifornia,SanDiego(UnitedStates). . . [8457-57]
Three-dimensional resonant guided wave networks,StanleyP.Burgos,EyalFeigenbaum,HarryA.Atwater,CaliforniaInstituteofTechnology(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-58]
Controlling surface plasmon interference and propagation in silver nanowire networks (Invited Paper),HongxingXu,InstituteofPhysics(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-59]
Conference 8457
38 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Modifying the plasmonic coupling efficiency of optical antennae by reducing reproducibly the gap size to 5nm via He focused ion beam milling,MauroMelli,MatteoCornaglia,TheMolecularFoundry(UnitedStates);ChoungHuynh,LarryScipioni,CarlZeissMicroscopyLLC(UnitedStates);FrankOgletree,P.JamesSchuck,StefanoCabrini,AlexanderWeber-Bargioni,TheMolecularFoundry(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-60]
Interesting and unusual properties of plasmon excitations evolving in free-metal nanoclusters (Invited Paper),VitalyV.Kresin,Univ.ofSouthernCalifornia(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-61]
SESSION 16 . . . . . . . . . . . . . . . . . . Thurs. 10:55 am to 12:30 pm
Enhanced Radiative Processes in PlasmonicsSession Chair: Mark Brongersma, GeballeLab.forAdvancedMaterials
(GLAM)(UnitedStates)
Molecular plasmonics and its application to nanochemistry, biosensing, and single-photon sources (Keynote Presentation),RomainQuidant,ICFO-InstitutdeCiènciesFotòniques(Spain). . . . . . . . . . . . . . . . . . . . . . . . . [8457-62]
Design of nanoantennas for fluorescence enhancement in the ultraviolet,XiaojinJiao,SteveBlair,Univ.ofUtah(UnitedStates). . . . . . . . . . . . . [8457-63]
Plasmon-assisted luminescence from metal nanostructures (Invited Paper),TigranV.Shahbazyan,JacksonStateUniv.(UnitedStates). . . . . . . . . [8457-64]
Lunch/Exhibition Break.............................. 12:30to1:45pm
SESSION 17 . . . . . . . . . . . . . . . . . . . . . . . Thurs. 1:45 to 3:30 pm
Plasmonics ApplicationsSession Chair: Romain Quidant, ICFO-InstitutdeCiènciesFotòniques
(Spain)
Antenna electrodes for optical sources and solar cells (Keynote Presentation),MarkL.Brongersma,StanfordUniv.(UnitedStates). . . [8457-65]
Investigation of the optical properties of plasmonic color filter for CMOS image sensor application,SozoYokogawa,StanleyP.Burgos,HarryA.Atwater,CaliforniaInstituteofTechnology(UnitedStates). . . . . . . . . . [8457-66]
Surface nanostructures for broadband and wide-angle response absorption enhancements in thin-film GaAs solar cells,RagipPala,DennisCallahan,AltaFang,CaliforniaInstituteofTechnology(UnitedStates);PierpaoloSpinelli,FOMInstituteforAtomicandMolecularPhysics(Netherlands);AlbertPolman,FOMInstituteAMOLF(Netherlands);HarryA.Atwater,CaliforniaInstituteofTechnology(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-67]
A silicon nanowire plasmonic photodetector integrated with resonant Au nanoantennas,Sang-WonJee,KeyaZhou,Jin-YoungJung,Han-DonUm,Kwang-TaePark,Min-JoonPark,HanyangUniv.(Korea,Republicof);Dong-WookKim,EwhaWomansUniv.(Korea,Republicof);Jung-HoLee,HanyangUniv.(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-68]
SESSION 18 . . . . . . . . . . . . . . . . . . . . . . . Thurs. 4:00 to 5:50 pm
Recent Progress in PlasmonicsSession Chair: Hongxing Xu, InstituteofPhysics(China)
Three-dimensional light manipulation by gold nanobumps (Invited Paper),DinPingTsai,ChiaMinChang,MingLunTseng,Yao-WeiHuang,HsinWeiHuang,Ding-WeiHuang,NationalTaiwanUniv.(Taiwan). . . . . . . . . . . . . . . . . [8457-69]
Femtosecond laser fabrication of gold nanorod and polymer composite microstructures (Invited Paper),KyokoMasui,SatoruShoji,OsakaUniv.(Japan);ShotaUshiba,OsakaUniv.(UnitedStates);Xuan-MingDuan,ChineseAcademyofSciences(China);SatoshiKawata,OsakaUniv.(Japan)andRIKEN(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-70]
Collective plasmon modes in nanoparticle assemblies: role of disorder, energy transport, and active modulation (Invited Paper),StephanLink,RiceUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-71]
Revealing the electromagnetic mechanism of coherent light scattering in a single hot spot of plasmonic nanoantennas,PabloAlbellaEchave,CentrodeFisicadeMateriales(Spain);PabloAlonso-González,MartinSchnell,JianingChen,FlorianHuth,CICnanoGUNEConsolider(Spain);AitzolGarcía-Etxarri,StanfordUniv.(UnitedStates);FelixCasanova,FedericoGolmar,LibeArzubiaga,LuisE.Hueso,CICnanoGUNEConsolider(Spain);JavierAizpurua,CentrodeFisicadeMateriales(Spain);RainerHillenbrand,CICnanoGUNEConsolider(Spain). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8457-72]
Conference 8457
spie.org/opadvance · TEL:+13606763290 · help@spie.org 39
Conference 8458Sunday-Thursday 12-16 August 2012 • Proceedings of SPIE Vol. 8458
Optical Trapping and Optical Micromanipulation IXConference Chairs:Kishan Dholakia, Univ.ofSt.Andrews(UnitedKingdom);Gabriel C. Spalding, IllinoisWesleyanUniv.(UnitedStates
Program Committee:Clemens Bechinger, Univ.Stuttgart(Germany);Yann R. Chemla, Univ.ofIllinoisatUrbana-Champaign(UnitedStates);Arthur E. T. Chiou, NationalYang-MingUniv.(Taiwan);Roberto Di Leonardo, Univ.degliStudidiRomaLaSapienza(Italy);Jesper Glückstad, TechnicalUniv.ofDenmark(Denmark);Min Gu, SwinburneUniv.ofTechnology(Australia);Sean J. Hart, U.S.NavalResearchLab.(UnitedStates);Carlos Lenz Cesar, Univ.EstadualdeCampinas(Brazil);Carlos López-Mariscal, U.S.NavalResearchLab.(UnitedStates);Masud Mansuripur, CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates);Jens-Christian D. Meiners, Univ.ofMichigan(UnitedStates);H. Daniel Ou-Yang, LehighUniv.(UnitedStates);Thomas T. Perkins, Univ.ofColoradoatBoulder(UnitedStates);Rubén Ramos-Garcia, InstitutoNacionaldeAstrofísica,ÓpticayElectrónica(Mexico);Halina Rubinsztein-Dunlop, TheUniv.ofQueensland(Australia);Christopher C. Schmidt, Univ.ofWisconsin-Madison(UnitedStates);Ming Hsien Wu, HamamatsuCorp.(UnitedStates);Pavel Zemánek, InstituteofScientificInstrumentsoftheASCR,v.v.i.(CzechRepublic)
Sunday 12 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 8:10 to 10:00 am
Foundations of the Electromagnetic Theory of Force and Momentum
Session Chair: Michael Mazilu, Univ.ofSt.Andrews(UnitedKingdom)
Optical forces in highly dispersive (slow-light) media (Invited Paper),RobertW.Boyd,Univ.ofOttawa(Canada)andUniv.ofRochester(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-01]
Subsystem approach to the electrodynamics in dielectric fluids (Invited Paper),BrandonA.Kemp,ArkansasStateUniv.(UnitedStates). . . . . [8458-02]
Electromagnetic momentum in a dielectric and the energy-momentum tensor (Invited Paper),MichaelE.Crenshaw,ThomasB.Bahder,U.S.ArmyAviationandMissileCommand(UnitedStates) . . . . . . . . . . . . . . . . . . [8458-03]
Radiation pressure on a submerged partial reflector deduced from the Doppler shift,MasudMansuripur,CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates);ArmisR.Zakharian,CorningIncorporated(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-04]
SESSION 2 . . . . . . . . . . . . . . . . . . . . . Sun. 10:15 am to 12:35 pm
Toward (or in) the Quantum Limit of Opto-MechanicsSession Chair: Oskar J. Painter, CaliforniaInstituteofTechnology
(UnitedStates)
There will be a short course related to the subject of this session, titled “Shaped Light” (SC1043), taught by Kishan Dholakia and Gabriel Spalding. Please see
page 210 for details.
Conference attendees are also welcome to attend the NanoScience + Engineering Plenary Session on Monday, 13 August, between 8:30 am and
12:00 pm, featuring Dr. Oskar Painter’s presentation titled, “The Light and Sound Fantastic: Radiation Pressure at the Nanoscale”. Please see page 9 for details.
Hybrid optonanomechanical near-field transducers for ultra-sensitive force measurements (Invited Paper),E.Gavartin,P.Verlot,L.Neuhaus,TobiasJ.Kippenberg,EcolePolytechniqueFédéraledeLausanne(Switzerland)[8458-05]
Cavity optomechanics with low-noise crystalline mirrors (Invited Paper),GarrettD.Cole,Univ.Wien(Austria). . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-06]
Cooling optically trapped particles (Invited Paper),PeterBarker,Univ.CollegeLondon(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-07]
Resonance enhanced optical manipulation: the push and pull of light,MichaelMazilu,KishanDholakia,Univ.ofSt.Andrews(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-08]
Theory and simulation of an optical spring mirror (Invited Paper),EwanM.Wright,CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates);MichaelMazilu,Univ.ofStAndrews(UnitedKingdom);SwatiSingh,TheUniv.ofArizona(UnitedStates);KishanDholakia,Univ.ofSt.Andrews(UnitedKingdom);PierreMeystre,TheUniv.ofArizona(UnitedStates) . . . . . . . . . . . . . . [8458-09]
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:35to1:50pm
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 1:50 to 3:10 pm
Statistical MechanicsSession Chair: Halina Rubinsztein-Dunlop, TheUniv.ofQueensland
(Australia)
Optical trapping and cooling of glass microspheres (Invited Paper),MarkG.Raizen,TheUniv.ofTexasatAustin(UnitedStates) . . . . . . . . . . . . . . [8458-10]
Dissipation and the foundations of statistical thermodynamics (Invited Paper),DenisJ.Evans,TheAustralianNationalUniv.(Australia). . . . . [8458-11]
Quantum-enhanced sensing of biological objects with optical tweezers,MichaelA.Taylor,TheUniv.ofQueensland(Australia);JiriJanousek,VincentR.Daria,TheAustralianNationalUniv.(Australia);JoachimKnittel,TheUniv.ofQueensland(Australia);BorisHage,Hans-AlbertBachor,TheAustralianNationalUniv.(Australia);WarwickP.Bowen,TheUniv.ofQueensland(Australia). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-12]
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 3:30 to 5:50 pm
Application of Exquisite Optical MeasurementsSession Chair: H. Daniel Ou-Yang, LehighUniv.(UnitedStates)
Optical mass sensing with coupled nanomechanical resonator systems (Invited Paper),Ka-DiZhu,ShanghaiJiaoTongUniv.(China) . . . . . . . [8458-13]
Forces and torques on the nanoscale: from measurement to applications (Invited Paper),GiovanniVolpe,BilkentUniv.(Turkey). . . . . . . . . . . . . [8458-14]
Femtonewton magnetic interaction between Brownian particles probed by optical tweezers,MariaN.Skryabina,EvgenyV.Lyubin,MariaD.Khokhlova,AndreyA.Fedyanin,LomonosovMoscowStateUniv.(RussianFederation) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-15]
Power spectral density integration analysis and its application to large bandwidth, high-precision position measurements,MartinKochanczyk,TobiasBartsch,TheUniv.ofTexasatAustin(UnitedStates);KatjaTaute,FOMInstituteforAtomicandMolecularPhysics(Netherlands);Ernst-LudwigFlorin,TheUniv.ofTexasatAustin(UnitedStates). . . . . . . . . . . . . . . . . . . . . [8458-16]
Power spectrum analysis for optical tweezers: no, you don’t just do a least squares fit!,HenrikK.Flyvbjerg,TechnicalUniv.ofDenmark(Denmark);SimonF.Nørrelykke,PrincetonUniv.(UnitedStates)andMPIfürPhysikkomplexerSysteme(Germany). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-17]
Interaction dynamics of colloidal particles in an optical light tube,BenjaminTränkle,AlexanderRohrbach,Albert-Ludwigs-Univ.Freiburg(Germany)[8458-18]
Symposium-Wide Plenary Session . . . . . . . . . . . . . . . . . . . . Sun. 6:00 to 7:25 pm6:00pm: Introduction and Opening Remarks
6:05pm: The Exciting Science of Light with Metamaterials, VladimirM.Shalaev,PurdueUniv.(USA)
6:45pm:Future of Optics and Photonics, BahaaE.A.Saleh,CREOL,TheCollegeofOpitcsandPhotonicsattheUniv.ofCentralFlorida(USA)
40 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Monday 13 AugustNanoScience + Engineering Plenary Session . . . . . . . . . . . . . . . Mon. 8:30 am to 12:00 pm
Session Chairs:Satoshi Kawata,OsakaUniv.(Japan)and Manijeh Razeghi, NorthwesternUniv.(USA)
8:30am:The Light and Sound Fantastic: Radiation Pressure at the Nanoscale, OskarPainter,CaliforniaInstituteofTechnology(USA)
9:15am:Organics and Nanostructures for Nonlinear Optics, NasserPeyghambarian,CollegeofOpticalSciences,TheUniv.ofArizona(USA)
CoffeeBreak . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10:00to10:30am
10:30am:From Nanophotonics, to Metaphotonics, to Dynamic Photonics: Controlling Light Propagation and Light-Matter Interactions for Emerging Technologies, ParasPrasad,Univ.atBuffalo(USA)
11:15am:Global Activities in Novel-Nano Magnetic Materials for Magnetic, Optoelectronics Applications,MisoonMah,AsianOfficeofAerospaceDevelopment(Japan)
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:00to1:30pm
SESSION 5 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 1:30 to 5:25 pm
Special Session in Honor of Michael W. BernsSession Chair: Halina Rubinsztein-Dunlop, TheUniv.ofQueensland
(Australia)
Laser tweezers and scissors: a photonic toolbox to study cells and their organelles (Invited Paper),MichaelW.Berns,BeckmanLaserInstituteandMedicalClinic(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-19]
Optical manipulation of cells and tissues by ultrashort laser pulses (Invited Paper),AlexanderHeisterkamp,Friedrich-Schiller-Univ.Jena(Germany);JudithKrawinkel,TobiasEhmke,Friedrich-Schiller-UnivJena(Germany);DagHeinemann,MarkusSchomaker,HeikoMeyer,LaserZentrumHannovere.V.(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-20]
Femtosecond laser surgery on a chip shedding light on nerve regeneration (Invited Paper),AdelaBen-Yakar,TheUniv.ofTexasatAustin(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-21]
The influence of femtosecond laser pulse wavelength on embryonic stem cell differentiation,PatienceMthunzi,CouncilforScientificandIndustrialResearch(SouthAfrica). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-22]
Analysis of cell poration by femtosecond laser for particle insertion by optical manipulation,WaleedMuhammad,Jung-DaeKim,Yong-GuLee,GwangjuInstituteofScienceandTechnology(Korea,Republicof). . . [8458-23]
New directions in femtosecond optical transfection,MaciejK.Antkowiak,MariaLeilaniY.Torres-Mapa,FrankJ.Gunn-Moore,KishanDholakia,Univ.ofSt.Andrews(UnitedKingdom) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-24]
Directing growth cones of optic axons growing with laser scissors and laser tweezers (Invited Paper),TaoWu,Univ.ofCalifornia,Irvine(UnitedStates);TimoA.Nieminen,TheUniv.ofQueensland(Australia);SamarendraK.Mohanty,JillMiotke,RonaldL.Meyer,Univ.ofCalifornia,Irvine(UnitedStates);HalinaRubinsztein-Dunlop,TheUniv.ofQueensland(Australia);MichaelW.Berns,Univ.ofCalifornia,Irvine(UnitedStates). . . . . . . . . . . . . . . . . . [8458-25]
Highly efficient and fully controlled guidance of neurons using laser,BryanJ.Black,LingGu,SamarendraK.Mohanty,TheUniv.ofTexasatArlington(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-26]
Optical tweezers in a multimodal photonic microscopy and spectroscopy platform,VitorB.Pelegati,AndréA.deThomaz,DiogoB.Almeida,JavierF.Adur,MarianaO.Baratti,HernandesF.Carvalho,CarlosLenz-Cesar,Univ.EstadualdeCampinas(Brazil)................................ [8458-27]
Tuesday 14 AugustSESSION 6 . . . . . . . . . . . . . . . . . . . . . . . . Tues. 8:00 to 10:30 am
Optical Studies of Cellular MechanicsSession Chair: Michael W. Berns, BeckmanLaserInstituteandMedical
Clinic(UnitedStates)
The optical stretcher: are biomechanical changes necessary for tumor progression? (Invited Paper),JosefA.Käs,Univ.Leipzig(Germany). [8458-28]
Elastic properties of red cell membrane studied by double-trap optical tweezers technique,MariaKhokhlova,EvgenyV.Lyubin,MariaN.Skryabina,AndreyA.Fedyanin,LomonosovMoscowStateUniv.(RussianFederation) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-29]
Zeta potentials of stored red blood cells by using optical tweezers,DiegoC.N.Silva,CauehJovino,CarlosSilva,Univ.FederaldePernambuco(Brazil);HeloiseP.Fernandes,Univ.EstadualdeCampinas(Brazil);SheilaLucena,AnaCosta,FundaçâoHemope(Brazil);MariadeLourdesBarjasCastro,CarlosLenz-Cesar,Univ.EstadualdeCampinas(Brazil);BeateS.Santos,AdrianaFontes,Univ.FederaldePernambuco(Brazil). . . . . . . . . . . . . . . . . . . . . . . . . . [8458-30]
Comparison of modified pericellular matrices using optical force probe microscopy,LouisT.McLane,PatrickChang,GeorgiaInstituteofTechnology(UnitedStates);AnnaGranqvist,SahlgrenskaUniv.Hospital(Sweden);AnthonyKramer,JenniferE.Curtis,GeorgiaInstituteofTechnology(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-31]
Towards a comprehensive understanding of the dynamics of neurosecretory vesicles,GeorgWissmeyer,TheUniv.ofQueensland(Australia)andLudwig-Maximilians-Univ.München(Germany);DarylC.Preece,FredericMeunier,TimoA.Nieminen,HalinaRubinsztein-Dunlop,TheUniv.ofQueensland(Australia). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-32]
Optical trapping and photothermal heating of gold nanoparticles used for controlled vesicle cargo release,AndersKyrsting,PoulMartinBendix,LeneB.Oddershede,Univ.ofCopenhagen(Denmark). . . . . . . . . . . . . . . . . . . [8458-33]
Induction of sustained glycolytic oscillations in single yeast cells using microfluidics and optical tweezers,Anna-KarinGustavsson,CarolineBeck,MattiasGoksör,Univ.ofGothenburg(Sweden). . . . . . . . . . . . . . . . . . [8458-34]
SESSION 7 . . . . . . . . . . . . . . . . . . . . Tues. 10:55 am to 12:15 pm
Optical Microrheology for Biological SystemsSession Chair: Josef A. Käs, Univ.Leipzig(Germany)
Non-equilibrium intracellular microrheology in living cells,Ming-TzoWei,H.DanielOu-Yang,LehighUniv.(UnitedStates) . . . . . . . . . . . . . . . . . . . [8458-35]
Extracellular matrix characterization by optical-tweezers-based active microrheology (AMR) for cardiomyocytes cultures,MarthaB.Alvarez-Elizondo,ElliotL.Botvinick,Univ.ofCalifornia,Irvine(UnitedStates). [8458-36]
Pico-litre microrheology measured using vaterite microspheres,JamesBennet,RoryKelly,LachlanGibson,TimothyNicholson,DarylC.Preece,TimoA.Nieminen,HalinaRubinsztein-Dunlop,TheUniv.ofQueensland(Australia). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-37]
Angular dynamics at the nm-scale probed with the optical torque wrench,FrancescoPedaci,MaartenvanOene,ZhuangxiongHuang,NynkeH.Dekker,TechnischeUniv.Delft(Netherlands) . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-38]
Lunch/Exhibition Break.............................. 12:15to1:45pm
SESSION 8 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 1:45 to 4:40 pm
Optical Manipulation of Single MoleculesSession Chair: Thomas T. Perkins, JILA(UnitedStates)
Microfluidics and holographic optical tweezers to simulate metabolite-protein channel binding sites,StefanoPagliara,UlrichF.Keyser,Univ.ofCambridge(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-39]
Real-time single molecule translation,MaurizoRighini,ChristianKaiser,DanielH.Goldman,CarlosJ.Bustamante,Univ.ofCalifornia,Berkeley(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-40]
In vivo optical trapping reveals kinesin drags dynein during intracellular transport,PaulR.Selvin,BenjaminH.Blehm,YannR.Chemla,Univ.ofIllinoisatUrbana-Champaign(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . [8458-41]
Characterizing the effects of transcription factor TFIIS on RNA polymerase II at the single molecule level,TroyA.Lionberger,Univ.ofCalifornia,Berkeley(UnitedStates)andHowardHughesMedicalInstitute(UnitedStates);ToyotakaIshibashi,ManchutaDangkulwanich,YvesP.Coello,Univ.ofCalifornia,Berkeley(UnitedStates);CarlosJ.Bustamante,Univ.ofCalifornia,Berkeley(UnitedStates)andHowardHughesMedicalInstitute(UnitedStates). . . . . . . [8458-42]
DNA sequence and elasticity,KrishnanRaghunathan,AlanKandinov,DavidWilson,Univ.ofMichigan(UnitedStates);JoshuaN.Milstein,Univ.ofToronto(Canada);Jens-ChristianD.Meiners,Univ.ofMichigan(UnitedStates)[8458-43]
Dynamics of overstretching DNA and dye: DNA interactions (Invited Paper),DanielH.Paik,ThomasT.Perkins,JILA(UnitedStates) . . . . . . . . . . . [8458-44]
Single-molecule studies of the effect of spermidine on DNA mechanics and viral DNA packaging,NicholasA.Keller,DouglasE.Smith,Univ.ofCalifornia,SanDiego(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-45]
Conference 8458
spie.org/opadvance · TEL:+13606763290 · help@spie.org 41
SESSION 9 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 4:40 to 5:40 pm
Approaches with Advanced StructuresSession Chair: Jesper Glückstad, TechnicalUniv.ofDenmark
(Denmark)
Controlled photonic manipulation of proteins and other nanomaterials,DavidErickson,CornellUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . [8458-46]
Optical trapping of particle arrays via guided resonance modes in a novel photonic crystal lattice,JingMa,LuisJ.MartínezRodriguez,MichelleL.Povinelli,TheUniv.ofSouthernCalifornia(UnitedStates). . . . . . . . . . [8458-47]
Miniaturized micromechanical valves for microfluidic very large scale integration (mVLSI),IsmailE.Araci,StephenR.Quake,StanfordUniv.(UnitedStates)andHowardHughesMedicalInstitute(UnitedStates). . . . . . . [8458-48]
Wednesday 15 AugustSESSION 10 . . . . . . . . . . . . . . . . . . . . . . . .Wed. 8:00 to 10:00 am
Combining Optical Traps with AcousticsSession Chair: Graham W. J. Brodie, Univ.ofDundee(UnitedKingdom)
Localizing nanoscale sound sources with optically trapped gold nanoparticles (Invited Paper),SpasNedev,SilkeSilkeKirchner,AlexanderOhlinger,AndrasDeak,AndreyA.Lutich,TheobaldLohmüller,FrankJäckel,JochenFeldmann,Ludwig-Maximilians-Univ.München(Germany). . . [8458-49]
Optical stretching on chip with acoustophoretic prefocusing,MariaKhoury,RuneBarnkob,PeterTidemand-Lichtenberg,HenrikBruus,KirstineBerg-Sørensen,TechnicalUniv.ofDenmark(Denmark). . . . . . . . . . . . . . . . [8458-50]
Trapping and deformation of microbubbles in a dual-beam fibre-optic trap,SusanE.Skelton,MariosSergides,Univ.CollegeLondon(UnitedKingdom);GianlucaM.Memoli,NationalPhysicalLab.(UnitedKingdom);OnofrioM.Marago,IstitutoperiProcessiChimico-Fisici(Italy);PhilipH.Jones,Univ.CollegeLondon(UnitedKingdom) . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-51]
Cavitation dynamics of laser-induced breakdown of an optically trapped nanoparticle and cellular response to cavitation-induced shear stress,YoshihikoArita,UniversityofSt.Andrews(UnitedKingdom);MaciejK.Antkowiak,MariaLeilaniY.Torres-Mapa,TomásCizmár,Univ.ofSt.Andrews(UnitedKingdom);WoeiMingLee,MassachusettsGeneralHospital(UnitedStates);VasanVenugopalan,Univ.ofCalifornia,Irvine(UnitedStates);PaulA.Campbell,Univ.ofDundee(UnitedKingdom);FrankJ.Gunn-Moore,KishanDholakia,Univ.ofSt.Andrews(UnitedKingdom). . . . . . . . . . . . . . . . . [8458-52]
Microfluidic particle sorting assisted by optical and acoustic fields (Invited Paper),GregorThalhammer,RuthSteiger,StefanBernet,MonikaRitsch-Marte,InnsbruckMedicalUniv.(Austria). . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-53]
SESSION 11 . . . . . . . . . . . . . . . . . . . . . . .Wed. 10:15 to 11:55 am
Self-Assembly of Driven SystemsSession Chair: Michael P. MacDonald, InstituteforMedicalScience&
Technology(UnitedKingdom)
Dynamics of self-driven particles on periodic and random arrays,CynthiaJ.OlsonReichhardt,JeffreyDrocco,CharlesM.Reichhardt,LosAlamosNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-54]
An experimental study of single-file-diffusion in a driven colloidal suspension,YaelRoichman,TalMaya,TelAvivUniv.(Israel). . . . . . . [8458-55]
Statics and dynamics of wetting-dewetting transitions for particles with attractive interactions on periodic substrates,CharlesM.Reichhardt,JeffreyDrocco,CynthiaJ.OlsonReichhardt,AlanR.Bishop,LosAlamosNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-56]
Faster optical delivery of self-arranged multi-particle cluster,MartinSiler,InstituteofScientificInstrumentsoftheASCR,v.v.i.(CzechRepublic);TomásCizmár,Univ.ofSt.Andrews(UnitedKingdom);PavelZemanek,InstituteofScientificInstrumentsoftheASCR,v.v.i.(CzechRepublic). . . . . . . . . [8458-57]
Passive optical sorting of gold nanoparticles,MartinPloschner,TomásCizmár,MichaelMazilu,AndreadiFalco,KishanDholakia,Univ.ofSt.Andrews(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-58]
Lunch/Exhibition Break........................... 11:55amto1:30pm
SESSION 12 . . . . . . . . . . . . . . . . . . . . . . . . Wed. 1:30 to 3:10 pm
Trapping Nanoscale DielectricsSession Chair: Masud Mansuripur, CollegeofOpticalSciences,The
Univ.ofArizona(UnitedStates)
In situ characterization of optically trapped nanoscale objects using dynamic optical tweezers and spectroscopic interrogation (Invited Paper),PeterJ.Reece,FanWang,WenJunToe,KelliePearce,TheUniv.ofNewSouthWales(Australia);HarkHoeTan,ChennupatiJagadish,TheAustralianNationalUniv.(Australia). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-59]
Position and orientation tracking of nanorods,MarkusGriesshammer,AlexanderRohrbach,Albert-Ludwigs-Univ.Freiburg(Germany). . . . . [8458-60]
Optical trapping and sensing of 10-nm dielectric particles using a double-nanohole in a metal film (Invited Paper),ReuvenGordon,Univ.ofVictoria(Canada) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-61]
Optical trapping of an encapsulated quantum dot using a double nanohole aperture in a metal film,AnaZehtabiOskuie,JarrahBergeron,YuanjiePang,MatthewMoffitt,ReuvenGordon,Univ.ofVictoria(Canada). . . . . . . . [8458-62]
SESSION 13 . . . . . . . . . . . . . . . . . . . . . . . . Wed. 3:30 to 5:10 pm
Plasmonic Trapping and Gold NanoparticlesSession Chair: Reuven Gordon, Univ.ofVictoria(Canada)
Plasmon nano-optical tweezers and their applications to biosciences,RomainQuidant,ICFO-InstitutdeCiènciesFotòniques(Spain). . . . . [8458-63]
Measurements of extreme orientation-dependent temperature increase around an irradiated gold nanorod,HaiyanMa,PoulMartinBendix,LeneB.Oddershede,Univ.ofCopenhagen(Denmark). . . . . . . . . . . . . . . . . . . [8458-64]
Plasmon hybridization reveals the interaction between individual colloidal gold nanoparticles confined in an optical potential well,MikaelKall,ChalmersUniv.ofTechnology(Sweden);LianmingTong,ChalmersUniv.ofTechnology(Sweden)andInstituteofPhysics(China);VladimirMiljkovic,ChalmersUniv.ofTechnology(Sweden);PeterJohansson,ChalmersUniv.ofTechnology(Sweden)andOrebroUniv.(Sweden). . . . . . . . . . . . . . . . [8458-65]
Manipulation of metal nanowires using shaped optical fields,JulianSweet,ArgonneNationalLab.(UnitedStates);ZijieYan,TheUniv.ofChicago(UnitedStates);MatthewA.Pelton,ArgonneNationalLab.(UnitedStates);NorbertF.Scherer,TheUniv.ofChicago(UnitedStates). . . . . . . . . . . . . . . . . . . [8458-66]
Manipulating forces in optical vortex using plasmonic bumps,EngHuatKhoo,IftikharAhmed,A*STARInstituteofHighPerformanceComputing(Singapore) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-67]
Posters-Wednesday . . . . . . . . . . . . . . . . . Wed. 5:30 to 7:30 pmConference attendees are invited to attend the poster session on Wednesday evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
VALOR: vertical acoustic levitation with increased optical routing,GrahamW.J.Brodie,PaulO’Mahoney,Univ.ofDundee(UnitedKingdom);GabrielC.Spalding,IllinoisWesleyanUniv.(UnitedStates);MichaelP.MacDonald,Univ.ofDundee(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-90]
Acoustic Bessel beam with combined optical trapping,GrahamW.J.Brodie,DavidA.Hughes,ChristineE.M.Demore,Univ.ofDundee(UnitedKingdom);GabrielC.Spalding,IllinoisWesleyanUniv.(UnitedStates);MichaelP.MacDonald,Univ.ofDundee(UnitedKingdom). . . . . . . . . . . . . . . . [8458-91]
OET meets acoustic tweezing,ChristianWitte,RabWilson,JonathanM.Cooper,StevenL.Neale,Univ.ofGlasgow(UnitedKingdom). . . . . . . [8458-92]
Wide-field platform for studying single molecules in microscopic water droplets,KristianHelmerson,TheodorAsavei,MonashUniv.(Australia)[8458-93]
Design and evaluation of a microfluidic system for inhibition studies of yeast cell signaling,CharlotteHamngren,ChalmersUniv.ofTechnology(Sweden);PeterDinér,UppsalaUniv.(Sweden);MortenGrötli,MattiasGoksör,CarolineBeck,Univ.ofGothenburg(Sweden). . . . . . . . . . . . . . . . . . . [8458-94]
Microfluidic manipulation using coma introduced to an astigmatic optical tweezers,SamarendraK.Mohanty,DijunLuo,TheUniv.ofTexasatArlington(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-95]
Optimizing bead size improves force precision in optical traps,RebeccaK.Montange,JILA(UnitedStates);MatthewS.Bull,ElisabethR.Shanblatt,Univ.ofColoradoatBoulder(UnitedStates);ThomasT.Perkins,NationalInstituteofStandardsandTechnology(UnitedStates)andJILA(UnitedStates). . [8458-96]
Conference 8458
42 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Optical tweezers studies of structure-function relationships in the bacteriophage T4 viral packaging motor,AmyDavenport,DouglasE.Smith,Univ.ofCalifornia,SanDiego(UnitedStates). . . . . . . . . . . . . . . . . . . . [8458-97]
Mechanism of termination of bacteriophage DNA packaging investigated with optical tweezers,DamianJ.delToro,Univ.ofCalifornia,SanDiego(UnitedStates);JeanSippy,MichaelFeiss,TheUniv.ofIowa(UnitedStates);CarlosE.Catalano,Univ.ofWashingtonMedicalCtr.(UnitedStates);DouglasE.Smith,Univ.ofCalifornia,SanDiego(UnitedStates). . . . . . . . . . . . . . . . . . . . [8458-98]
Characterizing the role of stiffness in mammary tumor formation in vitro using active microrheology,AbhishekKurup,Univ.ofCalifornia,Irvine(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-99]
The gene ten-1 contributes to axon regeneration accuracy following femtosecond laser axotomy in C. elegans,DylanT.Stevens,ManojMathew,MattiasGoksör,MarcPilon,Univ.ofGothenburg(Sweden) . . . . . . . [8458-100]
Quantitative phase microscopy of cells during varied stimulation regime,BipinS.Joshi,LingGu,SamarendraK.Mohanty,TheUniv.ofTexasatArlington(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-101]
Decoupling refractive index of microscopic sample from its thickness in quantitative phase microscopy,NelsonCardenas,SamarendraK.Mohanty,TheUniv.ofTexasatArlington(UnitedStates) . . . . . . . . . . . . . . . . . [8458-102]
Optical trapping induced by reorientational nonlocal effects in nematic liquid crystals,LianaLucchetti,Univ.PolitecnicadelleMarche(Italy)[8458-103]
Optical micromanipulation of metallic-dielectric Janus microspheres,DavidM.Carberry,JamesShirtcliffe,JamesThomas,DavidB.Phillips,StephenH.Simpson,Univ.ofBristol(UnitedKingdom);RichardW.Bowman,GrahamM.Gibson,MilesJ.Padgett,Univ.ofGlasgow(UnitedKingdom);MervynJ.Miles,PaddyRoyall,Univ.ofBristol(UnitedKingdom). . . . . . . . . . . . . . . . . [8458-104]
Rotation of microscopic discs by light spin angular momentum,AlejandroV.Arzola,MartinSiler,OtoBrzobohaty,PetrJákl,PavelZemanek,InstituteofScientificInstrumentsoftheASCR,v.v.i.(CzechRepublic). . . . . . . . [8458-105]
Computational modelling of optical tweezers with many degrees of freedom using dynamic simulation: cylinders, nanowires, and multiple particles,YongyinCao,HarbinInstituteofTechnology(China)andTheUniv.ofQueensland(Australia);AlexanderB.Stilgoe,MartinStroet,VincentL.Y.Loke,TheUniv.ofQueensland(Australia);LixueChen,HarbinInstituteofTechnology(China);TimoA.Nieminen,HalinaRubinsztein-Dunlop,TheUniv.ofQueensland(Australia). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-106]
An algorithm for improved control over trap intensities in holographic optical tweezers,MartinP.Persson,DavidEngström,MattiasGoksör,Univ.ofGothenburg(Sweden). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-107]
Games console interfaces for controlling holographic optical manipulation,CraigMcDougall,CraigMacDonald,MatthewMcPherson,DavidMcGloin,Univ.ofDundee(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-108]
Fast trapping force calculation by utilizing graphic processing unit,Sheng-YangTseng,Ai-TangChang,LongHsu,Chih-WeiLuo,NationalChiaoTungUniv.(Taiwan) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-109]
Shaping of the trapping volume in optical tweezers using cylindrical vector beams,SusanE.Skelton,MariosSergides,Univ.CollegeLondon(UnitedKingdom);MariaGaraziaDonato,SebastianoVasi,RaniaSayed,PietroG.Gucciardi,IstitutoperiProcessiChimico-Fisici(Italy);RosalbaSaija,Univ.degliStudidiMessina(Italy);MariaA.Iatì,OnofrioM.Marago,IstitutoperiProcessiChimico-Fisici(Italy);PhilipH.Jones,Univ.CollegeLondon(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-110]
Optical trapping of metal-dielectric nanoparticle clusters near photonic crystal microcavities,CamiloMejiaPrada,MichelleL.Povinelli,TheUniv.ofSouthernCalifornia(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-111]
Mapping optical process in semiconductor nanowires using dynamic optical tweezers,FanWang,WenJunToe,AlexR.Hamilton,TheUniv.ofNewSouthWales(Australia);DavidMcGloin,Univ.ofDundee(UnitedKingdom);HarkHoeTan,ChennupatiJagadish,TheAustralianNationalUniv.(Australia);PeterJ.Reece,TheUniv.ofNewSouthWales(Australia). . . . . . . . . . . . . . . . [8458-112]
Raman tweezers combined with microfluidics for cell sorting applications,ZdenekPilat,SilvieBernatová,JanJezek,MojmirSery,OtaSamek,PavelZemanek,InstituteofScientificInstrumentsoftheASCR,v.v.i.(CzechRepublic). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-113]
Generation of coherence vortex networks from systems of several Mie-scattering particles,MadaraL.Marasinghe,MalinPremaratne,DavidM.Paganin,MonashUniv.(Australia). . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-114]
Femtosecond optical trapping of silica nanospheres,AnwarUsman,Wei-YiChiang,HiroshiMasuhara,NationalChiaoTungUniv.(Taiwan). . . . . [8458-115]
Low-energy femtosecond laser pulse-induced laser trapping crystallization of amino acid,AtsushiMiura,YanHuaHuang,AnwarUsman,Ken-IchiYuyama,TakayukiUwada,NationalChiaoTungUniv.(Taiwan);TerukiSugiyama,InstrumentTechnologyResearchCtr.(Taiwan);HiroshiMasuhara,NationalChiaoTungUniv.(Taiwan).................................. [8458-116]
Accumulating microparticles and direct-writing micropatterns using continuous-wave, laser-induced vapor bubble,HuiLiu,YajianZheng,GangZhao,ShiningZhu,NanjingUniv.(China). . . . . . . . . . . . . . . . . . . . . . [8458-117]
Optical and hydrodynamic characterization of cross-type optical particle separation system,KangSooLee,SangYoulYoon,SangBokKim,KyungHeonLee,HyungJinSung,SangSooKim,KAIST(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-118]
Integration of cross-type optical particle separation with hydrodynamic alignment,KyungHeonLee,SangBokKim,KangSooLee,HyungJinSung,KAIST(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-119]
Using pico-LCoS SLMs for high-speed cell sorting,JesperGlückstad,TechnicalUniv.ofDenmark(Denmark). . . . . . . . . . . . . . . . . . . . . . . . [8458-120]
Optical trapping of plasmonic core-shell particle in a 1D standing wave,LukasChvatal,MartinSiler,VitezslavKarasek,PavelZemanek,InstituteofScientificInstrumentsoftheASCR,v.v.i.(CzechRepublic). . . . . . . . [8458-121]
Plasmonic optical trapping of metal nanoparticles for SERS by utilizing gold nano-ring structure,ZhiwenKang,Ho-PuiA.Ho,TheChineseUniv.ofHongKong(HongKong,China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-122]
Two-dimensional freeform optical trapping by surface plasmon enhancement and patterned excitation,Hung-WeiSu,Shean-JenChen,NationalChengKungUniv.(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . [8458-123]
Optically bound particle structures in evanescent wave traps,MariosSergides,SusanE.Skelton,EwaKarczewska,KellyThorneycroft,Univ.CollegeLondon(UnitedKingdom);OnofrioM.Maragò,IstitutoperiProcessiChimico-Fisici(Italy);PhilipH.Jones,Univ.CollegeLondon(UnitedKingdom)[8458-124]
The role of spectral bandwidth in transverse optical binding,AndrewP.Rudhall,MichaelMazilu,JörgBaumgartl,Univ.ofSt.Andrews(UnitedKingdom);EwanM.Wright,CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates);KishanDholakia,Univ.ofSt.Andrews(UnitedKingdom). . . [8458-125]
Thursday 16 AugustSESSION 14 . . . . . . . . . . . . . . . . . . . . . . Thurs. 8:10 to 10:00 am
Optically Manipulated RoboticsSession Chair: Carlos Lenz-Cesar, Univ.EstadualdeCampinas(Brazil)
Accousto-optic deflector-based counter-propagating beam multi-trap laser micromanipulator,IgorPoberaj,DusanBabic,Univ.ofLjubljana(Slovenia);NatanOsterman,JozefStefanInstitute(Slovenia) . . . . . . . . . . . . . . . . [8458-68]
Shaping up for light-driven microrobotics (Invited Paper),DarwinPalima,AndrewRafaelM.Bañas,TechnicalUniv.ofDenmark(Denmark);GasztonVizsnyiczai,LórándKelemen,PálOrmos,BiologicalResearchCtr.(Hungary);JesperGlückstad,TechnicalUniv.ofDenmark(Denmark). . . . . . . . . . [8458-69]
WOW: light print, light propel, light point,JesperGlückstad,TechnicalUniv.ofDenmark(Denmark). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-70]
Alkaline niobate nanowires as opto-mechanical probes,FabriziaDutto,AleksandraRadenovic,EcolePolytechniqueFédéraledeLausanne(Switzerland) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-71]
Non-spherical optically trapped probes: design, control, and applications,DavidB.Phillips,StephenH.Simpson,Univ.ofBristol(UnitedKingdom);JamesA.Grieve,UniversityofBristol(UnitedKingdom);SimonHanna,Univ.ofBristol(UnitedKingdom);RichardW.Bowman,GrahamM.Gibson,MilesJ.Padgett,Univ.ofGlasgow(UnitedKingdom);MervynJ.Miles,DavidM.Carberry,Univ.ofBristol(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-72]
Conference 8458
spie.org/opadvance · TEL:+13606763290 · help@spie.org 43
SESSION 15 . . . . . . . . . . . . . . . . . . . . . Thurs. 10:30 to 11:30 am
Adaptive Optics for Optical MicromanipulationSession Chair: Gabriel C. Spalding, IllinoisWesleyanUniv.
(UnitedStates)
Multimode fibre as a light mode convertor: principles and applications,TomásCizmár,KishanDholakia,Univ.ofSt.Andrews(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-73]
Optical tweezing with nonlinear optical endoscopy,MinGu,HongchunBao,SwinburneUniv.ofTechnology(Australia). . . . . . . . . . . . . . . . . . . . . . [8458-74]
Phase-corrected, three-dimensional optical assembly,GangWang,IndianaUniv.-PurdueUniv.FortWayne(UnitedStates) . . . . . . . . . . . . . . . . . . [8458-75]
Lunch/Exhibition Break........................... 11:30amto1:00pm
SESSION 16 . . . . . . . . . . . . . . . . . . . . . . . Thurs. 1:00 to 2:20 pm
Novel Beams for Optical MicromanipulationSession Chair: Kishan Dholakia, Univ.ofSt.Andrews(UnitedKingdom)
Mapping the optical field distribution of the focal point of a tightly focused vector beam by 3D optical trapping of colloidal nanoparticles,JinxinFu,LehighUniv.(UnitedStates);LiangchengZhou,PrincetonUniv.(UnitedStates);H.DanielOu-Yang,LehighUniv.(UnitedStates);QiwenZhan,Univ.ofDayton(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-76]
Optimisation of polarisation effects in optical tweezers based upon conical refraction of circularly polarised light in biaxial crystals,CraigMcDougall,DavidJ.Carnegie,EdikU.Rafailov,DavidMcGloin,Univ.ofDundee(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-77]
Optical trapping with photorefractive evanescent fields,SusanaTorres-Hurtado,InstitutoNacionaldeAstrofisica,OpticayElectronica(Mexico);BraulioM.Villegas-Martinez,Univ.Varacruzana(Mexico);JulioC.Ramirez-San-Juan,InstitutoNacionaldeAstrofisica,OpticayElectronica(Mexico);NikolaiA.Korneev,RubénRamos-Garcia,InstitutoNacionaldeAstrofísica,ÓpticayElectrónica(Mexico) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-87]
Shaped accelerating Airy beams,AdrianRuelas,TecnologicodeMonterrey(Mexico);MiguelA.Bandres,InstitutoNacionaldeAstrofísica,ÓpticayElectrónica(Mexico) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-79]
SESSION 17 . . . . . . . . . . . . . . . . . . . . . . . Thurs. 2:20 to 3:00 pm
Opto-Electronic TweezersSession Chair: Rubén Ramos-Garcia, InstitutoNacionaldeAstrofísica,
ÓpticayElectrónica(Mexico)
Optoelectronic tweezers for the measurement of the relative stiffness of erythrocytes,StevenL.Neale,Univ.ofGlasgow(UnitedKingdom);ColinSelman,NimeshMody,Univ.ofAberdeen(UnitedKingdom);JonathanM.Cooper,Univ.ofGlasgow(UnitedKingdom) . . . . . . . . . . . . . . . . . . . . [8458-80]
Optoelectric tweezers on a BSO surface,MichaelEsseling,StefanGlasener,WestfälischeWilhelms-Univ.Münster(Germany);FedericoVolonteri,Institutd’OptiqueGraduateSchool(France);CorneliaDenz,WestfälischeWilhelms-Univ.Münster(Germany). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-81]
Conference 8458
SESSION 18 . . . . . . . . . . . . . . . . . . . . . . . Thurs. 3:15 to 4:55 pm
Chemistry and Rheology in Optical TrapsSession Chair: Tomás Cizmár, Univ.ofSt.Andrews(UnitedKingdom)
Probing the bulk viscosity of particles using aerosol optical tweezers,DavidL.Bones,RoryPower,JonathanP.Reid,Univ.ofBristol(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-82]
Picoliter rheology of gaseous media using a rotating optically trapped birefringent microparticle,YoshihikoArita,MichaelMazilu,Univ.ofSt.Andrews(UnitedKingdom);AndrewW.McKinley,ImperialCollegeLondon(UnitedKingdom);HalinaRubinsztein-Dunlop,TheUniv.ofQueensland(Australia);KishanDholakia,Univ.ofSt.Andrews(UnitedKingdom). . [8458-83]
Analysis of optical trap mediated aerosol coalescence,NileshS.Mistry,Univ.ofLeicester(UnitedKingdom);RichardPower,Univ.ofBristol(UnitedKingdom);SumanAnand,DavidMcGloin,Univ.ofDundee(UnitedKingdom);A.Almohamedi,MatthewDownie,Univ.ofLeicester(UnitedKingdom);JonB.Wills,JonathanP.Reid,Univ.ofBristol(UnitedKingdom);AndrewJ.Hudson,Univ.ofLeicester(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-84]
Optical manipulation of airborne particles using flexible dual-beam trap,OtoBrzobohaty,MartinSiler,PavelZemanek,InstituteofScientificInstrumentsoftheASCR,v.v.i.(CzechRepublic). . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8458-85]
Laser trapping dynamics of L-alanine depending on the laser polarization,Ken-ichiYuyama,NationalChiaoTungUniv.(Taiwan);TerukiSugiyama,InstrumentTechnologyResearchCtr.(Taiwan);HiroshiMasuhara,NationalChiaoTungUniv.(Taiwan)................................... [8458-86]
SESSION 19 . . . . . . . . . . . . . . . . . . . . . . . Thurs. 4:55 to 5:35 pm
The Final SessionSession Chair: David L. Andrews, Univ.ofEastAngliaNorwich(United
Kingdom)
Optical tweezers toolbox: better, faster, cheaper; choose all three,AlexanderB.Stilgoe,HalinaRubinsztein-Dunlop,TimoA.Nieminen,TheUniv.ofQueensland(Australia);YongyinCao,TheUniv.ofQueensland(Australia)andHarbinInstituteofTechnology(China) . . . . . . . . . . . . . . . . . . . . . . . . . [8458-88]
A hand wavy approach to optical tweezers,LucyShaw,TheUniv.ofMelbourne(Australia);DarylC.Preece,TimoA.Nieminen,HalinaRubinsztein-Dunlop,TheUniv.ofQueensland(Australia). . . . . . . . . . . . . . . . . . . . . [8458-89]
44 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Conference 8459Sunday-Wednesday 12-15 August 2012 • Proceedings of SPIE Vol. 8459
Physical Chemistry of Interfaces and Nanomaterials XIConference Chairs:Jenny Clark, Univ.ofCambridge(UnitedKingdom);Carlos Silva, Univ.deMontréal(Canada)
Conference Co-Chairs:John B. Asbury, ThePennsylvaniaStateUniv.(UnitedStates);Oleg V. Prezhdo, Univ.ofRochester(UnitedStates);Sergei Tretiak, LosAlamosNationalLab.(UnitedStates)
Program Committee:Oliver L. A. Monti, TheUniv.ofArizona(UnitedStates)
Sunday 12 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 9:00 to 10:20 am
Excitons in Organic Semiconductors ISession Chair: Richard Hildner, ICFO-InstitutdeCiènciesFotòniques
(Spain)
The dynamics of singlet fission in solid-state polyacene materials (Invited Paper),ChristopherJ.Bardeen,Univ.ofCalifornia,Riverside(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8459-01]
Carotenoid nanoparticles: a natural platform for probing singlet fission,AndrewJ.Musser,Univ.ofCambridge(UnitedKingdom);MargheritaMaiuri,DanieleBrida,GiulioCerullo,PolitecnicodiMilano(Italy);RichardH.Friend,JennyClark,Univ.ofCambridge(UnitedKingdom). . . . . . . . . . . . . . . [8459-02]
The interplay between Wannier-Mott and Frenkel excitons in plastic semiconductors: intramolecular versus intermolecular spatial coherence,FrancisPaquin,Univ.deMontréal(Canada);HajimeYamagata,TempleUniv.(UnitedStates);MaciejSakowicz,Univ.deMontréal(Canada);JonathanRivnay,AlbertoSalleo,StanfordUniv.(UnitedStates);LukeReynolds,SaifA.Haque,ImperialCollegeLondon(UnitedKingdom);FelixKoch,PaulSmith,ETHZurich(Switzerland);NatalieStingelin,ImperialCollegeLondon(UnitedKingdom);FrankC.Spano,TempleUniv.(UnitedStates);CarlosSilva,Univ.deMontréal(Canada) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8459-03]
SESSION 2 . . . . . . . . . . . . . . . . . . . . . Sun. 10:50 am to 12:30 pm
Excitons in Organic Semiconductors IISession Chair: Christopher J. Bardeen, Univ.ofCalifornia,Riverside
(UnitedStates)
Exciton fission in organic nanoparticles: spectroscopy and relevance for solar energy conversion (Invited Paper),MichaelJ.Tauber,Univ.ofCalifornia,SanDiego(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8459-04]
Analysis of state-specific vibrations coupled to the unidirectional energy transfer in conjugated dendrimers,SergeiTretiak,LosAlamosNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8459-05]
Ultrafast single-molecule detection: from small molecules to photosynthetic antenna complexes (Invited Paper),RichardHildner,ICFO-InstitutdeCiènciesFotòniques(Spain)andUniv.Bayreuth(Germany);DaanBrinks,ICFO-InstitutdeCiènciesFotòniques(Spain);R.J.Cogdell,Univ.ofGlasgow(UnitedKingdom);NiekF.vanHulst,ICFO-InstitutdeCiènciesFotòniques(Spain)andICREA-InstitucioCatalanadeRecercaiEstudisAvancats(Spain). . . [8459-06]
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:30to2:00pm
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 2:00 to 3:20 pm
Electronic Processes at Nanostructured Interfaces ISession Chair: Natalie Stingelin-Stutzmann, ImperialCollegeLondon
(UnitedKingdom)
Effect of impurity on open-circuit voltage of BHJ solar cells probed by photo-conductive AFM (Invited Paper),Xuan-DungDang,WeilinLeong,LorenKaake,AlanJ.Heeger,Thuc-QuyenNguyen,Univ.ofCalifornia,SantaBarbara(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8459-07]
Photocarrier and exciton dynamics in films of C 60 and ZnPc with a layered nanostructure,PaulA.Lane,PaulD.Cunningham,JosephS.Melinger,U.S.NavalResearchLab.(UnitedStates);EdwinJ.Heilweil,NationalInstituteofStandardsandTechnology(UnitedStates) . . . . . . . . . . . . . . . . . . . . . [8459-08]
Nanostructure control of the electronic coupling in conjugated polymer systems,ChristophHellmann,ImperialCollegeLondon(UnitedKingdom);FrancisPaquin,Univ.deMontréal(Canada);AnnalisaBruno,LukeReynolds,PasqualeD’Angelo,ImperialCollegeLondon(UnitedKingdom);GitteGraubner,MartinSteinhart,Univ.Osnabrück(Germany);ThomasD.Anthopoulos,SaifA.Haque,ImperialCollegeLondon(UnitedKingdom);CarlosSilva,Univ.deMontréal(Canada);NatalieStingelin-Stutzmann,ImperialCollegeLondon(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8459-09]
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 3:50 to 5:10 pm
Electronic Processes at Nanostructured Interfaces IISession Chair: Quyen Nguyen, Univ.ofCalifornia,SanDiego(United
States)
Solid-state structure development in polymer semiconductors and influence on optoelectronic processes (Invited Paper),NatalieStingelin-Stutzmann,ImperialCollegeLondon(UnitedKingdom). . . . . . . . . . . . [8459-10]
Electronic energy transport in nanomaterials: influence of host structure,DavidL.Andrews,JackS.Ford,Univ.ofEastAngliaNorwich(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8459-11]
Modeling of dye-sensitized solar cells based on high-potential porphyrin photoanodes,StevenJ.Konezny,GaryF.Moore,GaryW.Brudvig,VictorS.Batista,YaleUniv.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8459-12]
Symposium-Wide Plenary Session . . . . . . . . . . . . . . . . . . . . Sun. 6:00 to 7:25 pm6:00pm: Introduction and Opening Remarks
6:05pm: The Exciting Science of Light with Metamaterials, VladimirM.Shalaev,PurdueUniv.(USA)
6:45pm:Future of Optics and Photonics, BahaaE.A.Saleh,CREOL,TheCollegeofOpitcsandPhotonicsattheUniv.ofCentralFlorida(USA)
Monday 13 AugustNanoScience + Engineering Plenary Session . . . . . . . . . . . . . . . Mon. 8:30 am to 12:00 pm
Session Chairs:Satoshi Kawata,OsakaUniv.(Japan)and Manijeh Razeghi, NorthwesternUniv.(USA)
8:30am:The Light and Sound Fantastic: Radiation Pressure at the Nanoscale, OskarPainter,CaliforniaInstituteofTechnology(USA)
9:15am:Organics and Nanostructures for Nonlinear Optics, NasserPeyghambarian,CollegeofOpticalSciences,TheUniv.ofArizona(USA)
CoffeeBreak . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10:00to10:30am
10:30am:From Nanophotonics, to Metaphotonics, to Dynamic Photonics: Controlling Light Propagation and Light-Matter Interactions for Emerging Technologies, ParasPrasad,Univ.atBuffalo(USA)
11:15am:Global Activities in Novel-Nano Magnetic Materials for Magnetic, Optoelectronics Applications,MisoonMah,AsianOfficeofAerospaceDevelopment(Japan)
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:00to2:00pm
SESSION 5 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 2:00 to 3:00 pm
Electronic and Photonic Processes at Model InterfacesSession Chair: Sebastian Westenhoff, Univ.ofCambridge(United
Kingdom)
Single-molecule studies of proton transfer in guest-host materials (Invited Paper),PhilipJ.Reid,Univ.ofWashington(UnitedStates) . . . . . . . . . [8459-13]
Mechanism of two-photon fluorescence increment via cross-linked bovine serum albumin,Chun-YuLin,NationalChengKungUniv.(UnitedStates);Shean-JenChen,NationalChengKungUniv.(Taiwan). . . . . . . . . . . . [8459-14]
spie.org/opadvance · TEL:+13606763290 · help@spie.org 45
SESSION 6 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 3:30 to 5:30 pm
Organic Semiconductor Devices ISession Chair: Mario Caironi, IstitutoItalianodiTecnologia(Italy)
Oscillatory dynamics in bacterial reaction centres studied by electronic 2D spectroscopy (Invited Paper),SebastianWestenhoff,Univ.Gothenburg(Sweden);DavidPalacek,DonatasZigmantas,LundUniv.(Sweden);PetraEdlund,PhilipSmith,Univ.ofGothenburg(Sweden). . . . . . . . . . . . . . [8459-15]
Interface engineering for highly efficient hybrid solar cells (Invited Paper),AnnamariaPetrozza,IstitutoItalianodiTecnologia(Italy). . . . . . . . . . . [8459-16]
Electrolyte gating as a platform to control the conductivity in nanostructured films for optoelectronics (Invited Paper),ClaraSantato,SarehBayatpour,JonathanSayago,DilekIsik,EcolePolytechniquedeMontréal(Canada) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8459-17]
Tuesday 14 AugustSESSION 7 . . . . . . . . . . . . . . . . . . . . . . . . Tues. 9:00 to 10:20 am
Interfaces in Quantum-Confined Nanostructures ISession Chair: Sergio Brovelli, Univ.degliStudidiMilano-Bicocca
(Italy)
Atomic-size semiconductor quantum dots (Invited Paper),SebastienFrancoeur,EcolePolytechniquedeMontréal(Canada). . . . . . . . . . . . [8459-18]
Single nanowire extinction spectroscopy,MasaruK.Kuno,Univ.ofNotreDame(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8459-19]
Charge carrier dynamics in ZnO nanowires with surface electron depletion/accumulation,TzeChienSum,MingjieLi,GuichuanXing,FoongNienAhQune,GuozhongXing,TaoTomWu,ChengHonA.Huan,NanyangTechnologicalUniv.(Singapore);XingHaiZhang,A*STARInstituteofMaterialsResearchandEngineering(Singapore) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8459-20]
SESSION 8 . . . . . . . . . . . . . . . . . . . . Tues. 10:50 am to 12:10 pm
Interfaces in Quantum-Confined Nanostructures IISession Chair: Sebastien Francoeur, EcolePolytechniquedeMontréal
(Canada)
Wavefunction engineering in core-shell semiconductor nanocrystals: from fine-tuned exciton dynamics and suppressed Auger recombination to dual color electroluminescence (Invited Paper),SergioBrovelli,Univ.degliStudidiMilano-Bicocca(Italy) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8459-21]
Origin of shift in photoluminescence during the preparation of CdSe/ZnS-SiO 2 nanocomposite by spray pyrolysis and sol-gel method,Young-KukKim,Kyu-ChaeChoi,Si-HyunAhn,Young-SangCho,KoreaInstituteofMaterialsScience(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8459-22]
Nano-local observation of adsorption of anions via single gold nanoparticle spectroscopy,ThomasA.Klar,JohannesKeplerUniv.Linz(Austria);MichaelLudemann,ReneMuller,StephanSchwieger,ErichRunge,TechnischeUniv.Ilmenau(Germany);CynthiaVidal,MartinDjiango,CalinHrelescu,JohannesKeplerUniv.Linz(Austria). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8459-23]
Lunch/Exhibition Break.............................. 12:10to1:40pm
SESSION 9 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 1:40 to 3:00 pm
Organic Semiconductor Devices IISession Chair: Carlos Silva, Univ.deMontréal(Canada)
High-resolution charge modulation microscopy in high-mobility organic transistors (Invited Paper),MarioCaironi,IstitutoItalianodiTecnologia(Italy);NicolaMartino,IstitutoItalianodiTecnologia(Italy)andPolitecnicodiMilano(Italy);MariaRosaAntognazza,IstitutoItalianodiTecnologia(Italy) . . [8459-24]
Ethylbenzene oxidation to acetophenone by using Mn catalysts supported on modified, nanosized, SiO 2/Al 2O 3 mixed oxide in supercritical carbon dioxide,MohammadArshadi,IsfahanUniv.ofTechnology(Iran,IslamicRepublicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8459-25]
Thermal testing of firing materials,MingchanQiu,AnhuiUniv.ofScienceandTechnology(Chile). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8459-26]
Wednesday 15 AugustSESSION 10 . . . . . . . . . . . . . . . . . . . . . . . . Wed. 3:45 to 5:30 pm
Charge Transfer Dynamics in Organic Semiconductors: Joint Session with Conference 8459
Session Chair: Garry Rumbles, NationalRenewableEnergyLab.(UnitedStates)
Ultrafast dynamics of photogeneration and mobility of excitons and charges in conjugated polymers and covalent organic frameworks (Invited Paper),LaurensSiebbeles,TechnischeUniv.Delft(Netherlands) . . . . [8477-21]
Influence of molecular weight tuning on the photophysical properties of conjugated polymer: polymer blends,PaulWestacott,SarahFearn,MohammedAl-Hashimi,MartinJ.Heeney,DavidS.McPhail,NatalieStingelin-Stutzmann,ImperialCollegeLondon(UnitedKingdom). . . . . . . . . . . . [8459-27]
Charge generation dynamics in conjugated polymer blends with carbon nanotubes and fullerenes (Invited Paper),ChawKeongYong,SamStranks,ChristianT.Weisspfennig,MichaelB.Johnston,RobinJ.Nicholas,Univ.ofOxford(UnitedKingdom);E.BuchacaDomingo,NatalieStingelin-Stutzmann,ImperialCollegeLondon(UnitedKingdom);LauraM.Herz,Univ.ofOxford(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8477-22]
Probing the vertical molecular conformation and composition in polymer-fullerene photovoltaic devices (Invited Paper),DavidG.Lidzey,TheUniv.ofSheffield(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8459-28]
Charge generation and recombination dynamics in nanofiber P3HT:PCBM solar cells,TzeChienSum,MichaelKurniawan,TeddySalim,KongFaiTai,ChengHonA.Huan,YengMingLam,NanyangTechnologicalUniv.(Singapore) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8477-23]
Posters-Wednesday . . . . . . . . . . . . . . . . . Wed. 5:30 to 7:30 pmConference attendees are invited to attend the poster session on Wednesday evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
Oxidation of ethylbenzene using some recyclable cobalt nanocatalysts: the role of linker and electrochemical study,MohammadArshadi,IsfahanUniv.ofTechnology(Iran,IslamicRepublicof) . . . . . . . . . . . . . . . . . . . . . . . . . [8459-29]
Schiff base ligands immobilized on a nanosized SiO 2Al 2O 3 mixed oxide as adsorbents for heavy metals,MohammadArshadi,IsfahanUniv.ofTechnology(Iran,IslamicRepublicof) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8459-30]
Positive magnetoresistance in hydrogenated amorphous alloys silicon nickel a- Si 1-yNiy:H at very low temperature with magnetic field,AbdelhamidElKaaouachi,Sr.,AbdelfattahNarjis,Jr.,AbdelghaniSybous,Jr.,LhoussineLimouny,Jr.,Univ.IbnZohr(Morocco);GerardBiskupski,Sr.,Univ.desSciencesetTechnologiesdeLille(France);SaidDlimi,Jr.,Univ.IbnZohr(Morocco) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8459-31]
Variable range hopping in hydrogenated amorphous silicon-nickel alloys,AbdelhamidElKaaouachi,Univ.IbnZohr(Morocco);AbdelfattahNarjis,AbdelghaniSybous,Jr.,LhoussineLimouny,SaidDlimi,GerardBiskupski,Univ.desSciencesetTechnologiesdeLille(France) . . . . . . . . . . . . . . . . . . [8459-32]
Study of electrical conductivity and scale theory in metallic n-type GeSb,AbdelhamidElKaaouachi,Univ.IbnZohr(Morocco);AbdelghaniSybous,Jr.,AbdelfattahNarjis,LhoussineLimouny,SaidDlimi,GerardBiskupski,Univ.desSciencesetTechnologiesdeLille(France). . . . . . . . . . . . . . . . . . . . . . [8459-33]
Negative magnetoresistance behaviour and variable range-hopping conduction in insulating NbSi amorphous alloys at very low temperature with magnetic field,AbdelhamidElKaaouachi,Univ.IbnZohr(Morocco);AbdelghaniSybous,Jr.,AbdelfattahNarjis,LhoussineLimouny,SaidDlimi,GerardBiskupski,Univ.desSciencesetTechnologiesdeLille(France)[8459-34]
Nanoscale p-n junction based on cadmium sulfide,MaarifA.Jafarov,BakuStateUniv.(Azerbaijan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8459-35]
Variable range hopping conduction in insulating n-type InSb semiconductor,AbdelhamidElKaaouachi,Univ.IbnZohr(Morocco) [8459-36]
Photoluminescence quenching of CdSe quantum dots by proximal binding of ferrocene redox moieties,WeiLiu,GraduateUniv.oftheChineseAcademyofSciences(China);XiaohuiQiu,ShengnanWang,NationalCtr.forNanoscienceandTechnologyofChina(China) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8459-37]
Conference 8459
46 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Conference 8460Sunday-Wednesday 12-15 August 2012 • Proceedings of SPIE Vol. 8460
Biosensing and Nanomedicine IIConference Chairs:Hooman Mohseni, NorthwesternUniv.(UnitedStates);Massoud H. Agahi, Harbor-UCLAMedicalCtr.(UnitedStates)andCedars-SinaiMedicalCtr.(UnitedStates);Manijeh Razeghi, NorthwesternUniv.(UnitedStates)
Program Committee:Gert Cauwenberghs, Univ.ofCalifornia,SanDiego(UnitedStates);Philippe M. Fauchet, Univ.ofRochester(UnitedStates);David H. Gracias, TheJohnsHopkinsUniv.(UnitedStates);Kimberly S. Hamad-Schifferli, MassachusettsInstituteofTechnology(UnitedStates);James Sean Humbert, Univ.ofMaryland,CollegePark(UnitedStates);Giacomo Indiveri, ETHZurich(Switzerland);Keon Jae Lee, KAIST(Korea,Republicof);Yu-Hwa Lo, Univ.ofCalifornia,SanDiego(UnitedStates);Ryan P. McClintock, NorthwesternUniv.(UnitedStates);Omer G. Memis, NorthwesternUniv.(UnitedStates);Masoud Panjehpour, ThompsonCancerSurvivalCtr.(UnitedStates);Adam T. Woolley, BrighamYoungUniv.(UnitedStates);John M. Zavada, NationalScienceFoundation(UnitedStates)
Sunday 12 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 8:00 to 10:20 am
Biomolecule Detection and SensingSession Chairs: Hooman Mohseni, NorthwesternUniv.(UnitedStates);
Massoud H. Agahi, Harbor-UCLAMedicalCtr.(UnitedStates)
Label-free biological detection using radio-frequency and microwave wireless sensors (Invited Paper),RadislavA.Potyrailo,NandiniNagraj,GEGlobalResearch(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8460-01]
Integrated optical tweezers and interferometry for biosensing (Invited Paper),SamarendraK.Mohanty,TheUniv.ofTexasatArlington(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8460-02]
Real-time sub-nanometric spatial accuracy of excited electron interaction with biomolecule: innovating concept for spatio-temporal radiation biomedicine,YannA.Gauduel,VictorMalka,EcoleNationaleSupérieuredeTechniquesAvancées(France). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8460-03]
High-throughput FLIM-FRET nanoimaging for quantification of protein-protein interactions in high-content screening,AnthonyTsikouras,JinNing,McMasterUniv.(Canada);SandyNg,RichardBerman,SpectralAppliedResearchInc.(Canada);DavidW.Andrews,QiyinFang,McMasterUniv.(Canada) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8460-04]
Sub-attomolar sensitive and multiplexed immunoassay using surface-engineered quantum dots,SungjeeKim,JoonhyuckPark,PohangUniv.ofScienceandTechnology(Korea,Republicof) . . . . . . . . . . . . . . . . . . . [8460-05]
Measurement of PLGA-NP interaction with single smooth muscle cells using optical tweezers,LingGu,HomaHomayoni,KytaiT.Nguyen,SamarendraK.Mohanty,TheUniv.ofTexasatArlington(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8460-06]
SESSION 2 . . . . . . . . . . . . . . . . . . . . . Sun. 10:50 am to 12:30 pm
Biosensing ISession Chairs: John M. Zavada, NationalScienceFoundation(United
States);Keon Jae Lee, KAIST(Korea,Republicof)
Near-infrared fluorescence imaging: towards clinical reality (Invited Paper),SylvainGioux,HakSooChoi,SummerL.Gibbs,JohnV.Frangioni,BethIsraelDeaconessMedicalCtr.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . [8460-07]
Imaging glycans in living organisms using biocompatible click chemistry (Invited Paper),PengWu,AlbertEinsteinCollegeofMedicineofYeshivaUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8460-08]
Surface-enhanced Raman scattering substrate with high-sensitivity fabricated by assembly of polystyrene sphere array,LiangpingXia,ShaoyunYin,ChunleiDu,InstituteofOpticsandElectronics(China). . . . . . . . . [8460-09]
Enhancing the detection limit of whispering gallery mode biosensors,JoachimKnittel,JonD.Swaim,WarwickP.Bowen,TheUniv.ofQueensland(Australia). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8460-10]
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:30to1:30pm
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 1:30 to 3:10 pm
Biosensors for Diagnostic and Theranostics ISession Chairs: Gert Cauwenberghs, Univ.ofCalifornia,SanDiego
(UnitedStates);Philippe M. Fauchet, VanderbiltUniv.(UnitedStates)
Nanoengineering of material surfaces for tissue engineering and regenerative medicine (Invited Paper),KetulC.Popat,ColoradoStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8460-11]
MEMS and nanotechnology for biology and medicine: from lab-on-chip to building with cells (Invited Paper),RashidBashirV,Univ.ofIllinoisatUrbana-Champaign(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8460-12]
Laser stabilization of biofunctional magnetic nanoparticles in aqueous solution,AlexanderI.Omelchenko,EmilN.Sobol,InstituteonLaserandInformationTechnologies(RussianFederation);SvetlanaS.Pavlova,UgricStateUniv.(RussianFederation)................................... [8460-13]
Portable guided-mode resonance biosensor platform for point-of-care testing,GunYongSung,WanJoongKim,HyunsungKo,BongKyuKim,Kyung-HyunKim,ChulHuh,JongcheolHong,ElectronicsandTelecommunicationsResearchInstitute(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . [8460-14]
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 3:40 to 5:40 pm
Biosensing IISession Chairs: Yu-Hwa Lo, Univ.ofCalifornia,SanDiego(UnitedStates);Omer Gokalp Memis, NorthwesternUniv.(UnitedStates)
Silver nanoplates as photoacoustic contrast agents and biosensors (Invited Paper),KimberlyA.Homan,GeoffreyP.Luke,Yun-ShengChen,MichaelSouza,RyanTruby,StanislavY.Emelianov,TheUniv.ofTexasatAustin(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8460-15]
Optical endoscopic microscopy for medical applications (Invited Paper),Wang-YuhlOh,KAIST(Korea,Republicof) . . . . . . . . . . . . . . . . . . . . . [8460-16]
Nanoscale localization sampling using periodic and random nanostructures for sub-diffraction limited imaging of biomolecules,YoungjinOh,KyujungKim,WonjuLee,DonghyunKim,YonseiUniv.(Korea,Republicof). . . [8460-17]
Commercial SERS substrates for advanced biological detection,MikellaE.Hankus,PaulM.Pellegrino,U.S.ArmyResearchLab.(UnitedStates) [8460-18]
Viral peptides for intracellular delivery,StefaniaGaldiero,Univ.degliStudidiNapoliFedericoII(Italy). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8460-19]
Symposium-Wide Plenary Session . . . . . . . . . . . . . . . . . . . . Sun. 6:00 to 7:25 pm6:00pm: Introduction and Opening Remarks
6:05pm: The Exciting Science of Light with Metamaterials, VladimirM.Shalaev,PurdueUniv.(USA)
6:45pm:Future of Optics and Photonics, BahaaE.A.Saleh,CREOL,TheCollegeofOpitcsandPhotonicsattheUniv.ofCentralFlorida(USA)
spie.org/opadvance · TEL:+13606763290 · help@spie.org 47
Monday 13 AugustNanoScience + Engineering Plenary Session . . . . . . . . . . . . . . . Mon. 8:30 am to 12:00 pm
Session Chairs:Satoshi Kawata,OsakaUniv.(Japan)and Manijeh Razeghi, NorthwesternUniv.(USA)
8:30am:The Light and Sound Fantastic: Radiation Pressure at the Nanoscale, OskarPainter,CaliforniaInstituteofTechnology(USA)
9:15am:Organics and Nanostructures for Nonlinear Optics, NasserPeyghambarian,CollegeofOpticalSciences,TheUniv.ofArizona(USA)
CoffeeBreak . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10:00to10:30am
10:30am:From Nanophotonics, to Metaphotonics, to Dynamic Photonics: Controlling Light Propagation and Light-Matter Interactions for Emerging Technologies, ParasPrasad,Univ.atBuffalo(USA)
11:15am:Global Activities in Novel-Nano Magnetic Materials for Magnetic, Optoelectronics Applications,MisoonMah,AsianOfficeofAerospaceDevelopment(Japan)
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:00to1:30pm
SESSION 5 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 1:30 to 3:00 pm
Biosensing IIISession Chairs: Radislav A. Potyrailo, GEGlobalResearch(United
States);Adam T. Woolley, BrighamYoungUniv.(UnitedStates)
Electrochemical biosensors using carbon nanotube nanoelectrode arrays (Invited Paper),JunLi,KansasStateUniv.(UnitedStates). . . . . . . . . . [8460-20]
Localized surface plasmon resonances in porous metallic films and their applications in enhanced optical contrast microscopy,FeifeiWei,RyanAguinaldo,YiXu,ZhaoweiLiu,Univ.ofCalifornia,SanDiego(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8460-21]
Light trapping and enhancing gold nanoparticle array substrates made by thermal dewetting technique,Te-WeiChang,HyunjongR.Jin,GangLoganLiu,Univ.ofIllinoisatUrbana-Champaign(UnitedStates). . . . . . . . . . [8460-22]
High-resolution plasmonic structured illumination microscopy,FeifeiWei,ZhaoweiLiu,Univ.ofCalifornia,SanDiego(UnitedStates). . . . . . . . . [8460-23]
SESSION 6 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 3:30 to 5:30 pm
Biosensors for Diagnostic and Theranostics IISession Chair: Sylvain Gioux, BethIsraelDeaconessMedicalCtr.
(UnitedStates)
Gold-coated liposomes for biomedical applications (Invited Paper),MarekRomanowski,SarahJ.Leung,TheUniv.ofArizona(UnitedStates) . . [8460-24]
Photothermal nanoblade for cell surgery and cargo delivery (Invited Paper),Pei-YuE.Chiou,Univ.ofCalifornia,LosAngeles(UnitedStates) . . . . [8460-25]
Design and fabrication of an integrated blood-drawing and separating device,Yu-SzLin,TatungUniv.(Taiwan). . . . . . . . . . . . . . . . . . . . . . . [8460-26]
Circulating tumor cell detection using carbon nanotube devices: specific versus non-specific interactions,BenjaminC.King,ThomasBurkhead,BalajiPanchapakesan,Univ.ofLouisville(UnitedStates) . . . . . . . . . . . . . . . [8460-27]
Combined SERS biotags (SBTs) and microfluidic platform for the quantitative ratiometric discrimination between noncancerous and cancerous cells in flow,AlessiaPallaoro,MehranHoonejani,Univ.ofCalifornia,SantaBarbara(UnitedStates);GaryBraun,ErkkiRuoslahti,BurnhamInstituteforMedicalResearch(UnitedStates);CarlD.Meinhart,MartinMoskovits,Univ.ofCalifornia,SantaBarbara(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . [8460-28]
Tuesday 14 AugustSESSION 7 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 8:00 to 9:50 am
Biosensing IVSession Chair: Yann A. Gauduel, EcoleNationaleSupérieurede
TechniquesAvancées(France)
Multifunctional nanoparticles for biosensing, imaging, and therapy (Invited Paper),XiaohuGao,Univ.ofWashington(UnitedStates) . . . . . . . . . . [8460-29]
Controlled FRET efficiency in nano-bio hybrid materials made from semiconductor quantum dots and bacteriorhodopsin,IgorR.Nabiev,TrinityCollegeDublin(Ireland);NicolasBouchonville,Marie-BelleEstephan,Univ.deReimsChampagne-Ardenne(France);AlyonaSukhanova,TrinityCollegeDublin(Ireland);MichelTroyon,MichaelMolinari,Univ.deReimsChampagne-Ardenne(France). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8460-30]
Quantum dot-containing polymer particles with thermosensitive fluorescence,VladimirA.Oleinikov,MoscowEngineeringPhysicsInstitute(RussianFederation);AllaN.Generalova,Shemyakin-OvchinnikovInstituteofBioorganicChemistryoftheRussianAcademyofSciences(RussianFederation);AlyonaSukhanova,TrinityCollegeDublin(Ireland)andMoscowEngineeringPhysicsInstitute(RussianFederation);MikhailArtemyev,MoscowEngineeringPhysicsInstitute(RussianFederation)andBelarusianStateUniv.(Belarus);VitalyP.Zubov,Shemyakin-OvchinnikovInstituteofBioorganicChemistryoftheRussianAcademyofSciences(RussianFederation);IgorR.Nabiev,TrinityCollegeDublin(Ireland)andMoscowEngineeringPhysicsInstitute(RussianFederation) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8460-31]
Porous silicon photonic crystals for detection of infections,BakulGupta,PeterJ.Reece,J.JustinGooding,TheUniv.ofNewSouthWales(Australia). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8460-32]
Biosensing with integrated CMOS nanopores,LukeTheogarajan,Univ.ofCalifornia,SantaBarbara(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . [8460-33]
SESSION 8 . . . . . . . . . . . . . . . . . . . . Tues. 10:20 am to 12:00 pm
Biosensors for Diagnostic and Theranostics IIIImplantable and bio-integrated flexible GaN LED (Keynote Presentation),KeonJaeLee,KAIST(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . [8460-34]
Highly synergistic cancer therapy using spatio-temporally concerting gold nanoparticle conjugates,SungjeeKim,JutaekNam,PohangUniv.ofScienceandTechnology(Korea,Republicof);Wan-GeunLa,SeoulNationalUniv.(Korea,Republicof);NokyoungPark,SamsungAdvancedInstituteofTechnology(Korea,Republicof);JeongsooYoo,KyungpookNationalUniv.(Korea,Republicof);Byung-SooKim,SeoulNationalUniv.(Korea,Republicof). . . . . . [8460-35]
Neuronal regeneration pattern depends on type of laser-induced injury,BryanJ.Black,LingGu,SamarendraK.Mohanty,TheUniv.ofTexasatArlington(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8460-36]
Diffusion dynamics of TRF2 recruitment in cells towards DNA damage-sites caused by ultrafast near-IR laser micro-irradiation,SomduttaChakraborty,LingGu,TheUniv.ofTexasatArlington(UnitedStates);NazmulHuda,DavidGilley,IndianaUniv.-PurdueUniv.Indianapolis(UnitedStates);SamarendraK.Mohanty,TheUniv.ofTexasatArlington(UnitedStates) . . . . . . . . . . [8460-37]
Lunch/Exhibition Break.............................. 12:00to1:30pm
SESSION 9 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 1:30 to 3:10 pm
Biosensors for Diagnostic and Theranostics IVSession Chair: Kimberly A. Homan, TheUniv.ofTexasatAustin(United
States)
Theranostic nanomaterials based on porous silicon (Invited Paper),MichaelJ.Sailor,Univ.ofCalifornia,SanDiego(UnitedStates). . . . . . . . . . . . [8460-38]
Targeted photothermally controlled drug delivery for the treatment of rheumatoid arthritis (Invited Paper),Kyung-HwaYoo,YonseiUniv.(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8460-39]
Femtosecond lasers: new option for selective delivery of nanomedicine through vascular barrier,JongheeYoon,ChulheeChoi,KAIST(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8460-40]
Design and analyze device integrate QCM for DEP separating nano particles,Yu-SzLin,TatungUniv.(Taiwan). . . . . . . . . . . . . . . . . . . . . [8460-41]
Conference 8460
48 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Wednesday 15 AugustSESSION 10 . . . . . . . . . . . . . . . . . . . . . . . .Wed. 8:20 to 10:00 am
Biosensor Focus: Single Photon Detectors and Imagers ISession Chairs: Melville P. Ulmer, NorthwesternUniv.(UnitedStates);
Nicola S. Sudan, SICPASA(Switzerland)
Single-photon sensitive Geiger-mode ladar cameras (Invited Paper),PingYuan,RengarajanSudharsanan,XiaogangBai,PaulA.McDonald,EduardoL.Labios,Spectrolab,Inc.(UnitedStates);BryanA.Morris,JohnP.Nicholson,GaryM.Stuart,HarrisonDanny,Boeing-SVS,Inc.(UnitedStates) . . . [8460-42]
Real-time 3D intelligence products (Invited Paper),R.PatrickEarhart,BallCorp.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8460-43]
A photon-counting camera system developed from a crossed-strip detector,JonathanM.Cook,IsraelJ.Owens,JosephM.Palmer,DavidC.Thompson,MikeD.Ulibarri,LosAlamosNationalLab.(UnitedStates)[8460-44]
Characterising a position sensitive detector using scanning electron microscopy imaging,OmeimeX.Esebamen,MidSwedenUniv.(Sweden). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8460-46]
SESSION 11 . . . . . . . . . . . . . . . . . . . Wed. 10:30 am to 12:00 pm
Biosensor Focus: Single Photon Detectors and Imagers IIProgress in linear mode photon counting at Raytheon (Invited Paper),MichaelD.Jack,RaytheonCo.(UnitedStates) . . . . . . . . . . . . . . . . . . [8460-47]
High-throughput smFRET measurements using an 8-pixel SPAD array,AntoninoIngargiola,RyanColyer,Univ.ofCalifornia,LosAngeles(UnitedStates);DongsikKim,NesherTechnology,Inc.(UnitedStates);FrancescoPanzeri,PolitecnicodiMilano(Italy);RonLin,Univ.ofCalifornia,LosAngeles(UnitedStates);AngeloGulinatti,IvanRech,MassimoGhioni,PolitecnicodiMilano(Italy);ShimonWeiss,XavierMichalet,Univ.ofCalifornia,LosAngeles(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8460-48]
Parallel multispot smFRET analysis using an 8-pixel SPAD array,AntoninoIngargiola,PolitecnicodiMilano(Italy);RyanA.Colyer,Univ.ofCalifornia,LosAngeles(UnitedStates);DongsikKim,NesherTechnologiesInc.(UnitedStates);RonR.Lin,Univ.ofCalifornia,LosAngeles(UnitedStates);AngeloGulinatti,IvanRech,MassimoGhioni,PolitecnicodiMilano(Italy);ShimonWeiss,XavierMichalet,Univ.ofCalifornia,LosAngeles(UnitedStates) . . . . . . . . . . [8460-49]
Temperature dependence of the dark current and activation energy at avalanche onset of a GaN avalanche photodiodes in regards to single photon counting,MelvilleP.Ulmer,ErdemCicek,RyanMcClintock,ZahraVashaei,ManijehRazeghi,NorthwesternUniv.(UnitedStates). . . . . . [8460-50]
Lunch/Exhibition Break.............................. 12:00to1:30pm
SESSION 12 . . . . . . . . . . . . . . . . . . . . . . . . Wed. 1:30 to 3:10 pm
Biosensor Focus: Single Photon Detectors and Imagers IIIKilometer range single-photon depth imaging at wavelengths of 850nm and 1560nm (Invited Paper),GeraldS.Buller,AongusMcCarthy,NathanR.Gemmell,XimingRen,NilsJ.Krichel,RobertJ.Collins,Heriot-WattUniv.(UnitedKingdom);SandorN.Dorenbos,ValZwiller,TechnischeUniv.Delft(Netherlands);MichaelG.Tanner,RobertH.Hadfield,Heriot-WattUniv.(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8460-51]
3D near-infrared imaging using a 128x128 pixel single-photon avalanche diode sensor,JuanMataPavia,MartinWolf,Univ.HospitalZürich(Switzerland)andEcolePolytechniqueFédéraledeLausanne(Switzerland),EdoardoCharbon,EcolePolytechniqueFédéraledeLausanne(Switzerland)andTechnischeUniv.Delft(Netherlands). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8460-66]
Aspects of chip and cell size of silicon photomultipliers,PeterIskra,ChristophDietzinger,TobiasEggert,MichaelFraczek,ThomasGanaka,LotharHöllt,JürgenKnobloch,NatsukiMiyakawa,AndreasPahlke,FlorianWiest,ReinhardFojt,KETEKGmbH(Germany). . . . . . . . . . . . . . . . . . . . . . . . [8460-53]
Reduction of optical crosstalk in silicon photomultipliers,ChristophDietzinger,PeterIskra,KETEKGmbH(Germany);ThomasGanka,Unive.derBundeswehrMünchen(Germany);TobiasEggert,LotharHöllt,AndreasPahlke,NatsukiMiyakawa,MichaelFraczek,JürgenKnobloch,FlorianWiest,KETEKGmbH(Germany);WalterHansch,Univ.derBundeswehrMünchen(Germany);ReinhardFojt,KETEKGmbH(Germany). . . . . . . . . . . . . . . . . . . . . . . . [8460-54]
SESSION 13 . . . . . . . . . . . . . . . . . . . . . . . . Wed. 3:40 to 5:10 pm
Biosensor Focus: Single Photon Detectors and Imagers IVPhoton number resolution with electrically gated silicon avalanche photodiodes (Invited Paper),ZhiliangYuan,ToshibaResearchEuropeLtd.(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8460-55]
FAMOUS: a prototype silicon-photomultiplier telescope for the fluorescence detection of ultra-high-energy cosmic rays,MarkusLauscher,RWTHAachen(Germany);PedroAssis,PedroBrogueira,MiguelFerreira,Lab.deInstrumentaçãoeFísicaExperimentaldePartículas,Lisbon(Portugal);ThomasHebbeker,RWTHAachen(Germany);LuísMendes,Lab.deInstrumentaçãoeFísicaExperimentaldePartículas,Lisbon(Portugal);ChristineMeurer,LukasMiddendorf,TimNiggemann,RWTHAachen(Germany);MárioPimenta,Lab.deInstrumentaçãoeFísicaExperimentaldePartículas,Lisbon(Portugal);JohannesSchumacher,MauriceStephan,RWTHAachen(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8460-56]
Fast manipulation of telecom wavelength single photon qubits in lithium niobate waveguide using superconducting nanowire single-photon detectors,ChandraM.Natarajan,Heriot-WattUniv.(UnitedKingdom);DamienBonneau,MirkoLobino,PisuJiang,Univ.ofBristol(UnitedKingdom);MichaelG.Tanner,Heriot-WattUniv.(UnitedKingdom);SandersN.Dorenbos,ValZwiller,TechnischeUniv.Delft(Netherlands);RobertH.Hadfield,Heriot-WattUniv.(UnitedKingdom);MarkG.Thompson,JeremyL.O’Brien,Univ.ofBristol(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8460-57]
High-count-rate single-photon counting with MCP-Timepix detector,AntonS.Tremsin,JohnV.Vallerga,JasonB.McPhate,OswaldH.W.Siegmund,Univ.ofCalifornia,Berkeley(UnitedStates);RickRaffanti,TechneInstruments,Inc.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8460-58]
Posters-Wednesday . . . . . . . . . . . . . . . . . Wed. 5:30 to 7:30 pmConference attendees are invited to attend the poster session on Wednesday evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
Electronic platform to assess toxicity of carbon nanotubes and associated cellular behavior in real time,ReemEldawud,ChenboDong,YonRojanasakul,Cerasela-ZoicaDinu,WestVirginiaUniv.(UnitedStates). . . . . . . . . . . [8460-59]
Preparation of bioactive surfaces for optical detection of microbial agents using conjugates of specific anti-lipopolysaccharide antibodies with organic fluorescent dyes immobilized onto Si/SiO 2 surface,KatarzynaHalubek-Gluchowska,L.HirszfeldInstituteofImmunologyandExperimentalTherapy(Poland)andInstituteofLowTemperaturesandStructureResearch(Poland);JacekRybka,L.HirszfeldInstituteofImmunologyandExperimentalTherapy(Poland);PawelGluchowski,WieslawStrek,InstituteofLowTemperaturesandStructureResearch(Poland);AndrzejGamian,L.HirszfeldInstituteofImmunologyandExperimentalTherapy(Poland)andWroclawMedicalUniv.(Poland). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8460-60]
Detection of the bacteria existing at the aquatic environment using optical method,PawelGluchowski,InstituteofLowTemperatureandStructureResearch(Poland);KatarzynaHalubek-Gluchowska,L.HirszfeldInstituteofImmunologyandExperimentalTherapy(Poland)andInstituteofLowTemperatureandStructureResearch(Poland);JacekRybka,L.HirszfeldInstituteofImmunologyandExperimentalTherapy(Poland);DariuszHreniak,WieslawStrek,InstituteofLowTemperatureandStructureResearch(Poland). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8460-61]
Methodology to control size and shape of gold nanoparticles,AndreaCejaFernández,Ctr.deInvestigacionesenÓpticaA.C.(Mexico);ElderDelaRosaCruz,LeonardoPérezMayen,Ctr.deInvestigacionesenÓptica,A.C.(Mexico);AlejandroTorres,Univ.AutónomadeNuevoLeón(Mexico) . . . . . . . . [8460-62]
Topical release of photo-thermal responsive liposome in vivo monitored by fluorescence measurement,Kuo-ChihLiao,NationalChungHsingUniv.(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8460-63]
A novel biosensor for determination of glucose based on MWCNTs/ZrO 2-Pt nanocomposite,OmarA.Al-Hartomy,Univ.ofTabuk(SaudiArabia). [8460-64]
Polarization cartography of optical anisotropy of blood plasma,AlexanderV.Dubolazov,YuriyFedkovychChernivtsiNationalUniv.(Ukraine). . . . . [8460-65]
Conference 8460
spie.org/opadvance · TEL:+13606763290 · help@spie.org 49
Conference 8461Sunday-Thursday 12-16 August 2012 • Proceedings of SPIE Vol. 8461
Spintronics VConference Chairs:Henri-Jean Drouhin, EcolePolytechnique(France);Jean-Eric Wegrowe, EcolePolytechnique(France);Manijeh Razeghi, NorthwesternUniv.(UnitedStates)
Program Committee:Jack Bass, MichiganStateUniv.(UnitedStates);Franco Ciccacci, PolitecnicodiMilano(Italy);Russell P. Cowburn, Univ.ofCambridge(UnitedKingdom);Vincent Cros, UnitéMixtedePhysiqueCNRS/Thales(France);Hanan Dery, Univ.ofRochester(UnitedStates);Michel I. Dyakonov, Univ.Montpellier2(France);Michael E. Flatté, TheUniv.ofIowa(UnitedStates);Jean-Marie George, UnitéMixtedePhysiqueCNRS/Thales(France);Henri Jaffrès, UnitéMixtedePhysiqueCNRS/Thales(France);Andrew D. Kent, NewYorkUniv.(UnitedStates);Mathias Klaui, Univ.Konstanz(Germany);Yuri A. Mamaev, St.PetersburgStatePolytechnicalUniv.(RussianFederation);Ryan P. McClintock, NorthwesternUniv.(UnitedStates);Laurens W. Molenkamp, Julius-Maximilians-Univ.Würzburg(Germany);Hiro Munekata, TokyoInstituteofTechnology(Japan);Yoshichika Otani, TheUniv.ofTokyo(Japan);Dafiné Ravelosona, Institutd’ÉlectroniqueFondamentale(France);Nitin Samarth, ThePennsylvaniaStateUniv.(UnitedStates);Alain Schuhl, Commissariatàl’ÉnergieAtomique(France);Jing Shi, Univ.ofCalifornia,Riverside(UnitedStates);Donald J. Silversmith, DefenseThreatReductionAgency(UnitedStates);Luc Thomas, IBMAlmadenResearchCtr.(UnitedStates);Evgeny Tsymbal, Univ.ofNebraska-Lincoln(UnitedStates);Olaf M. J. van ‘t Erve, U.S.NavalResearchLab.(UnitedStates);Joerg Wunderlich, HitachiCambridgeLab.(UnitedKingdom);Igor Zutic, Univ.atBuffalo(UnitedStates)
Sunday 12 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 8:30 to 10:30 am
Spin Coherence, Dynamics, and FluctuationSession Chair: Jean-Eric Wegrowe, EcolePolytechnique(France)
Optical control of electron and hole spins in coupled InAs quantum dots (Invited Paper),AllanS.Bracker,SamG.Carter,NavalResearchLab.(UnitedStates);AlexGreilich,TechnischeUniv.Dortmund(Germany);DannyKim,HarvardUniv.(UnitedStates);DanielG.Gammon,NavalResearchLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8461-01]
Observation of the band structure Berry phase through magnetoconductance experiments in diluted magnetic semiconductors (Invited Paper),DamienLucot,MaraGranada,RomainGiraud,AristideLemaitre,ChristianUlysse,Lab.dePhotoniqueetdeNanostructures(France);XavierWaintal,Commissariatàl’ÉnergieAtomique(France);GiancarloFaini,Lab.dePhotoniqueetdeNanostructures(France). . . . . . . . . . . . . . . . . . . . . . [8461-02]
Intrinsic spin fluctuations reveal the dynamical response function of holes coupled to nuclear spin baths in (In,Ga)As quantum dots (Invited Paper),YanLi,NikolaiA.Sinitsyn,DarrylL.Smith,LosAlamosNationalLab.(UnitedStates);DirkReuter,AndreasD.Wieck,Ruhr-Univ.Bochum(Germany);DmitriR.Yakovlev,TechnischeUniv.Dortmund(Germany)andRussianAcademyofSciences(RussianFederation);ManfredBayer,TechnischeUniv.Dortmund(Germany);ScottA.Crooker,LosAlamosNationalLab.(UnitedStates)[8461-03]
Semiconductor spin noise spectroscopy (Invited Paper),MichaelOestreich,FabianBerski,RaminDahbashi,Jan-GerritLonnemann,HendrikKuhn,JensHübner,LeibnizUniv.Hannover(Germany) . . . . . . . . . . . . . . . . . . . . . [8461-04]
SESSION 2 . . . . . . . . . . . . . . . . . . . . . Sun. 11:00 am to 12:30 pm
Spin-Injection ISession Chair: Aurelie M. Spiesser, NationalInstituteofAdvanced
IndustrialScienceandTechnology(Japan)
Spin injection into semiconductors using magnetization dynamics (Invited Paper),KazuyaAndo,TohokuUniv.(Japan). . . . . . . . . . . . . . . . . . . . . [8461-05]
Experimental demonstration of a magnetic bipolar junction transistor (Invited Paper),EzekielJohnston-Halperin,TheOhioStateUniv.(UnitedStates);DavidD.Awschalom,Univ.ofCalifornia,SantaBarbara(UnitedStates);MichaelE.Flatté,TheUniv.ofIowa(UnitedStates). . . . . . . . . . . . . . . . . . . . . . [8461-06]
Spin injection into semiconductor heterostructures: towards 2D systems (Invited Paper),MariuszCiorga,Univ.Regensburg(Germany). . . . . . . [8461-07]
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:30to1:30pm
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 1:30 to 3:30 pm
Spin-Injection IISession Chair: Junsaku Nitta, TohokuUniv.(Japan)
Domain wall motion driven by current in magnetic nanowires with perpendicular anisotropy (Invited Paper),LucThomas,See-HunYang,Kwang-SuRyu,TimothyPhung,StuartS.P.Parkin,IBMAlmadenResearchCtr.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8461-65]
Electrical and dynamical spin injection into Si (Invited Paper),YuichiroAndo,EijiShikoh,MasashiShiraishi,OsakaUniv.(Japan). . . . . . . . . . . . . . . [8461-08]
Spin accumulation and decoherence mechanisms at ferromagnetic/tunnel barrier/semiconductor interfaces (Invited Paper),Jean-MarieGeorge,UnitéMixtedePhysiqueCNRS/Thales(France) . . . . . . . . . . . . . . . . . . . . . . [8461-09]
Device Physics of Ferromagnet/III-V Heterostructures (Invited Paper),PaulA.Crowell,Univ.ofMinnesota,TwinCities(UnitedStates) . . . . . . . . . . . [8461-10]
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 4:00 to 5:30 pm
Spin-Injection IIISession Chair: Yuichiro Ando, OsakaUniv.(Japan)
Vanishing pure spin-current : the equilibrium states under spin-injection in non-local geometry. (Invited Paper),Jean-EricWegrowe,Henri-JeanDrouhin,EcolePolytechnique(France);DanielLacour,Univ.HenriPoincaréNancy(France). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8461-11]
Interface scattering by negative donor for hot-electron injection in n-doped silicon (Invited Paper),YuanLu,DanielLacour,FrancoisMontaigne,StephaneSuire,JulienBernos,MichelHehn,Univ.HenriPoincaréNancy(France)[8461-12]
First-principles calculations of transport and magnetic properties of rare-earth materials (Invited Paper),KirillBelashchenko,Univ.ofNebraska-Lincoln(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8461-13]
Symposium-Wide Plenary Session . . . . . . . . . . . . . . . . . . . . Sun. 6:00 to 7:25 pm6:00pm: Introduction and Opening Remarks
6:05pm: The Exciting Science of Light with Metamaterials, VladimirM.Shalaev,PurdueUniv.(USA)
6:45pm:Future of Optics and Photonics, BahaaE.A.Saleh,CREOL,TheCollegeofOpitcsandPhotonicsattheUniv.ofCentralFlorida(USA)
50 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Monday 13 AugustNanoScience + Engineering Plenary Session . . . . . . . . . . . . . . . Mon. 8:30 am to 12:00 pm
Session Chairs:Satoshi Kawata,OsakaUniv.(Japan)and Manijeh Razeghi, NorthwesternUniv.(USA)
8:30am:The Light and Sound Fantastic: Radiation Pressure at the Nanoscale, OskarPainter,CaliforniaInstituteofTechnology(USA)
9:15am:Organics and Nanostructures for Nonlinear Optics, NasserPeyghambarian,CollegeofOpticalSciences,TheUniv.ofArizona(USA)
CoffeeBreak . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10:00to10:30am
10:30am:From Nanophotonics, to Metaphotonics, to Dynamic Photonics: Controlling Light Propagation and Light-Matter Interactions for Emerging Technologies, ParasPrasad,Univ.atBuffalo(USA)
11:15am:Global Activities in Novel-Nano Magnetic Materials for Magnetic, Optoelectronics Applications,MisoonMah,AsianOfficeofAerospaceDevelopment(Japan)
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:00to1:00pm
SESSION 5 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 1:00 to 3:30 pm
Magnetic Tunnel JunctionSession Chair: Jean-Marie George, UnitéMixtedePhysiqueCNRS/
Thales(France)
Barrier breakdown mechanisms in MgO-based magnetic tunnel junctions under pulsed conditions and correclation with low-frequency noise. (Invited Paper),SelmaAmara-Dababi,HeleneBea,RicardoSousa,BernardDiény,SPINTEC(France). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8461-14]
Spin filtering in spinel ferrite CoFe 2O 4 (Invited Paper),MichaelFoerster,InstitutdeCiènciadeMaterialsdeBarcelona(Spain)andJohannesGutenbergUniv.Mainz(Germany);DiegoF.Gutierrez,JosepFontcuberta,InstitutdeCiènciadeMaterialsdeBarcelona(Spain). . . . . . . . . . . . . . . . . . . . . . [8461-15]
Perpendicular CoFeB-MgO magnetic tunnel junction (Invited Paper),HideoOhno,TohokuUniv.(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8461-16]
Spin filter superconducting tunnel junctions (Invited Paper),MarkBlamire,Univ.ofCambridge(UnitedKingdom);KartikSenapati,NationalInstituteofScienceEducationandResearch(India). . . . . . . . . . . . . . . . . . . . . . . . [8461-17]
Electrical spin injection into group IV semiconductors (Invited Paper),AurelieM.Spiesser,NationalInstituteofAdvancedIndustrialScienceandTechnology(Japan);SandeepSharma,Univ.ofGroningen(Netherlands);SatoshiIba,HidekazuSaito,RonaldJansen,ShinjiYuasa,KojiAndo,NationalInstituteofAdvancedIndustrialScienceandTechnology(Japan). . . . . . . . . . . . . [8461-18]
SESSION 6 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 4:00 to 6:30 pm
Spin-Orbit InteractionSession Chair: Hideo Ohno, TohokuUniv.(Japan)
Spin-orbit coupling in graphene structures (Invited Paper),JaroslavFabian,UniversityofRegensburg(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . [8461-19]
Spin topological phase in InGaAs spin interferometers (Invited Paper),JunsakuNitta,TohokuUniv.(Japan)........................... [8461-20]
Spin physics in the transport properties of antimony-based materials (Invited Paper),MichaelB.Santos,SheenaMurphy,DilhaniJayathilaka,ChomaniGaspe,ShayneCairns,TetsuyaD.Mishima,TheUniv.ofOklahoma(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8461-21]
Spin dynamics in two-dimensional electron and hole systems revealed by resonant spin amplification (Invited Paper),TobiasKorn,MichaelGriesbeck,MichaelKugler,Univ.Regensburg(Germany);MikhailM.Glazov,IoffePhysico-TechnicalInstitute(RussianFederation);EugeneY.Sherman,Univ.delPaísVasco(Spain);MarikaHirmer,DieterSchuh,Univ.Regensburg(Germany);WernerWegscheider,ETHZurich(Switzerland);ChristianSchüller,Univ.Regensburg(Germany). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8461-22]
Spin transistor action from Onsager reciprocity and SU(2) gauge theory (Invited Paper),InancAdagideli,SabanciUniv.(Turkey). . . . . . . . . . . . [8461-23]
Tuesday 14 AugustSESSION 7 . . . . . . . . . . . . . . . . . . . . . . . . Tues. 8:00 to 10:00 am
Spin TransferSession Chair: Christian Binek, Univ.ofNebraska-Lincoln(United
States)
Magnetization dynamics seen by x-rays (Invited Paper),YvesAcremann,ETHZurich(Switzerland). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8461-24]
Current-induced domain wall manipulation in magnetic tunnel junctions (Invited Paper),AndreChanthbouala,Joao-MiguelSampaio,UnitéMixtedePhysiqueCNRS/Thales(France);PeterMetaxas,TheUniv.ofWesternAustralia(Australia);RieMatsumoto,UnitéMixtedePhysiqueCNRS/Thales(France);AlexeyKhvalkovskiy,GrandisInc.(UnitedStates);VincentCros,AbdelmadjidAnane,JulieGrollier,AlbertFert,UnitéMixtedePhysiqueCNRS/Thales(France);KonstantinZvezdin,IstitutoP.M.s.r.l.(Italy);AkioFukushima,HitoshiKubota,KayYakushiji,ShinjiYuasa,NationalInstituteofAdvancedIndustrialScienceandTechnology(Japan) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8461-25]
Unconventional spin torque bias dependencies in magnetic tunnel junctions (Invited Paper),AurélienManchon,KingAbdullahUnivofScienceandTechnology(SaudiArabia) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8461-26]
Spin-torque vortex oscillators in multilayered metallic nanowires electrodeposited inside nanoporous alumina templates: experimental measurements and micromagnetic study (Invited Paper),FlavioAbreuAraujo,Univ.CatholiquedeLouvain(Belgium);VincentCros,UnitéMixtedePhysiqueCNRS/Thales(France);KonstantinA.Zvezdin,IstitutoP.M.s.r.l.(Italy);LucPiraux,Univ.CatholiquedeLouvain(Belgium). . . . . . . . . . . . . . . . . . . [8461-27]
SESSION 8 . . . . . . . . . . . . . . . . . . . . Tues. 10:30 am to 12:30 pm
NanomagnetismSession Chair: Yves Acremann, ETHZurich(Switzerland)
Spin wave mediated magnetic vortex core reversal (Invited Paper),HermannStoll,Max-Planck-InstitutfürMetallforschung(Germany) . . . . . . . . . . [8461-28]
Surface ferromagnetism of Pt thin films (Invited Paper),BorisNadgorny,PushkalThapa,WayneStateUniv.(UnitedStates);ParashuKharel,Univ.ofNebraska-Lincoln(UnitedStates);RenatSubirianov,Univ.ofNebraskaatOmaha(UnitedStates);JulieBorchers,NationalInstituteofStandardsandTechnology(UnitedStates);DavidSellmyer,Univ.ofNebraska-Lincoln(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8461-29]
Nanomagnetic logic (Invited Paper),DavidCarlton,LawrenceLivermoreNationalLab.(UnitedStates);BrianLambson,ZhengGu,JeffreyBokor,Univ.ofCalifornia,Berkeley(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . [8461-30]
Controlling magnetic order in quantum dots (Invited Paper),IgorZutic,JamesPientka,RafalOszwaldowski,KarelVyborny,JeongsuLee,JongHan,Univ.atBuffalo(UnitedStates);AndrePetukhov,SouthDakotaSchoolofMinesandTechnology(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8461-31]
Lunch/Exhibition Break.............................. 12:30to1:30pm
SESSION 9 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 1:30 to 3:00 pm
Voltage ControlSession Chair: Marius Vasile Costache, InstitutCatalàde
Nanotecnologia(Spain)
Voltage-controlled magnetic anisotropy in magnetic tunnel junctions (Invited Paper),WeigangWang,MingenLi,StephenHageman,Chia-LingChien,JohnsHopkinsUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8461-32]
Switching spin and charge between edge states in topological insulator constrictions (Invited Paper),ViktorKrueckl,KlausRichter,Univ.Regensburg(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8461-33]
Isothermal electric control of exchange bias near room temperature (Invited Paper),ChristianBinek,XiHe,YiWang,A.Wysocki,TakashiKomesu,U.Lanke,AnthonyN.Caruso,KirillD.Belashchenko,E.Vescovo,PeterA.Dowben,Univ.ofNebraska-Lincoln(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . [8461-34]
Conference 8461
spie.org/opadvance · TEL:+13606763290 · help@spie.org 51
SESSION 10 . . . . . . . . . . . . . . . . . . . . . . . . Tues. 3:30 to 6:00 pm
Magnetic SC, Multiferoics, and GrapheneNegative capacitance in a ferroelectric-dielectric heterostructure for ultra low-power computing (Invited Paper),SayeefSalahuddin,Univ.ofCalifornia,Berkeley(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8461-35]
Predictive modeling of ferroelectric and multiferroic tunnel junctions (Invited Paper),JulianVelev,Univ.ofPuertoRico(UnitedStates) . . . . . . . . . . [8461-36]
Copper-doped ZnSe nanocrystals: nanoscale diluted magnetic semiconductors exhibiting long-lived photo-magnetization (Invited Paper),ScottA.Crooker,AnshuPandey,VictorKlimov,LosAlamosNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8461-37]
Theoretical evaluation of spin-dependent Auger de-excitation in Mn2+-doped semiconductor nanocrystals (Invited Paper),XiaosongLi,BoPeng,MichaelWhite,DanielR.Gamelin,Univ.ofWashington(UnitedStates)[8461-38]
Spin transport in graphene nanostructures using non-equilibrium Green’s function technique (Invited Paper),VietHungNguyen,ArnaudBournel,PhilippeDollfus,Institutd’ÉlectroniqueFondamentale(France) . . . . . . . . . . . . [8461-39]
Wednesday 15 AugustSESSION 11 . . . . . . . . . . . . . . . . . . . . . . . .Wed. 8:30 to 10:30 am
Spin-Optics ISession Chair: Henri-Jean Drouhin, EcolePolytechnique(France)
Spinoptics in nanostructures (Invited Paper), (Keynote Presentation),ErezHasman,Technion-IsraelInstituteofTechnology(Israel). . . . . . . . . . . [8461-40]
Transverse voltage induced by circularly polarized obliquely incident light in plasmonic crystals (Invited Paper),TeruyaIshihara,TakafumiHatano,HiroyukiKurosawa,TohokuUniv.(Japan);YosukeKurami,NaoshiNishimura,KyotoUniv.(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8461-41]
Spin and orbital angular momentum of light and particle beams and their inter-conversion (Invited Paper),LorenzoMarrucci,Univ.degliStudidiNapoliFedericoII(Italy) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8461-42]
SESSION 12 . . . . . . . . . . . . . . . . . . . Wed. 11:00 am to 12:30 pm
Spin CaloritronicsSession Chair: Jean-Eric Wegrowe, EcolePolytechnique(France)
Giant thermoelectric effect in Al2O3 magnetic tunnel junctions (Invited Paper),StephaneMangin,Univ.HenriPoincaréNancy(France);WeiweiLin,Univ.Paris-Sud11(FrenchPolynesia);MichelHehn,LaurentChaput,BeatriceNegulescu,StephaneAndrieu,FrancoisMontaigne,Univ.HenriPoincaréNancy(France). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8461-43]
Magnon-drag thermopile (Invited Paper),MariusV.Costache,GermanBridoux,InstitutCatalàdeNanotecnologia(Spain);IngmarNeumann,InstitutCatalàdeNanotecnologia(Spain)andUniv.AutònomadeBarcelona(Spain);SergioValenzuela,InstitutCatalàdeNanotecnologia(Spain)andUniv.AutònomadeBarcelona(Spain)andInstitucióCatalanadeRecercaiEstudisAvançats(ICREA)(Spain). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8461-44]
Anatomy of phonon-induced spin relaxation processes in silicon (Invited Paper),YangSong,UnivofRochester(UnitedStates);HananDery,Univ.ofRochester(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8461-45]
Lunch/Exhibition Break.............................. 12:30to2:00pm
SESSION 13 . . . . . . . . . . . . . . . . . . . . . . . . Wed. 2:00 to 3:30 pm
Spin-Optics IISession Chair: Erez Hasman, Technion-IsraelInstituteofTechnology
(Israel)
Plasmonic antennas as building blocks for spin optics and quantum optics applications (Invited Paper),QiwenZhan,WeibinChen,GuanghaoRui,Univ.ofDayton(UnitedStates);DonC.Abeysinghe,Univ.ofCincinnati(UnitedStates);ChristopherE.Tabor,RobertL.Nelson,AirForceResearchLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8461-46]
Spin Hall effect of light in graphene (Invited Paper),HailuLuo,XinxingZhou,ShuangchunWen,HunanUniv.(China) . . . . . . . . . . . . . . . . . . . . . . . . [8461-47]
Ultrafast probing of the optical spin Hall effect in semiconductors (Invited Paper),HenryM.vanDriel,Univ.ofToronto(Canada). . . . . . . . . . . . . [8461-48]
SESSION 14 . . . . . . . . . . . . . . . . . . . . . . . . Wed. 4:00 to 5:30 pm
Spin-Optics and OptoelectronicsSession Chair: Qiwen Zhan, Univ.ofDayton(UnitedStates)
Spin-photodiodes for SiGe spin-optoelectronics (Invited Paper),ChristianRinaldi,MatteoCantoni,DanielaPetti,PolitecnicodiMilano(Italy);NualaM.Caffrey,StefanoSanvito,TrinityCollegeDublin(Ireland);RiccardoBertacco,PolitecnicodiMilano(Italy). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8461-49]
Splitting of light field induced by Hall effect of light and symmetry breaking of vector fields (Invited Paper),Ling-JunKong,Xi-LinWang,Zhi-ChengRen,Sheng-XiaQian,Si-MinLi,YongnanLi,Hui-TianWang,NankaiUniv.(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8461-50]
Exploring magnetic ordering in oxide thin films with x-rays (Invited Paper),DarioA.Arena,BrookhavenNationalLab.(UnitedStates). . . . . . . . . . [8461-51]
Posters-Wednesday . . . . . . . . . . . . . . . . . Wed. 5:30 to 7:30 pmConference attendees are invited to attend the poster session on Wednesday evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
Magnetic and Mössbauer studies of praseodymium-doped, single-phase bismuth ferrite nanoparticles,SimantK.Srivastav,N.S.Gajbhiye,IndianInstituteofTechnologyKanpur(India).......................... [8461-60]
Room temperature ferromagnetism in swift heavy ion irradiated V doped ZnO thin films,GurusamyJayalakshmi,NationalInstituteofTechnology,Tiruchirappalli(India);KothalamuthuSaravanan,Helmholtz-ZentrumDresden-Rossendorfe.V.(Germany);ThailampillaiBalasubramanian,NationalInstituteofTechnology,Tiruchirappalli(India). . . . . . . . . . . . . . . . . . . . [8461-61]
Surface functionalization of ZnO films by THIOL,GurusamyJayalakshmi,NationalInstituteofTechnology,Tiruchirappalli(India);KothalamuthuSaravanan,Helmholtz-ZentrumDresden-Rossendorfe.V.(Germany);ThailampillaiBalasubramanian,NationalInstituteofTechnology,Tiruchirappalli(India). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8461-62]
Strong correlation between induced ferromagnetism and oxygen deficiency in hydrothermally synthesized Cu-doped TiO 2 nanorods,SandeepK.S.Patel,N.S.Gajbhiye,IndianInstituteofTechnologyKanpur(India). . . [8461-63]
Modification of band gap and spin-orbit coupling in type-II GaAsSb/InGaAs heterostructures through uniaxial strain modulation,MatthewD.Crawford,WeiPan,JeffreyG.Cederberg,SandiaNationalLabs.(UnitedStates) [8461-64]
Defect-induced spin polarization studies in 4H-SiC, VankataC.Kummari,MangalS.Dhoubhadel,BibhuduttaRout,FloydD.McDaniel,Univ.ofNorthTexas(UnitedStates),WeilinJiang,PacificNorthwestNationalLab.(UnitedStates),TiloReinert,Univ.ofNorthTexas(UnitedStates). . . . . . . . . . [8461-66]
Thursday 16 AugustSESSION 15 . . . . . . . . . . . . . . . . . . . . . . Thurs. 8:00 to 10:00 am
Fundamental Properties of MaterialsSession Chair: Igor Zutic, Univ.atBuffalo(UnitedStates)
Spin injection/transport and spin-charge conversion in organic semiconductors at room temperature (Invited Paper),SebastianMooser,ShunWatanabe,JoshanielCooper,KalK.Banger,Univ.ofCambridge(UnitedKingdom);JoergWunderlich,HitachiCambridgeLab.(UnitedKingdom)andInstituteofPhysicsASCR,v.v.i.(CzechRepublic);KazuyaAndo,TohokuUniv.(Japan);EijiSaitoh,TohokuUniv.(Japan)andJapanScienceandTechnologyAgency(Japan)andJapanAtomicEnergyAgency(Japan);HenningSirringhaus,Univ.ofCambridge(UnitedKingdom) . . . . . . . . . . . . . . . . . . . . . . . . . [8461-52]
Emergent electrodynamics of skyrmions in chiral magnets (Invited Paper),AndreasBauer,TechnischeUniv.München(Germany). . . . . . . . . . . . [8461-53]
Theory of organic magnetoresistance in disordered organic semiconductors (Invited Paper),NicholasJ.Harmon,MichaelE.Flatté,Univ.ofIowa(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8461-54]
Probing the surface and interface of topological insulator Bi 2Se 3grown on epitaxial graphene/SiC(0001) (Invited Paper),LianLi,Univ.ofWisconsin-Milwaukee(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8461-55]
Conference 8461
52 spie.org/opadvance · TEL:+13606763290 · help@spie.org
SESSION 16 . . . . . . . . . . . . . . . . . . Thurs. 10:30 am to 12:30 pm
Optical Methods and DevicesSession Chair: Ezekiel Johnston-Halperin, TheOhioStateUniv.
(UnitedStates)
Circularly polarized lasing in (110) quantum well-based spin laser (Invited Paper),SatoshiIba,NaraInstituteofScienceandTechnology(NAIST)(Japan)andNationalInstituteofAdvancedIndustrialScienceandTechnology(AIST)(Japan);ShinjiKoh,KazuhiroIkeda,HitoshiKawaguchi,NaraInstituteofScienceandTechnology(Japan) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8461-56]
Time-resolved, magneto-optical spectroscopy of MOVPE-grown III-Mn-V ferromagnetic semiconductors (Invited Paper),GitiA.Khodaparast,MithunBhowmick,TravisMerritt,VirginiaPolytechnicInstituteandStateUniv.(UnitedStates);CaitlinFeeser,BruceW.Wessels,NorthwesternUniv.(UnitedStates);StephenA.McGill,NationalHighMagneticFieldLab.(UnitedStates);DiptaSaha,XinguanPan,GaryD.Sanders,ChristopherJ.Stanton,Univ.ofFlorida(UnitedStates);YasuhiroH.Matsuda,TheUniv.ofTokyo(Japan) . . . [8461-57]
Optically detecting spin-split bands in semiconductors in magnetic fields (Invited Paper),ChristopherJ.Stanton,XingyuanPan,DiptaSaha,GarySanders,Univ.ofFlorida(UnitedStates);RyanDoezema,MichaelSantos,Univ.ofOklahoma(UnitedStates);SophiaHayes,WashingtonUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8461-58]
Optical spin injection and spin lifetime in Ge heterostructures (Invited Paper),FabioPezzoli,Univ.degliStudidiMilano-Bicocca(Italy);FedericoF.Bottegoni,PolitecnicodiMilano(Italy);DharaTrivedi,Univ.ofRochester(UnitedStates);FrancoCiccacci,PolitecnicodiMilano(Italy);AnnaGiorgioni,Univ.deglistudidiMilano-Bicocca(Italy);PengkiLi,Univ.ofRochester(UnitedStates);StefanoCecchi,PolitecnicodiMilano(Italy);EmanueleGrilli,Univ.deglistudidiMilano-Bicocca(Italy);YangSong,Univ.ofRochester(UnitedStates);MarioGuzzi,Univ.deglistudidiMilano-Bicocca(Italy);HananDery,Univ.ofRochester(UnitedStates);GiovanniIsella,PolitecnicodiMilano(Italy). . . . . . . . . [8461-59]
Conference 8461
Books of Related InterestVisittheonsiteBookstoreororderonlinetoday:spie.org/publications
Field Guide to Infrared Systems, Detectors, and FPAs, Second EditionbyArnold DanielsVol.FG15
Organic Electroluminescenceby Zakya H. KafafiVol.PM151
spie.org/opadvance · TEL:+13606763290 · help@spie.org 53
Conference 8462Tuesday-Wednesday 14-15 August 2012 • Proceedings of SPIE Vol. 8462
Carbon Nanotubes, Graphene, and Associated Devices VConference Chairs:Didier Pribat, SungkyunkwanUniv.(Korea,Republicof);Young-Hee Lee, SungkyunkwanUniv.(Korea,Republicof);Manijeh Razeghi, NorthwesternUniv.(UnitedStates)
Program Committee:Seunghyun Baik, SungkyunkwanUniv.(Korea,Republicof);Paolo Bondavalli, ThalesResearch&Technology(France);Costel-Sorin Cojocaru, EcolePolytechnique(France);Kenji Hata, NationalInstituteofAdvancedIndustrialScienceandTechnology(Japan);Mark C. Hersam, NorthwesternUniv.(UnitedStates);Seong Chan Jun, YonseiUniv.(Korea,Republicof);Horacio Lamela Rivera, Univ.CarlosIIIdeMadrid(Spain);Seung Hee Lee, ChonbukNationalUniv.(Korea,Republicof);Annick Loiseau, ONERA(France);Ryan P. McClintock, NorthwesternUniv.(UnitedStates);William I. Milne, Univ.ofCambridge(UnitedKingdom);Philip W. T. Pong, TheUniv.ofHongKong(HongKong,China)
Sunday 12 AugustSymposium-Wide Plenary Session . . . . . . . . . . . . . . . . . . . . Sun. 6:00 to 7:25 pm6:00pm: Introduction and Opening Remarks
6:05pm: The Exciting Science of Light with Metamaterials, VladimirM.Shalaev,PurdueUniv.(USA)
6:45pm:Future of Optics and Photonics, BahaaE.A.Saleh,CREOL,TheCollegeofOpitcsandPhotonicsattheUniv.ofCentralFlorida(USA)
Monday 13 AugustNanoScience + Engineering Plenary Session . . . . . . . . . . . . . . . Mon. 8:30 am to 12:00 pm
Session Chairs:Satoshi Kawata,OsakaUniv.(Japan)and Manijeh Razeghi, NorthwesternUniv.(USA)
8:30am:The Light and Sound Fantastic: Radiation Pressure at the Nanoscale, OskarPainter,CaliforniaInstituteofTechnology(USA)
9:15am:Organics and Nanostructures for Nonlinear Optics, NasserPeyghambarian,CollegeofOpticalSciences,TheUniv.ofArizona(USA)
CoffeeBreak . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10:00to10:30am
10:30am:From Nanophotonics, to Metaphotonics, to Dynamic Photonics: Controlling Light Propagation and Light-Matter Interactions for Emerging Technologies, ParasPrasad,Univ.atBuffalo(USA)
11:15am:Global Activities in Novel-Nano Magnetic Materials for Magnetic, Optoelectronics Applications,MisoonMah,AsianOfficeofAerospaceDevelopment(Japan)
Tuesday 14 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . Tues. 8:30 to 10:00 am
Growth and Device Technology IOn the growth mechanism of graphene from transition metal films or foils (Invited Paper),DidierPribat,SungkyunkwanUniv.(Korea,Republicof)[8462-01]
Chemical vapor deposition of graphene on copper at reduced temperatures,BruceI.Willner,StructuredMaterialsIndustries,Inc.(UnitedStates);JeonghyunHwang,MichaelG.Spencer,CornellUniv.(UnitedStates);TomSalagaj,StructuredMaterialsIndustries,Inc.(UnitedStates);WilliamC.Mitchel,AirForceResearchLab.(UnitedStates);GaryS.Tompa,StructuredMaterialsIndustries,Inc.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . [8462-02]
A novel multi-wall CNT synthesis technique using conventional CVD with controlled pressure,MohsenKara,MuhammadHafizAmir,AzmanAwangTeh,RafidahAhmad,MohdRusop,ZaikiAwang,Univ.TeknologiMARA(Malaysia). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8462-03]
Investigation of the evaporation of the nickel catalyst during growth of carbon spheres,ShaneePacley,WilliamMitchell,AirForceResearchLab.(UnitedStates);PaulT.Murray,DavidAnderson,Univ.ofDaytonResearchInstitute(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8462-04]
SESSION 2 . . . . . . . . . . . . . . . . . . . . . . . Tues. 10:30 to 11:40 am
Growth and Device Technology IIFabrication and ab initio study of downscaled graphene nanoelectronic devices (Invited Paper),HiroshiMizuta,JapanAdvancedInstituteofScienceandTechnology(Japan)andUniv.ofSouthampton(UnitedKingdom);ZakariaMoktadir,StuartBoden,NimaKalhor,ShuojinHang,MarekSchmidt,HaroldChong,Univ.ofSouthampton(UnitedKingdom);NguyenCuong,DamChi,JapanAdvancedInstituteofScienceandTechnology(Japan);HarveyRutt,Univ.ofSouthampton(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . [8462-05]
Advancing quasi-freestanding epitaxial graphene electronics through integration of wafer scale hexagonal boron nitride dielectrics,MichaelS.Bresnehan,ThePennsylvaniaStateUniv.Electro-OpticsCtr.(UnitedStates)andThePennsylvaniaStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . [8462-06]
Tools for making graphene and carbon nanotubes by chemical vapor deposition,GaryS.Tompa,BruceI.Willner,TomSalagaj,StructuredMaterialsIndustries,Inc.(UnitedStates);JeonghyunHwang,MichaelG.Spencer,CornellUniv.(UnitedStates);NickM.Sbrockey,StructuredMaterialsIndustries,Inc.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8462-07]
Lunch/Exhibition Break........................... 11:40amto1:00pm
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 1:00 to 2:10 pm
Microwave and Terahertz Applications IUltrafast dynamics of graphene nanostructures and devices studied by THz time-domain spectroscopy (Invited Paper),HyunyongChoi,InheeMaeng,YonseiUniv.(Korea,Republicof);SeongchuLim,SeungJinChae,YoungHeeLee,SungkyunkwanUniv.(Korea,Republicof);Joo-HiukSon,TheUniv.ofSeoul(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8462-08]
Modeling and experimental verification of graphene co-planar waveguide transmission lines,ZaikiAwang,MohsenKara,MuhammadHafizAmir,AzmanAwangTeh,MohdRusop,Univ.TeknologiMARA(Malaysia). . . . . . . . [8462-09]
Performance assessment of optimized carbon-nanotube-based wireless on-chip communication,PierreFranck,NanyangTechnologicalUniv.(Singapore)andUniv.deLimoges(France);DominiqueBaillargeat,BengKangTay,NanyangTechnologicalUniv.(Singapore)................... [8462-10]
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 2:10 to 3:20 pm
Microwave and Terahertz Applications IITerahertz conductivity studies in carbon nanostructure and silver nanoparticles composite thin-film (Invited Paper),HoracioLamela,EhsanDadrasnia,Univ.CarlosIIIdeMadrid(Spain);MohanBabuKuppam,FrédéricGaret,Jean-LouisCoutaz,IMEP-LAHC(France);Dong-MokLee,SeunghyunBaik,SungkyunkwanUniv.(Korea,Republicof). . . . . . . . . . . . . . . . . . [8462-11]
Electrical properties of carbon nanotube transmission lines at microwave frequencies,AzmanAwangTeh,MohsenKara,MuhammadHafizAmir,RafidahAhmad,MuhammadRusopMuhammad,ZaikiAwang,Univ.TeknologiMARA(Malaysia). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8462-12]
Studying and analyzing terahertz signals in carbon nanostructure composite thin-film,EhsanDadrasnia,HoracioLamela,Univ.CarlosIIIdeMadrid(Spain). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8462-13]
54 spie.org/opadvance · TEL:+13606763290 · help@spie.org
SESSION 5 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 3:50 to 5:20 pm
Optical Interactions IModification of optical properties in graphene oxide (Invited Paper),InsangSong,SamsungDigitalCity(Korea,Republicof);JuhwanLim,KyujunChoi,RaniAnoop,YonseiUniv.(Korea,Republicof);Duck-HwanKim,Sang-UkSon,SamsungAdvancedInstituteofTechnology(Korea,Republicof);JaeHunKim,SeokLee,KoreaInstituteofScienceandTechnology(Korea,Republicof);JaeKim,SeongChanJun,YonseiUniv.(Korea,Republicof). . . . . . . . . . . [8462-14]
Complete optical absorption in periodically patterned graphene,SukosinThongrattanasiri,ConsejoSuperiordeInvestigacionesCientíficas(Spain);FrankH.Koppens,ICFO-InstitutdeCiènciesFotòniques(Spain);F.JavierGarcíadeAbajo,ConsejoSuperiordeInvestigacionesCientíficas(Spain). . . . . . [8462-15]
Infrared transmission spectroscopy of CVD graphene on Si,ShinMou,SangNyonKim,AirForceResearchLab.(UnitedStates);Kuei-HsienChen,AcademiaSinica(Taiwan);Li-ChyongChen,NationalTaiwanUniv.(Taiwan);GailJ.Brown,WilliamC.Mitchel,AirForceResearchLab.(UnitedStates) . . . . . . . . [8462-16]
Graphene-based ultra-sensitive bolometer and calorimeter,KinChungFong,KeithC.Schwab,CaliforniaInstituteofTechnology(UnitedStates) . . [8462-17]
Wednesday 15 AugustSESSION 6 . . . . . . . . . . . . . . . . . . . . . . . . .Wed. 8:30 to 10:00 am
Optical Interactions IICharacterization of carbon nano-materials by apertureless near-field scanning optical microscope-Raman spectroscopy (Invited Paper),MunSeokJeong,Kyoung-DuckPark,GwangjuInstituteofScienceandTechnology(Korea,Republicof);YongHwanKim,SungkyunkwanUniv.(Korea,Republicof);JinHoPark,JungSuPark,GwangjuInstitueofScienceandTechnology(Korea,Republicof);YoungHeeLee,SungkyunkwanUniv.(Korea,Republicof)[8462-18]
Single-walled carbon nanotubes and type-II quantum dots for photovoltaics and passive mode-locking saturable absorbers,JauTang,Yong-GangWang,Shin-MinCheng,PyngYu,Kuo-YenHuang,Chi-TsuYuan,AcademiaSinica(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8462-19]
Charge transfer effects in graphene-CdSe/ZnS quantum dots composites,AlexanderV.Klekachev,IMEC(Belgium)andKatholiekeUniv.Leuven(Belgium);IngeAsselberghs,IMEC(Belgium);SergeyN.Kuznetsov,PetrozavodskStateUniv.(RussianFederation);MarleenH.vanderVeen,IMEC(Belgium);AndreL.Stesmans,KatholiekeUniv.Leuven(Belgium);MarcM.Heyns,StefanDeGendt,IMEC(Belgium)andKatholiekeUniv.Leuven(Belgium). . . . . . . . . . . . [8462-20]
Enhancing light absorption in graphene photodetectors using plasmonic nanostructures,VrindaThareja,DavidT.Schoen,AlokP.Vasudev,MarkL.Brongersma,StanfordUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . [8462-21]
SESSION 7 . . . . . . . . . . . . . . . . . . . . Wed. 10:30 am to 12:40 pm
Thin Film Transistors, Sensors, and Related ApplicationsCNTFETs fabricated using an original dynamic air-brush technique for SWCNTs deposition: application to gas and peroxide sensing (Invited Paper),PaoloBondavalli,GillesFeugnet,ThalesResearch&Technology(France). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8462-22]
Design of polymer-carbon nanohybrid junction by interface modeling for efficient printed transistors (Invited Paper),WoojaeKim,KyungwonUniv.(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8462-23]
Sorting of carbon nanotubes: benefits from high-performance gas sensors to light detectors (Invited Paper),OlivierDucloux,ONERA(France);YannBattie,Lab.d’EtudedesMicrostructures,CNRS,ONERA(France);PhilippeThobois,OlivierLeTraon,SylvainB.Maine,RiadHaïdar,CharlieKoechlin,NellyDorval,BrigitteAttal-Tretout,AnnickLoiseau,ONERA(France). . . . . . . . . . . . [8462-24]
Interferometrically defined 3D pyrolyzed-carbon sensors,DavidB.Burckel,SandiaNationalLabs.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . [8462-25]
Scalable nanoscale strain engineering of graphene by laser shock,GaryCheng,PurdueUniv.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . [8462-26]
Lunch/Exhibition Break.............................. 12:40to2:15pm
SESSION 8 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 2:15 to 3:45 pm
Miscellaneous ApplicationsBallasted and electrically steerable carbon nanotube field emitters (Invited Paper),MatthewT.Cole,Univ.ofCambridge(UnitedKingdom);ChiLi,SoutheastUniv.(China);YanZhang,CambridgeUniv.(UnitedKingdom);KeQu,BaoPingWang,SoutheastUniv.(China);DidierPribat,SungkyunkwanUniv.(Korea,DemocraticPeoplesRepublicof);WilliamI.Milne,Univ.ofCambridge(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8462-27]
Thermochemical reaction control by carbon nanotube networks for energy generation (Invited Paper),SeunghyunBaik,SeunghyunHong,SungpyoHong,Tae-RinLee,Young-JinKim,ChangkookRyu,SungkyunkwanUniv.(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8462-28]
Modified carbon nanotubes: from nanomedicine to nanotoxicology (Invited Paper),MassimoBottini,BurnhamInstituteforMedicalResearch(UnitedStates);NunzioBottini,LaJollaInstituteforAllergyandImmunology(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8462-29]
Posters-Wednesday . . . . . . . . . . . . . . . . . Wed. 5:30 to 7:30 pmConference attendees are invited to attend the poster session on Wednesday evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
Development of carbon nanotube paste for dye-sensitized solar cells,MasayaTsuji,TakahideOya,YokohamaNationalUniv.(Japan) . . . . . [8462-30]
Fabrication and characterization of graphene-based hydrogen sensors formed using 3C-SiC thin films,KangSanKim,Gwiy-SangChung,Univ.ofUlsan(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8462-31]
Reduced graphene oxide/ poly(dimethylsiloxane) composites for use in finger-sensing piezoresistive pressure sensors,JihunHwang,SunukPark,PohangUniv.ofScienceandTechnology(Korea,Republicof);Jong-JinPark,SamsungAdvancedInstituteofTechnology(Korea,Republicof);ChanEonPark,PohangUniv.ofScienceandTechnology(Korea,Republicof). . . . . . [8462-32]
Transparent conducting carbon nanotubes thin films on the flexible substrate,Hsi-ChaoChen,Hsuan-YiChiu,Kuo-TingHuang,Yu-SiangLo,Cheng-HongHe,NationalYunlinUniv.ofScienceandTechnology(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8462-33]
Distinguishing the electrical effects of chemical and topological defect in graphene oxide,XiaohuiQiu,NationalCtr.forNanoscienceandTechnologyofChina(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8462-34]
Conference 8462
spie.org/opadvance · TEL:+13606763290 · help@spie.org 55
Conference 8463Tuesday-Thursday 14-16 August 2012 • Proceedings of SPIE Vol. 8463
Nanoengineering: Fabrication, Properties, Optics, and Devices IXConference Chairs:Elizabeth A. Dobisz, HitachiGlobalStorageTechnologies,Inc.(UnitedStates);Louay A. Eldada, Amprius(UnitedStates)
Program Committee:André-Jean Attias, Univ.PierreetMarieCurie(France);Eva M. Campo, Univ.ofPennsylvania(UnitedStates);Gregory J. Exarhos, PacificNorthwestNationalLab.(UnitedStates);Cynthia Hanson, SpaceandNavalWarfareSystemsCtr.Pacific(UnitedStates);Ghassan E. Jabbour, ArizonaStateUniv.(UnitedStates);Robert Magnusson, TheUniv.ofTexasatArlington(UnitedStates);Jun Tanida, OsakaUniv.(Japan);Richard Tiberio, StanfordUniv.(UnitedStates);Chee Wei Wong, ColumbiaUniv.(UnitedStates)
Sunday 12 AugustSymposium-Wide Plenary Session . . . . . . . . . . . . . . . . . . . . Sun. 6:00 to 7:25 pm6:00pm: Introduction and Opening Remarks
6:05pm: The Exciting Science of Light with Metamaterials, VladimirM.Shalaev,PurdueUniv.(USA)
6:45pm:Future of Optics and Photonics, BahaaE.A.Saleh,CREOL,TheCollegeofOpitcsandPhotonicsattheUniv.ofCentralFlorida(USA)
Monday 13 AugustNanoScience + Engineering Plenary Session . . . . . . . . . . . . . . . Mon. 8:30 am to 12:00 pm
Session Chairs:Satoshi Kawata,OsakaUniv.(Japan)and Manijeh Razeghi, NorthwesternUniv.(USA)
8:30am:The Light and Sound Fantastic: Radiation Pressure at the Nanoscale, OskarPainter,CaliforniaInstituteofTechnology(USA)
9:15am:Organics and Nanostructures for Nonlinear Optics, NasserPeyghambarian,CollegeofOpticalSciences,TheUniv.ofArizona(USA)
CoffeeBreak . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10:00to10:30am
10:30am:From Nanophotonics, to Metaphotonics, to Dynamic Photonics: Controlling Light Propagation and Light-Matter Interactions for Emerging Technologies, ParasPrasad,Univ.atBuffalo(USA)
11:15am:Global Activities in Novel-Nano Magnetic Materials for Magnetic, Optoelectronics Applications,MisoonMah,AsianOfficeofAerospaceDevelopment(Japan)
Tuesday 14 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . Tues. 8:30 am to 12:10 pm
New Optical Devices Enabled by NanoengineeringSession Chair: Louay A. Eldada, SunEdison(UnitedStates)
Supramolecular self-assemblies at surfaces: engineering and functionality for nanophotonics (Invited Paper),André-JeanAttias,AntoineColas,Univ.PierreetMarieCurie(France);DavidKreher,UnivPierreetMarieCurie(France);FabriceMathevet,Univ.PierreetMarieCurie(France);BrettHelms,LawrenceBerkeleyNationalLab.(UnitedStates);FabriceCharra,Commissariatàl’ÉnergieAtomique(France). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8463-01]
Plasmonic active spectral filter at VIS-NIR region by metal-insulator-metal (MIM) structure on glass plate,YasushiOshikane,OsakaUniv.(Japan);KensukeMurai,NationalInstituteofAdvancedIndustrialScienceandTechnology(Japan);TakayaHigashi,FumihikoYamamoto,MotohiroNakano,HaruyukiInoue,OsakaUniv.(Japan) . . . . . . . . . . . . . . . . . . . . . . . . . . [8463-02]
GaAs nanowire-based plasmon emitting diode: an integrated subwavelength light source and waveguide in plane,PengyuFan,GeballeLab.forAdvancedMaterials(GLAM)(UnitedStates);CarloColombo,ÉcolePolytechniqueFédéraledeLausanne(Switzerland);KevinC.Huang,GeballeLab.forAdvancedMaterials(GLAM)(UnitedStates);AnnaFontcubertaiMorral,ÉcolePolytechniqueFédéraledeLausanne(Switzerland);MarkBrongersma,GeballeLab.forAdvancedMaterials(GLAM)(UnitedStates) . . . . . . . [8463-03]
Second harmonic generation from the top of an Au-coated tip via a tapered fiber coupled microsphere resonator,FangRen,HideakiTakashima,KazutakaKitajima,HidekiFujiwara,KeijiSasaki,HokkaidoUniv.(Japan). . . . . . [8463-04]
Pushing or pulling droplets on ZnO nanorods with an UV light,C.W.Liu,Chen-PinHsu,Yu-LinWang,NationalTsingHuaUniv.(Taiwan). . . . . [8463-05]
Electromagnetic surface wave effects on a thin film of gold with an array of holes,JuanManuelMerlo,TecnológicodeMonterrey(Mexico);J.FélixAguilar,InstitutoNacionaldeAstrofísica,ÓpticayElectrónica(Mexico);LucilaCescato,Univ.EstadualdeCampinas(Brazil). . . . . . . . . . . . . . . . . . . . . . . . . . . [8463-06]
Far-field detection and imaging of surface plasmon polaritons by engineering sub-wavelength slit structure,ReyadMehfuz,TheUniv.ofBritishColumbia(Canada);KennethJ.Chau,UBCOkanagan(Canada) . . . . [8463-07]
Beyond TIRF: super Z-resolution metamaterials-mediated evanescent wave microscopy,WenweiZheng,FeifeiWei,ZhaoweiLiu,Univ.ofCalifornia,SanDiego(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8463-08]
InP photonic crystal switch with a resonant wavelength of 1.55 μm,YiYu,TechnicalUniv.ofDenmark(Denmark). . . . . . . . . . . . . . . . . . . . . . . . . [8463-09]
Lunch/Exhibition Break.............................. 12:10to1:30pm
SESSION 2 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 1:30 to 4:10 pm
Nanoengineering for EnergySession Chair: André-Jean Attias, Univ.PierreetMarieCurie(France)
Nanotechnologies for efficient energy conversion, energy storage, water treatment, and water purification (Invited Paper),LouayA.Eldada,SunEdison(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8463-10]
Thin film supercapacitors incorporating reduced graphene oxide harmonized with MnO 2 by highly efficient pulse irradiation process,SunMinKim,TaeHeeYoo,JungAhLim,KoreaInstituteofScienceandTechnology(Korea,Republicof);Jong-HuyKim,KoreaInstituteofEnergyResearch(Korea,Republicof);Yong-WonSong,KoreaInstituteofScienceandTechnology(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8463-11]
Optical and mechanical properties of porous silicon made using plasma electrolysis,ZhilingZhang,YongfengJiang,ZhongHu,DavidGalipeau,QihuaFan,SouthDakotaStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . [8463-12]
Barrier height of Ag-TiO 2-NW- Schottky diode and current conductivity,AniruddhaMondal,ChinnamuthuPaulsamy,NationalInstituteofTechnologyAgartala(India). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8463-13]
Optical fiber evanescent absorption sensor design for high-temperature gas sensing in advanced coal-fired power plants,MichaelP.Buric,PaulR.Ohodnicky,Jr.,StevenD.Woodruff,BenjaminChorpening,NationalEnergyTechnologyLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8463-14]
Study of the effects of structural properties on the photoluminescence behavior of erbium thin films,HimaniS.Kamineni,Univ.atAlbany(UnitedStates);SpyrosGalis,IBMCorp.(UnitedStates);MengbingHuang,AlainE.Kaloyeros,Univ.atAlbany(UnitedStates). . . . . . . . . . . . . . . . . . . . . . [8463-15]
Wednesday 15 AugustSESSION 3 . . . . . . . . . . . . . . . . . . . . . Wed. 9:00 am to 12:20 pm
Engineered Nanostructures for Macro PropertiesSession Chair: Louay A. Eldada, SunEdison(UnitedStates)
Nanofabricated optical and detector elements for light-field camera sensors (Invited Paper),VijayK.Narasimhan,YiCui,StanfordUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8463-16]
Measuring transport channels of disordered materials,JacopoBertolotti,Univ.Twente(Netherlands)andUniv.Florence(Italy);DuyguAkbulut,SebastianusGoorden,HasanYilmaz,WillemVos,AllardMosk,Univ.Twente(Netherlands). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8463-17]
Photochromic film texturing with speckle illumination: application-to-goods
56 spie.org/opadvance · TEL:+13606763290 · help@spie.org
authentication,NicolasN.Crespo-Monteiro,NathalieN.Destouches,ThierryT.Fournel,Lab.HubertCurien(France) . . . . . . . . . . . . . . . . . . . . . . . . . . [8463-18]
Optical pumped lasing in ZnO-based quantum wells grown by pulsed laser deposition,AndreyA.Lotin,InstituteonLaserandInformationTechnologies(RussianFederation). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8463-19]
Influence of absorption band-width of nanorods on TPA of femtosecond laser pulse,VyacheslavA.Trofimov,TatianaM.Lysak,LomonosovMoscowStateUniv.(RussianFederation);ShengLan,SouthChinaNormalUniv.(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8463-20]
Heat-treatment dependency of the photoluminescent property of the 65CdO-17.5B2O 3-17.5SiO 2 (in mol %) film,ChawonHwang,BongKiRyu,PusanNationalUniv.(Korea,Republicof) . . . . . . . . . . . . . . . . . . . . . . [8463-21]
Y 2O 3 spherical monodisperse particles as a new type of multi-functional mesoporous materials,DulinaA.Nadiia,OlehVovk,AlexanderTolmachev,InstituteforSingleCrystals(Ukraine) . . . . . . . . . . . . . . . . . . . . . . . . . . [8463-22]
Temperature analysis and effects on SQW PbSe/PbSrSe energy levels, modal gain, and current density,MajedKhodr,HaririCanadianUniv.(Lebanon). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8463-23]
Lunch/Exhibition Break.............................. 12:20to2:00pm
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 2:00 to 4:10 pm
Sensors and NanodevicesSession Chair: Vijay K. Narasimhan, StanfordUniv.(UnitedStates)
Scanning Raman spectroscopy of few- and single-layer MoS 2 flakes,TobiasKorn,GerdPlechinger,StefanieHeydrich,MichaelHirmer,FranzX.Schrettenbrunner,DieterWeiss,JonathanEroms,ChristianSchüller,Univ.Regensburg(Germany). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8463-24]
Stimulus-responsive light coupling and modulation in subwavelength optical waveguide junctions,IlsunYoon,KangukKim,Univ.ofCalifornia,SanDiego(UnitedStates);SarahE.Baker,LawrenceLivermoreNationalLab.(UnitedStates);DonaldJ.Sirbuly,Univ.ofCalifornia,SanDiego(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8463-25]
Dissolved oxygen sensing based on fluorescence quenching of ceria nanoparticles,NaderShehata,VirginiaPolytechnicInstituteandStateUniv.(UnitedStates)andAlexandriaUniversity(Egypt);KathleenMeehan,VirginiaPolytechnicInstituteandStateUniv.(UnitedStates). . . . . . . . . . . . . . [8463-27]
Fabrication and characterization of nanostructure thin film ZnO Schottky contacts-based UV photodetectors,GhusoonM.Ali,Al-MustansiriyahUniv.(Iraq) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8463-28]
Characterization of Mn-nanoparticles decorated organo-functionalized SiO 2-Al 2O 3 mixed-oxide as a novel electrochemical sensor: application for voltammetric determination of captopril,MohammadArshadi,IsfahanUniv.ofTechnology(Iran,IslamicRepublicof) . . . . . . . . . . . . . . . . . . . . . . . . . [8463-29]
Posters-Wednesday . . . . . . . . . . . . . . . . . Wed. 5:30 to 7:30 pmConference attendees are invited to attend the poster session on Wednesday evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
Low-index cladded wire grating as broadband polarizing mirror,Jyh-RouSze,InstrumentTechnologyResearchCtr.(Taiwan);An-ChiWei,PowerLensTechnology,Inc.(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8463-49]
New low-cost method to produce micro- and nano-structured surfaces,WolfgangHornig,BPEe.K.(Germany). . . . . . . . . . . . . . . . . . . . . . . . . [8463-50]
The effects of temperature and hydrostatic pressure on the optical properties of double semi-parabolic quantum wells,AlirezaKeshavars,MohamadJavadKarimi,ShirazUniv.ofTechnology(Iran,IslamicRepublicof) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8463-51]
Thermoelectric device based on the silicon nanowires,MoongyuJang,TaehyoungZyung,YoungsamPark,YounghoonHyun,WonchulChoi,ElectronicsandTelecommunicationsResearchInstitute(Korea,Republicof) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8463-52]
Sensors based on highly birefringent slot microfiber,QiLiu,NanjingUniv.(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8463-53]
Study of stochastic resonance in a huge quantum dot network,HirokiFujino,
TakahideOya,YokohamaNationalUniv.(Japan). . . . . . . . . . . . . . . . . [8463-54]
Study of two-dimensional, device-error-redundant, single-electron oscillators systems,YoshisatoMurakami,TakahideOya,YokohamaNationalUniv.(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8463-55]
Method for the development of nanostructured surfaces for fabrication of biosensors,HectorSantiagoHernández,JuanL.Pichardo-Molina,RaúlA.Vazquez-Nava,Ctr.deInvestigacionesenÓpticaA.C.(Mexico). . . . . [8463-56]
Scanning absorption nanoscopy system using supercontinuum generation based on photonic crystal fiber,NoeulPark,Kyoung-DuckPark,MinGonKim,MunSeokJeong,GwangjuInstituteofScienceandTechnology(Korea,Republicof) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8463-57]
Nanostructural and morphologies study of La0.67Sr0.33Mn1-xTixO 3 thin films,MohdSyafiqZulfakar,HudaAbdullah,Univ.KebangsaanMalaysia(Malaysia). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8463-58]
Electrical properties of solution-processed semiconductor and SOG passivation layer by inkjet-printing,SangChulLim,Ji-YoungOh,ElectronicsandTelecommunicationsResearchInstitute(Korea,Republicof);SeongDeokAhn,,ElectronicsandTelecommunicationsResearchInstitute(Korea,Republicof);KyoungIkCho,JaeBonKoo,ElectronicsandTelecommunicationsResearchInstitute(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8463-59]
Fabrication and application of free-form continuous surface relief micro-optical elements,JingangWang,JingBu,YongYang,MingWeiWang,XiaocongYuan,NankaiUniv.(China). . . . . . . . . . . . . . . . . . . . . . . . . . [8463-60]
Thursday 16 AugustSESSION 5 . . . . . . . . . . . . . . . . . . . . . . . Thurs. 8:00 to 10:00 am
NanofabricationSession Chair: Louay A. Eldada, SunEdison(UnitedStates)
Fabricating chiral, 3D micron to nanostructures in a single lithography/etch cycle using metal-assisted chemical etching,OwenHildreth,GeorgiaInstituteofTechnology(UnitedStates);KonradRykaczewski,NationalInstituteofStandardsandTechnology(UnitedStates);C.P.Wong,GeorgiaInstituteofTechnology(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8463-30]
Large-area and high-resolution nanostructures by EUV interference lithography,LiWang,BerndTerhalle,AndreasLangner,BirgitPäivänranta,MohamadHojeij,JensGobrecht,YasinEkinci,PaulScherrerInstitut(Switzerland) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8463-31]
Femtosecond laser drilling of optical fibers for sensing in microfluidic channels,RicardasBuividas,SwinburneUniv.ofTechnology(Australia);MindaugasMikutis,ALTECHNACo.Ltd.(Lithuania);GediminasGervinskas,DanielDay,SwinburneUniv.ofTechnology(Australia);GintautasSlekys,AltechnaCo.Ltd.(Australia);SauliusJuodkazis,SwinburneUniv.ofTechnology(Australia). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8463-32]
Selectively patterned metal nanodots fabrication by combining block copolymer self-assembly and electron beam lithography,HiroyukiSuzuki,ReoKometani,SunaoIshihara,Shin’ichiWarisawa,TheUniv.ofTokyo(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8463-33]
Nanoscale superplastic forming of metallic thin films under laser shock,GaryCheng,HuangGao,PurdueUniv.(UnitedStates). . . . . . . . . . . . [8463-34]
Surface-relief formation in azo-polymers: a new nanostructuring tool,ArriPriimagi,AaltoUniv.SchoolofScienceandTechnology(Finland)andTokyoInstituteofTechnology(Japan);AleksandrKravchenko,AndriyShevchenko,VictorOvchinnikov,MattiKaivola,AaltoUniv.SchoolofScienceandTechnology(Finland). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8463-35]
SESSION 6 . . . . . . . . . . . . . . . . . . . Thurs. 10:30 am to 12:10 pm
Nano-Opto-Mechanical Systems ISession Chair: Eva M. Campo, Univ.ofPennsylvania(UnitedStates)
Attractive and repulsive optical forces in nanowire pairs (Invited Paper),PhilippeTassin,RongkuoZhao,ThomasKoschny,CostasM.Soukoulis,IowaStateUniv.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8463-36]
Graphene-nanoplatelet-based photomechanical actuators,JamesLoomis,BenKing,TomBurkhead,PengXu,NathanBessler,Univ.ofLouisville(UnitedStates);EugeneTerentjev,Univ.ofCambridge(UnitedKingdom);BalajiPanchapakesan,Univ.ofLouisville(UnitedStates) . . . . . . . . . . . . . . . [8463-37]
Probing metal nanoparticles via cathodoluminescence, electron energy-
Conference 8463
spie.org/opadvance · TEL:+13606763290 · help@spie.org 57
loss, and optical spectroscopies (Invited Paper),F.JavierGarcíadeAbajo,ViktorMyroshnychenko,ConsejoSuperiordeInvestigacionesCientíficas(Spain). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8463-38]
Bio-inspired artificial iris based on nematic elastomer,NuriaTorrasAndres,KirillE.Zinoviev,CarlosJ.Camargo,JaumeEsteve,ConsejoSuperiordeInvestigacionesCientíficas(Spain). . . . . . . . . . . . . . . . . . . . . . . . . . . . [8463-39]
Lunch/Exhibition Break.............................. 12:10to1:30pm
SESSION 7 . . . . . . . . . . . . . . . . . . . . . . . . Thurs. 1:30 to 3:00 pm
Nano-Opto-Mechanical Systems IISession Chair: Philippe Tassin, IowaStateUniv.(UnitedStates)
Mechanical supramolecular systems for hand-operating nanotechnology (Invited Paper),KatsuhikoAriga,NationalInstituteforMaterialsScience(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8463-40]
Focus ion beam milling and 3-dimension image reconstruction to study sub-surface morphology of electrospun CNT composites,EvaM.Campo,Univ.ofPennsylvania(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . [8463-41]
Light-induced mechanical effect in single- and few-layer graphene,JamesLoomis,BenKing,BalajiPanchapakesan,Univ.ofLouisville(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8463-42]
An analytical model for the opto-thermo-mechanical conversion mechanisms in a NOEMS-based energy harvester,JordiAgusti,Univ.AutònomadeBarcelona(Spain);AlexanderCuadrado,Univ.ComplutensedeMadrid(Spain);GabrielAbadal,Univ.AutònomadeBarcelona(Spain);JuanCarlosMartinez-Anton,JavierAlda,Univ.ComplutensedeMadrid(Spain). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8463-43]
Conference 8463
SESSION 8 . . . . . . . . . . . . . . . . . . . . . . . . Thurs. 3:30 to 5:10 pm
Nano-Opto-Mechanical Systems IIISession Chair: Katsuhiko Ariga, NationalInstituteforMaterialsScience
(Japan)
Nematic elastomer bistable actuator operated by light,KirillE.Zinoviev,NuriaTorrasAndres,CarlosJ.Camargo,JaumeEsteve,ConsejoSuperiordeInvestigacionesCientíficas(Spain). . . . . . . . . . . . . . . . . . . . . . . . . . . . [8463-44]
Carbon-based dimensional composites for actuation,JamesLoomis,BenKing,BalajiPanchapakesan,Univ.ofLouisville(UnitedStates). . . . . . [8463-45]
Pulsed laser cooling for cavity-optomechanical resonators,ShaiMachnes,JavierCerrillo,Univ.Ulm(Germany);MarkusAspelmeyer,WitlefWieczorek,Univ.Wien(Austria);MartinPlenio,AlexRetzker,Univ.Ulm(Germany)[8463-46]
Cis-trans photoisomerization of azobenzene upon excitation to the S1 state: an ab initio molecular dynamics and QM/MM study,MarekPederzoli,JiríPittner,J.HeyrovskyInstituteofPhysicalChemistryoftheASCR,v.v.i.(CzechRepublic);HansLischka,Univ.Wien(Austria);MarioBarbatti,Max-Planck-InstitutfürKohlenforschung(Germany) . . . . . . . . . . . . . . . . . . [8463-47]
Logic model design of NOMS education and dissemination activities for the visually impaired,EvaM.Campo,Univ.ofPennsylvania(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8463-48]
Optics+ Photonics
all paper presentations at this event become part of the world’s largest collection of optics and photonics research
PublishinSPIEProceedings-Timely-Relevant-Cited-Indexed
PresentatSPIEOptics+Photonics-Dynamic-Diverse-Current-Collaborative
SPIEDigitalLibrary.org
58 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Conference 8464Sunday-Wednesday 12-15 August 2012 • Proceedings of SPIE Vol. 8464
Nanobiosystems: Processing, Characterization, and Applications VConference Chairs:Norihisa Kobayashi, ChibaUniv.(Japan);Fahima Ouchen, AirForceResearchLab.(UnitedStates);Ileana Rau, PolytechnicalUniv.ofBucharest(Romania)
Program Committee:Carrie M. Bartsch, AirForceResearchLab.(UnitedStates);Liming Dai, CaseWesternReserveUniv.(UnitedStates);Ananth Dodabalapur, TheUniv.ofTexasatAustin(UnitedStates);James G. Grote, AirForceResearchLab.(UnitedStates);Emily M. Heckman, AirForceResearchLab.(UnitedStates);Kuniharu Ijiro, HokkaidoUniv.(Japan);Jung-Il Jin, KoreaUniv.(Korea,Republicof);François Kajzar, PolytechnicalUniv.ofBucharest(Romania);Sang Nyon Kim, AirForceResearchLab.(UnitedStates);Oksana Krupka, Univ.d’Angers(France);Charles Y. C. Lee, AirForceOfficeofScientificResearch(UnitedStates);Misoon Y. Mah, AirForceOfficeofScientificResearch(UnitedStates);Naoya Ogata, ChitoseInstituteofScienceandTechnology(Japan);Bruce H. Robinson, Univ.ofWashington(UnitedStates);Anna Samoc, TheAustralianNationalUniv.(Australia);Marek J. Samoc, WroclawUniv.ofTechnology(Poland);Niyazi Serdar Sariciftci, JohannesKeplerUniv.Linz(Austria);Kristi M. Singh, AirForceResearchLab.(UnitedStates);Andrew J. Steckl, Univ.ofCincinnati(UnitedStates);Morley O. Stone, AirForceResearchLab.(UnitedStates);Perry P. Yaney, Univ.ofDayton(UnitedStates)
Sunday 12 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 8:30 to 10:10 am
Session Chair: Fahima Ouchen, AirForceResearchLab.(UnitedStates)
Solid state lighting using deoxyribonucleic acid-phosphor blend (Invited Paper),JamesG.Grote,AirForceResearchLab.(UnitedStates). . . . [8464-01]
DNA nano-circuit for electronics (Keynote Presentation), NaoyaOgata,ChitoseInstituteofScienceandTechnology(Japan) . . . . . . . . . . . . . . . . . . . . [8464-02]
Kinetics of grating inscription in DR1: DNA-CTMA thin film, experiment and semi-intercalation approach (Invited Paper),AntoniC.Mitus,GrzegorzPawlik,JaroslawMysliwiec,AndrzejMiniewicz,WroclawUniv.ofTechnology(Poland);JamesG.Grote,AirForceResearchLab.(UnitedStates);FrançoisKajzar,Univ.d’Angers(France)andUniv.PolitehnicaBucharest(Romania);IleanaRau,Univ.PolitehnicaBucharest(Romania) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8464-03]
SESSION 2 . . . . . . . . . . . . . . . . . . . . . Sun. 10:30 am to 12:00 pm
Session Chair: Koen Clays, KatholiekeUniv.Leuven(Belgium)
Light-producing organisms from nature: inspiration for applied biophotonics (Keynote Presentation), DimitriDeheyn,Univ.ofCalifornia,SanDiego(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8464-04]
Photo and electronic properties of DNA-surfactant complex film (Invited Paper),NorihisaKobayashi,MayuFukabori,KazukiNakamura,ChibaUniv.(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8464-05]
Transient response of DNA-clevios P-CTMA biopolymers and application in metal-biopolymer-metal photodetectors,BinZhou,TianmuZhang,Univ.atBuffalo(UnitedStates);BrianTelek,FahimaOuchen,CarrieM.Bartsch,EmilyM.Heckman,AirForceResearchLab.(UnitedStates);AlexanderN.Cartwright,Univ.atBuffalo(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8464-06]
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:00to2:10pm
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 2:10 to 3:00 pm
Session Chair: Jaroslaw Mysliwiec, WroclawUniv.ofTechnology(Poland)
Microporous, multilayered DNA/polyaniline structures (Invited Paper),OlafKarthaus,TakuyaOkamoto,AkiSato,ChitoseInstituteofScienceandTechnology(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8464-08]
DNA-based, thin-film dielectrics for applications as gate insulators in FETs,FahimaOuchen,AirForceResearchLab.(UnitedStates);NarayananVenkat,Univ.ofDaytonResearchInstitute(UnitedStates);KristiM.Singh,MouShin,DonnaJoyce,AirForceResearchLab.(UnitedStates);PerryP.Yaney,Univ.ofDayton(UnitedStates);EmilyM.Heckman,CarrieM.Bartsch,JamesG.Grote,AirForceResearchLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . [8464-09]
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 3:20 to 5:30 pm
Session Chair: Olaf Karthaus, ChitoseInstituteofScienceandTechnology(Japan)
Enhancement of red emission from Eu(III) complex-doped DNA-CTMA film,KazukiNakamura,AmikaSagara,NorihisaKobayashi,ChibaUniv.(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8464-10]
Room temperature coulomb blockade in a DNA-templated metal/polymer-alternated hybrid nanowire (Invited Paper),KuniharuIjiro,GuoqingWang,HokkaidoUniv.(Japan);HirofumiTanaka,LiuHong,OsakaUniv.(Japan);YasutakaMatsuo,KenichiNiikura,HokkaidoUniv.(Japan)andJST-CREST(Japan);MasuhiroAbe,KazuhikoMatsumoto,TakujiOgawa,OsakaUniv.(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8464-11]
Influence of surfactant on dynamics of photoinduced motions in a dye-doped deoxyribonucleic acid (Invited Paper),JaroslawMysliwiec,AndrzejMiniewicz,WroclawUniv.ofTechnology(Poland);BouchtaSahraoui,Univ.d’Angers(France);JacekNiziol,AGHUniv.ofScienceandTechnology(Poland);EdytaHebda,JanPielichowski,KrakowUniv.ofTechnology(Poland) [8464-12]
Novel cationic dye and crosslinkable surfactant for DNA biophotonics,LewisE.Johnson,LukeN.Latimer,StephanieJ.Benight,ZacharyH.Watanabe-Gastel,DelwinL.Elder,Univ.ofWashington(UnitedStates);CarrieM.Bartsch,EmilyM.Heckman,AirForceResearchLab.(UnitedStates);BruceH.Robinson,Univ.ofWashington(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . [8464-13]
Tunable DFB dye lasers based on DNA-surfactant complexes (Invited Paper),ToshifumiChida,YutakaKawabe,ChitoseInstituteofScienceandTechnology(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8464-14]
Symposium-Wide Plenary Session . . . . . . . . . . . . . . . . . . . . Sun. 6:00 to 7:25 pm6:00pm: Introduction and Opening Remarks
6:05pm: The Exciting Science of Light with Metamaterials, VladimirM.Shalaev,PurdueUniv.(USA)
6:45pm:Future of Optics and Photonics, BahaaE.A.Saleh,CREOL,TheCollegeofOpitcsandPhotonicsattheUniv.ofCentralFlorida(USA)
spie.org/opadvance · TEL:+13606763290 · help@spie.org 59
Monday 13 AugustNanoScience + Engineering Plenary Session . . . . . . . . . . . . . . . Mon. 8:30 am to 12:00 pm
Session Chairs:Satoshi Kawata,OsakaUniv.(Japan)and Manijeh Razeghi, NorthwesternUniv.(USA)
8:30am:The Light and Sound Fantastic: Radiation Pressure at the Nanoscale, OskarPainter,CaliforniaInstituteofTechnology(USA)
9:15am:Organics and Nanostructures for Nonlinear Optics, NasserPeyghambarian,CollegeofOpticalSciences,TheUniv.ofArizona(USA)
CoffeeBreak . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10:00to10:30am
10:30am:From Nanophotonics, to Metaphotonics, to Dynamic Photonics: Controlling Light Propagation and Light-Matter Interactions for Emerging Technologies, ParasPrasad,Univ.atBuffalo(USA)
11:15am:Global Activities in Novel-Nano Magnetic Materials for Magnetic, Optoelectronics Applications,MisoonMah,AsianOfficeofAerospaceDevelopment(Japan)
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:00to2:00pm
SESSION 5 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 2:00 to 5:00 pm
Nanobiosystems and Optical Processes in Organic Materials and Nanostructures: Joint Session with
Conference 8474Session Chair: James G. Grote, AirForceResearchLab.(UnitedStates)
Nanophotonics technology and applications(Keynote Presentation),YeshaiahuFainman,Univ.ofCalifornia,SanDiego(UnitedStates). . . [8464-15]
Semiconductor nano photonics for bio sensing(Keynote Presentation),ManijehRazeghi,NorthwesternUniv.(UnitedStates) . . . . . . . . . . . . . [8464-16]
Title to be announced(Keynote Presentation),KennethD.Singer,CaseWesternReserveUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . [8464-17]
Optoelectronics using DNA as a template for dyes(Keynote Presentation),GregoryA.Sotzing,Univ.ofConnecticut(UnitedStates)andAirForceResearchLab.(UnitedStates);DonnaMamangum,DamindaNavarathne,Univ.ofConnecticut(UnitedStates);JackP.Lombardi,AirForceInstituteofTechnology(UnitedStates);CarrieM.Bartsch,EmilyM.Heckman,KristiM.Singh,JamesG.Grote,ThomasR.Nelson,Jr.,AirForceResearchLab.(UnitedStates)[8464-07]
Tuesday 14 AugustSESSION 6 . . . . . . . . . . . . . . . . . . . . . . . . Tues. 8:30 to 10:00 am
Session Chair: Norihisa Kobayashi, ChibaUniv.(Japan)
Biphotonic chromophores for photodynamic therapy: molecular engineering and biological data (Invited Paper),ChantalAndraud,EcoleNormaleSupérieuredeLyon(France). . . . . . . . . . . . . . . . . . . . . . . . . . [8464-19]
Silk fibroin is a biofunctional interfaces for neural cells in electronic device (Invited Paper),ValentinaBenfenati,IstitutoperloStudiodeiMaterialiNanostrutturati(Italy);AnnaSagnella,AssuntaPistone,IstitutoperlaSintesiOrganicaelaFotoreattività(Italy);KatjaStahl,Univ.ofOslo(Norway);CarolinaGomis-Perez,Univ.degliStudidiBologna(Italy);GiampieroRuani,StefanoToffanin,IstitutoperloStudiodeiMaterialiNanostrutturati(Italy);ReidunTorp,Univ.ofOslo(Norway);DavidL.Kaplan,FiorenzoG.Omenetto,TuftsUniv.(UnitedStates);RobertoZamboni,IstitutoperlaSintesiOrganicaelaFotoreattività(Italy);MicheleMuccini,IstitutoperloStudiodeiMaterialiNanostrutturati(Italy). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8464-20]
Janus tecton: a platform for nanobiosystems? (Invited Paper),André-JeanAttias,Univ.PierreetMarieCurie(France);DavidKreher,FabriceMathevet,UnivPierreetMarieCurie(France);FabriceCharra,Commissariatàl’ÉnergieAtomique(France). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8464-21]
SESSION 7 . . . . . . . . . . . . . . . . . . . . Tues. 10:30 am to 12:10 pm
Session Chair: Roberto Zamboni, IstitutoperlaSintesiOrganicaelaFotoreattività(Italy)
DNA, sugars, and proteins at work in optics(Keynote Presentation),KoenClays,KatholiekeUniv.Leuven(Belgium). . . . . . . . . . . . . . . . . . . . . . . [8464-22]
Organic nanoparticles as a central plateform of magnetofluorescent nano-assemblies toward two-photon bioimaging applications (Invited Paper),ElénaIshow,Univ.deNantes(France). . . . . . . . . . . . . . . . . . . . . . . . . [8464-23]
Fluorescence and SHG in organic nanocrystals of DCNP (Invited Paper),AndrzejMiniewicz,KrystynaPalewska,PawelKarpinski,LechSznitko,WroclawUniv.ofTechnology(Poland) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8464-24]
Lunch/Exhibition Break.............................. 12:10to1:40pm
SESSION 8 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 1:40 to 3:10 pm
Session Chair: Andrzej Miniewicz, WroclawUniv.ofTechnology(Poland)
Advances in DNA photonics(Keynote Presentation),EmilyM.Heckman,AirForceResearchLab.(UnitedStates);EmilyM.Fehrman-Cory,Univ.ofDayton(UnitedStates);RobertoS.Aga,Jr.,GeneralDynamicsInformationTechnology(UnitedStates);BrianTelek,AlyssaLesko,Univ.ofDayton(UnitedStates);FahimaOuchen,AirForceResearchLab.(UnitedStates);JackP.Lombardi,AirForceInstituteofTechnology(UnitedStates);CarrieM.Bartsch,JamesG.Grote,AirForceResearchLab.(UnitedStates) . . . . . . . . . . . . . . . . . . [8464-25]
Doping and characterization of nonlinear optical properties of DNA complexes with NLO chromophores (Invited Paper),IleanaRau,AureliaMeghea,AnaMariaManea,AlexandrinaTane,PolytechnicalUniv.ofBucharest(Romania);FrançoisKajzar,PolytechnicalUniv.ofBucharest(Romania)andUniv.Angers(France) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8464-26]
Comparison of transport properties of DNA-based and P3HT-based films fabricated in air versus fabricated and sealed in nitrogen atmosphere,PerryP.Yaney,Univ.ofDayton(UnitedStates);FahimaOuchen,AirForceResearchLab.(UnitedStates);TimothyGorman,Univ.ofDayton(UnitedStates);JamesG.Grote,AirForceResearchLab.(UnitedStates) . . . . . . . . . . . . . . . . . . [8464-27]
SESSION 9 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 3:40 to 6:00 pm
Session Chair: Ileana Rau, PolytechnicalUniv.ofBucharest(Romania)
Organic optoelectronics and photonics silk-based devices (Invited Paper),RobertoZamboni,IstitutoperlaSintesiOrganicaelaFotoreattività(Italy);ValentinaBenfenati,RaffaellaCapelli,IstitutoperloStudiodeiMaterialiNanostrutturati(Italy);JasonAmsden,TuftsUniv.(UnitedStates);GianlucaGenerali,IstitutoperloStudiodeiMaterialiNanostrutturati(Italy);AnnaSagnella,AssuntaPistone,IstitutoperlaSintesiOrganicaelaFotoreattività(Italy);SunghwanKim,TuftsUniv.(UnitedStates);StefanoToffanin,IstitutoperloStudiodeiMaterialiNanostrutturati(Italy);DavidL.Kaplan,TuftsUniv.(UnitedStates);MicheleMuccini,IstitutoperloStudiodeiMaterialiNanostrutturati(Italy);FiorenzoG.Omenetto,TuftsUniv.(UnitedStates). . . . . . . . . . . . . . . . [8464-28]
Bio-dielectric organic-inorganic hybrid films for energy storage applications,DonnaJoyce,AirForceResearchLab.(UnitedStates);FahimaOuchen,NarayananVenkat,StevenR.Smith,Univ.ofDaytonResearchInstitute(UnitedStates);KristiM.Singh,UES,Inc.(UnitedStates);JamesG.Grote,AirForceResearchLab.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . [8464-29]
Multilayered photosensor with bacteriorhodopsin film (Invited Paper),YoshikoOkada-Shudo,TheUniv.ofElectro-Communications(Japan)[8464-30]
QMMM modeling of NLO properties of chromophores in bio-environments (Invited Paper),HansÅgren,A.Murugan,Z.Rinkevicius,RoyalInstituteofTechnology(Sweden). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8464-31]
Water-soluable conjugated polyelectrolytes for two-photon biological imaging and fluorescence biosensors (Invited Paper),HanYoungWoo,PusanNationalUniv.(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . [8464-32]
Conference 8464
60 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Wednesday 15 AugustPosters-Wednesday . . . . . . . . . . . . . . . . . Wed. 5:30 to 7:30 pm
Conference attendees are invited to attend the poster session on Wednesday evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
Characterization of fracture properties of A 2 and D 2 tool steels using the nanoindenter,UzochukwuC.Okafor,Univ.ofNorthTexas(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8464-33]
Indirect versus direct charge transfer from immobilized photosynthetic proteins to a carbon electrode in a photovoltaic device,ArashTakshi,HoumanYaghoubi,Univ.ofSouthFlorida(UnitedStates);AliMahmoudzadeh,RafaelSaer,JohnD.Madden,J.ThomasBeatty,TheUniv.ofBritishColumbia(Canada) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8464-34]
Extension of the spectral range of bacteriorhodopsin functional activity by energy transfer from quantum dots,VladimirA.Oleinikov,MoscowEngineeringPhysicsInstitute(RussianFederation);NicolasBouchonville,MichaelMolinari,Univ.deReimsChampagne-Ardenne(France);SvetlanaV.Sizova,KonstantinE.Mochalov,AntonChistyakov,MoscowEngineeringPhysicsInstitute(RussianFederation);AlyonaSukhanova,TrinityCollegeDublin(Ireland)andMoscowEngineeringPhysicsInstitute(RussianFederation);AlexanderSchapov,MikhailArtemyev,MoscowEngineeringPhysicsInstitute(RussianFederation);IgorR.Nabiev,TrinityCollegeDublin(Ireland);EvgeniyLukashev,LomonosovMoscowStateUniv.(RussianFederation). . . . [8464-35]
Hyperspectral polarized light scattering to study tumor cells in in-vitro samples,NicolasRiviere,RomainCeolato,ONERA(France);CorinneLorenzo,RaphaelJorand,InstitutdesTechnologiesAvancéesensciencesduVivant(France). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8464-36]
Synthesis and characterization of porous nano crystalline biphasic calcium phosphate for bio applications,MichaelS.Shanthi,MahalingamAshok,ThailampilaiBalasubramanian,NationalInstituteofTechnology,Tiruchirappalli(India). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8464-37]
Nanobiosystem properties obtained from fungal insoluble metabolite,NicoletaRadu,CosminCorobea,InstitutulNationaldeCercetare(Romania);IleanaRau,PolytechnicalUniv.ofBucharest(Romania) . . . . . . . . . . . [8464-38]
Processing and characterisation of nanobiosystem obtained from microbial soluble metabolite,NicoletaRadu,CosminCorobea,InstitutulNationaldeCercetare(Romania);IleanaRau,PolytechnicalUniv.ofBucharest(Romania). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8464-39]
Conference 8464
spie.org/opadvance · TEL:+13606763290 · help@spie.org 61
Conference 8465Tuesday-Thursday 14-16 August 2012 • Proceedings of SPIE Vol. 8465
Nanostructured Thin Films VConference Chairs:Tom G. Mackay, TheUniv.ofEdinburgh(UnitedKingdom);Yi-Jun Jen, NationalTaipeiUniv.ofTechnology(Taiwan);Raúl J. Martín-Palma, Univ.AutónomadeMadrid(Spain)
Program Committee:Hatice Altug, BostonUniv.(UnitedStates);Didier Felbacq, Univ.Montpellier2(France);Krzysztof Kempa, BostonCollege(UnitedStates);Akhlesh Lakhtakia, ThePennsylvaniaStateUniv.(UnitedStates);H. Angus Macleod, ThinFilmCenter,Inc.(UnitedStates);N. Asger Mortensen, TechnicalUniv.ofDenmark(Denmark);Sidney J. Ribeiro, Univ.EstadualPaulista(Brazil);Michael J. Sailor, Univ.ofCalifornia,SanDiego(UnitedStates);Geoffrey B. Smith, Univ.ofTechnology,Sydney(Australia);Motofumi Suzuki, KyotoUniv.(Japan)
Sunday 12 AugustSymposium-Wide Plenary Session . . . . . . . . . . . . . . . . . . . . Sun. 6:00 to 7:25 pm6:00pm: Introduction and Opening Remarks
6:05pm: The Exciting Science of Light with Metamaterials, VladimirM.Shalaev,PurdueUniv.(USA)
6:45pm:Future of Optics and Photonics, BahaaE.A.Saleh,CREOL,TheCollegeofOpitcsandPhotonicsattheUniv.ofCentralFlorida(USA)
Monday 13 AugustNanoScience + Engineering Plenary Session . . . . . . . . . . . . . . . Mon. 8:30 am to 12:00 pm
Session Chairs:Satoshi Kawata,OsakaUniv.(Japan)and Manijeh Razeghi, NorthwesternUniv.(USA)
8:30am:The Light and Sound Fantastic: Radiation Pressure at the Nanoscale, OskarPainter,CaliforniaInstituteofTechnology(USA)
9:15am:Organics and Nanostructures for Nonlinear Optics, NasserPeyghambarian,CollegeofOpticalSciences,TheUniv.ofArizona(USA)
CoffeeBreak . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10:00to10:30am
10:30am:From Nanophotonics, to Metaphotonics, to Dynamic Photonics: Controlling Light Propagation and Light-Matter Interactions for Emerging Technologies, ParasPrasad,Univ.atBuffalo(USA)
11:15am:Global Activities in Novel-Nano Magnetic Materials for Magnetic, Optoelectronics Applications,MisoonMah,AsianOfficeofAerospaceDevelopment(Japan)
Tuesday 14 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . Tues. 8:30 to 10:20 pm
Nanostructured Solar CellsSession Chair: Raúl J. Martín-Palma, Univ.AutónomadeMadrid
(Spain)
Organic photovoltaics: current status and future opportunities (Invited Paper),BernardKippelen,GeorgiaInstituteofTechnology(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8465-01]
Nanostructured metal and semiconductor films for solar cells (Invited Paper),MarkL.Brongersma,StanfordUniv.(UnitedStates). . . . . . . . [8465-02]
Nanostructured photonics thin films for sustainable energy (Invited Paper),JifengLiu,XiaoxinWang,ThayerSchoolofEngineeringatDartmouth(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8465-03]
Effects of rapid thermal processing and pulse-laser sintering on CdTe nanowire films for photovoltaic applications,KellyM.Rickey,LiangliangChen,S.VenkataprasadBhat,YueWu,XiulinRuan,PurdueUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8465-04]
SESSION 2 . . . . . . . . . . . . . . . . . . . . Tues. 10:50 am to 12:30 pm
Fundamentals and ApplicationsSession Chair: Bernard Kippelen, GeorgiaInstituteofTechnology
(UnitedStates)
Plasmonic dipole antennae on silicon (Invited Paper),SabaSiadat,Univ.ofOttawa(Canada);MohammadAlavirad,CarletonUniv.(Canada);DerekA.McNamara,Univ.ofOttawa(Canada);LangisRoy,CarletonUniv.(Canada);PierreBerini,Univ.ofOttawa(Canada). . . . . . . . . . . . . . . . . . . . . . . . . [8465-05]
Ultra-thin epitaxial metallic films on semiconductors: a playground for exploration of novel quantum phenomena at nanoscale (Invited Paper),Chih-KangShih,TheUniv.ofTexasatAustin(UnitedStates) . . . . . . . . . . . [8465-06]
Application of carbon-aluminum nanostructures in divertors coatings from fusion reactor,VictorCiupina,RodicaVladoiu,Univ.OvidiusConstanta(Romania);CristianLungu,NationalInstituteforLasers,PlasmaandRadiationPhysics(Romania);GabrielProdan,OvidiusUniversityConstanta(Romania);ConstantinPorosnicu,NationalInstituteforLasers,PlasmaandRadiationPhysics(Romania);MadalinaProdan,MirelaContulov,AureliaMandes,VirginiaDinca,Iuliana-MihaelaStanescu,Univ.OvidiusConstanta(Romania);VasileZarovschi,NationalInstituteforLasers,PlasmaandRadiationPhysics(Romania) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8465-07]
Development of drug delivery systems based on nanostructured porous silicon loaded with the anti-tumoral drug emodin adsorbed on silver nanoparticles,MargaritaHernández,ConsejoSuperiordeInvestigacionesCientíficas(Spain);GonzaloRecio-Sánchez,Univ.AutónomadeMadrid(Spain);PazSevilla,Univ.ComplutensedeMadrid(Spain);VicenteTorres-Costa,Univ.AutónomadeMadrid(Spain);JoséV.García-Ramos,ConcepciónDomingo,ConsejoSuperiordeInvestigacionesCientíficas(Spain);RaúlJ.Martín-Palma,Univ.AutónomadeMadrid(Spain). . . . . . . . . . . . . . . . . . . . . . . . . . . . [8465-08]
Lunch/Exhibition Break.............................. 12:30to2:00pm
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 2:00 to 4:30 pm
Theoretical StudiesSession Chair: Akhlesh Lakhtakia, ThePennsylvaniaStateUniv.
(UnitedStates)
Where effective medium theories fail (Invited Paper),BrunoGompf,Univ.Stuttgart(Germany). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8465-09]
Strong coupling in an hybrid dielectric-metal nanostructure (Invited Paper),DidierFelbacq,AuroreCastanie,Univ.Montpellier2(France);EmmanuelKling,Sagem(France). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8465-10]
Functional optical coatings based on plasmonic nanocomposites,SergeyG.Moiseev,InstituteofRadioEngineeringandElectronics(RussianFederation)andUlyanovskStateUniversity(RussianFederation)andUlyanovskStateTechnicalUniversity(RussianFederation). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8465-11]
Modeling laser ablation growth by diffusion limited aggregation,RudreshGhosh,ReneLopez,TheUniv.ofNorthCarolinaatChapelHill(UnitedStates);DavidB.Geohegan,JasonReadle,AlexA.Puretzky,ChristopherRouleau,OakRidgeNationalLab.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . [8465-12]
Application of the complex poynting theorem to metamaterial multilayered nanostructures,RolaAylo,ParthaBanerjee,GeorgesNehmetallah,Univ.ofDayton(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8465-13]
62 spie.org/opadvance · TEL:+13606763290 · help@spie.org
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 4:30 to 5:20 pm
Biomimetic NanostructuresSession Chair: Didier Felbacq, Univ.Montpellier2(France)
Plasma processed biomimetic nanostructures and molecular sensing (Invited Paper),SurojitChattopadhyay,NationalYang-MingUniv.(Taiwan) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8465-14]
Hydrophobic and color-producing mechanisms in Papilio blumei butterfly,Mei-LingLo,Cheng-ChungLee,NationalCentralUniv.(Taiwan) . . . . [8465-15]
Wednesday 15 AugustSESSION 5 . . . . . . . . . . . . . . . . . . . . . . . . . .Wed. 8:00 to 9:50 am
Fabrication and Characterization ISession Chair: Yi Jun Jen, NationalTaipeiUniv.ofTechnology(Taiwan)
Synthesis and self-assembly of Au nanorods and AuAg nanoparticles with engineered optical properties (Invited Paper),JosephB.Tracy,NorthCarolinaStateUniv.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8465-16]
Towards new levels for stacking of sol-gel nanostructured coatings,PhilippeF.Belleville,XavierDieudonné,KarineVallé,HervéPiombini,Commissariatàl’ÉnergieAtomique(France) . . . . . . . . . . . . . . . . . . . . [8465-17]
ZnO based multilayer films: synthesis and characterization,AnnikaPohl,UlrikaKvist,MikaelOttosson,PeterSvedlindh,RonnyKnut,OlofKaris,UppsalaUniv.(Sweden);WeiWan,XiadongZou,StockholmUniv.(Sweden). . [8465-18]
Detecting InGaN compositional inhomogeneities using atom probe tomography,TyJ.Prosa,DavidJ.Larson,DavidOlson,PeterClifton,CamecaInstruments,Inc.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8465-19]
Large-area nanoparticle nanoimprinting enabled by high-speed laser direct writing,DaehoLee,AlexSherry,EunpaKim,HengPan,Univ.ofCalifornia,Berkeley(UnitedStates);SeungHwanKo,KAIST(Korea,Republicof);CostasGrigoropoulos,Univ.ofCalifornia,Berkeley(UnitedStates) . . . . . . . . [8465-20]
SESSION 6 . . . . . . . . . . . . . . . . . . . . Wed. 10:20 am to 12:00 pm
Optical DetectionSession Chair: Joseph B Tracy, NorthCarolinaStateUniv.(United
States)
Luminescence quenching of ZnO nano-wires for TNT sensing applications,RoyAad,UniversityofTechnologyofTroyes(France);VesnaSimic,Commissariatàl’ÉnergieAtomique(France);CorinneSartel,VincentSallet,Univ.deVersaillesSaint-Quentin-enYvelines(France);ChristopheCouteau,GillesLérondel,Univ.deTechnologieTroyes(France). . . . . . . . . . . . . . . . . . [8465-21]
Ammonia gas sensing by tridoped p-ZnO thin film,BalakrishnanLakshmiNarayanan,GowrishankarSubramaniam,JayaramanElanchezhiyan,GopalakrishnanNammalvar,NationalInstituteofTechnology,Tiruchirappalli(India). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8465-22]
Fabrication of nano-structured thin film sensors and development of processes for multiple applications with data showing sufficient sensitivities for detection of RDX explosive and e-coli bacteria,JohnC.Corda,MichaelCurley,AshwithK.Chilvery,TatianaKukhatreva,AlabamaA&MUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8465-23]
Optical property and SERS spectrum measurements for silver-pillar arrays,YiJunJen,YungHsiangWang,ChingWeiYu,MengJieLin,NationalTaipeiUniv.ofTechnology(Taiwan) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8465-24]
Gold-coated nanoporous membranes for SERS studies,PaulD.Robinson,AschalewKassu,AnupSharma,AlabamaA&MUniv.(UnitedStates),PaulRuffin,ChrisitnaBrantley,EugeneEdwards,U.S.ArmyAviationandMissileCommand(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8465-25]
Lunch/Exhibition Break.............................. 12:00to1:30pm
SESSION 7 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 1:30 to 3:20 pm
Fabrication and Characterization IISession Chair: Vijayakumar Venugopal, FiatLuxTechnologies(United
States)
Optical metamaterial thin films by nanoparticle self-assembly (Invited Paper),WounjhangPark,Univ.ofColoradoatBoulder(UnitedStates). . . . . . [8465-26]
Tunable stoichiometry of thin films through multi-target PLD and magnetron sputtering with in situ ellipsometry,JohnG.Jones,AirForceResearchLab.(UnitedStates);LirongSun,GeneralDynamicsInformationTechnology(UnitedStates);JohnT.Grant,Univ.ofDaytonResearchInstitute(UnitedStates);NeilR.Murphy,AirForceResearchLab.(UnitedStates);MatthewA.Lange,AirForceInstituteofTechnology(UnitedStates);JamieJ.Gengler,SpectralEnergies(UnitedStates);RachelJakubiak,AirForceResearchLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8465-27]
SHG investigation of physical confinement and interfacial effects of piezoelectric nano-layered PVDF films,JenniferJones,VanderbiltUniv.(UnitedStates)andFiskUniversity(UnitedStates);RichardMu,FiskUniv.(UnitedStates);NormanTolk,VanderbiltUniv.(UnitedStates);LeiZhu,CaseWesternReserveUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . [8465-28]
Plasmon-enhanced laser heating of gold::vanadium dioxide nanocomposites,DavonW.Ferrara,EvanR.MacQuarrie,VictorDiez-Blanco,JoyeetaNag,RichardF.Haglund,Jr.,VanderbiltUniv.(UnitedStates)[8465-29]
Utilization of modulated pulsed power magnetron sputtering for the enhanced density of room temperature deposited a-germanium films,NeilR.Murphy,LirongSun,JohnG.Jones,AirForceResearchLab.(UnitedStates);ChintalapalleV.Ramana,TheUniv.ofTexasatElPaso(UnitedStates);RachelJakubiak,AirForceResearchLab.(UnitedStates). . . . . . . . . . . . . . . . [8465-30]
SESSION 8 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 3:50 to 5:00 pm
Sculptured Thin FilmsSession Chair: Wounjhang Park, Univ.ofColoradoatBoulder(United
States)
Sculptured thin films as 3D photonic crystals (Invited Paper),VijayakumarVenugopal,FiatLuxTechnologies(UnitedStates). . . . . . . . . . . . . . . . [8465-31]
Nanorod pillars and square nanospirals with serial metal-dielectric structures,YiJunJen,HuangMingWu,NationalTaipeiUniv.ofTechnology(Taiwan);HungShengLiao,NationalTaipeiUnivofTechnology(Taiwan);Meng-JieLin,NationalTaipeiUniv.ofTechnology(Taiwan). . . . . . . . . . . . . . [8465-32]
Chiral-sculptured thin films as dual-functioning optical sensors,SuhanaJamaian,TomG.Mackay,TheUniv.ofEdinburgh(UnitedKingdom);AkhleshLakhtakia,ThePennsylvaniaStateUniv.(UnitedStates). . . . . . . . . . . [8465-33]
Posters-Wednesday . . . . . . . . . . . . . . . . . Wed. 5:30 to 7:30 pmConference attendees are invited to attend the poster session on Wednesday evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
Excitation of multiple surface-plasmon polariton waves at metal/chiral-sculptured thin-film interfaces,AkhleshLakhtakia,SemaErten,ThePennsylvaniaStateUniv.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . [8465-41]
Suppression of circular Bragg phenomenon in chiral sculptured thin films produced with simultaneous rocking and rotation of substrate during serial bideposition,StephenE.Swiontek,DrewPulsifer,JianXu,AkhleshLakhtakia,ThePennsylvaniaStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . [8465-42]
Synchrotron radiation technological studies on nano-scale Si 3N 4 film for sub-50nm Si-IC application,ZheChuanFeng,NationalTaiwanUniv.(Taiwan);YingLangWang,TaiwanSemiconductorManufacturingCo.Ltd.(Taiwan);HwoShuennSheu,NationalSynchrotronRadiationResearchCtr.(Taiwan) [8465-43]
Manipulations of thermal emission by β-FeSi 2 thin films and nanostructures,YasuyukiKaneko,MotofumiSuzuki,KaoruNakajima,KenjiKimura,KyotoUniv.(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8465-44]
Low-temperature sol-gel processing and characterization of (Lu0,95Eu0,05)2O 3 phosphor film,NataliyaV.Babayevskaya,OleksijS.Bezkrovnyi,AlexandrV.Tolmachev,InstituteforSingleCrystals(Ukraine) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8465-45]
Conference 8465
spie.org/opadvance · TEL:+13606763290 · help@spie.org 63
Characterization of CdZnO thin films for ozone sensing,JihyunYu,HyunjinYang,HongsukMo,TaesuJeong,ChangjuYoun,ChonbukNationalUniv.(Korea,Republicof);KwangjoonHong,ChosunUniv.(Korea,Republicof) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8465-46]
Mg-doped ZnO nanoparticles syntheszed by sonochemical process for thin film transistors,Ji-YoungOh,SangChulLim,Chul-AmKim,Sang-SeokLee,Kyoung-IkCho,SeongDeokAhn,ElectronicsandTelecommunicationsResearchInstitute(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . [8465-47]
Characteristics of chemiresistor hydrogen sensor using various ZnO films incorporated with a Pt catalyst,Duy-ThachPhan,Univ.ofUlsan(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8465-48]
Optimizing the sensitivity of porous thin film optical sensors,TomG.Mackay,TheUniv.ofEdinburgh(UnitedKingdom) . . . . . . . . . . . . . . . [8465-49]
Significant enhancement of yellow-green light emission of ZnO nanorod arrays using Ag island films,Chin-AnLin,Dung-ShengTsai,Cheng-YingChen,Jr-HauHe,NationalTaiwanUniv.(Taiwan). . . . . . . . . . . . . . . . . . . . . . [8465-50]
Optical properties of nanostructured Ag-Al 2O 3 granular thin films,LeonidPoperenko,MykolaBiednov,IrinaYurgelevych,NationalTarasShevchenkoUniv.ofKyiv(Ukraine). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8465-51]
On alignment of liquid crystals in chiral sculptured thin films,HadarReisman,Ben-GurionUniv.oftheNegev(Israel);DrewPulsifer,RaúlJ.Martín-Palma,AkhleshLakhtakia,ThePennsylvaniaStateUniv.(UnitedStates);RomanS.Dabrowski,MilitaryUniv.ofTechnology(Poland);IbrahimAbdulhalimII,Ben-GurionUniv.oftheNegev(Israel). . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8465-52]
Novel anode for Li-ion rechargeable batteries: Al-nanorods thin films,S.K.Sharma,Bo-GyunKim,Jong-SungYu,ChejuNationalUniv.(Korea,Republicof) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8465-53]
Stress relaxation in nanostructured Al thin films grown on Ti/glass substrates,Bo-GyunKim,SanjeevK.Sharma,ChiKyuChoi,ChejuNationalUniv.(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8465-54]
Thursday 16 AugustSESSION 9 . . . . . . . . . . . . . . . . . . . . . . . Thurs. 9:00 to 10:30 am
Fabrication and Characterization IIISession Chair: Tom G. Mackay, TheUniv.ofEdinburgh(United
Kingdom)
Practical applications of thin films nanostructured by shadowing growth (Invited Paper),MotofumiSuzuki,KyotoUniv.(Japan). . . . . . . . . . . . . [8465-34]
Multilayered zinc oxide thin films deposited using reactive high-power impulse magnetron sputtering technique,LirongSun,AirForceResearchLab.(UnitedStates)andGeneralDynamicsInformationTechnology(UnitedStates);NeilR.Murphy,AirForceResearchLab.(UnitedStates);JohnT.Grant,AirForceResearchLab.(UnitedStates)andUniversityofDaytonResearchInstitute(UnitedStates);JohnG.Jones,RachelJakubiak,AirForceResearchLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8465-35]
Optical and luminescent properties of CdSe/ZnS and TiO 2 semiconductor quantum dots embedded into PMMA Layers,Hung-JuLin,Aix-MarseilleUniv.(France)andThinFilmTechnologyCenter,NationalCentralUniv.(Taiwan);Yu-JenChen,NationalCentralUniv.(Taiwan)andIM2NP,Aix-MarseilleUniversity(France);JudikaelLe-Rouzo,InstitutMatériauxMicroélectroniqueNanosciencesdeProvence(France);AlexandreMerlen,InstitutMateriauxNanoelectroniquedeProvence(France);WaldirAvansi,Jr.,Univ.deSãoPaulo(Brazil);Sheng-HuiChen,NationalCentralUniv.(Taiwan);FrançoisFlory,InstitutMatériauxMicroélectroniqueNanosciencesdeProvence(France)andEcoleCentraleMarseille(France);Cheng-ChungLee,NationalCentralUniv.(Taiwan);ValmorRobertoMastelaro,Univ.deSãoPaulo(Brazil) . . . . . . . . . . . . . . . . . . [8465-36]
Resistive switching characterization of Pt/ZnO/Pt capacitor under ultraviolet illumination,JoséRamónDuránRetamal,JrHauHe,WenYuanChang,JrJianKe,ChenFangKang,NationalTaiwanUniv.(Taiwan). [8465-37]
Conference 8465
SESSION 10 . . . . . . . . . . . . . . . . . . Thurs. 11:00 am to 12:00 pm
Fabrication and Characterization IVSession Chair: Motofumi Suzuki, KyotoUniv.(Japan)
On the gap reduction of tungsten overhanging electrodes fabricated by focused ion beam,AbhishekKumarSingh,JitendraKumar,IndianInstituteofTechnologyKanpur(India)................................... [8465-38]
Porous glass films prepared on the F-doped tin oxide coated soda-lime glass substrate using phase separation phenomenon,ChawonHwang,BongKiRyu,PusanNationalUniv.(Korea,Republicof). . . . . . . . . . . . . . . . [8465-39]
Nano-microstructured, superhydrophobic, and near-infrared antireflective thin films on glass,FlavioHorowitz,KellyC.Camargo,Univ.FederaldoRioGrandedoSul(Brazil);AlexandreF.Michels,Univ.deCaxiasdoSul(Brazil);FabianoRodembusch,Univ.FederaldoRioGrandedoSul(Brazil) . . [8465-40]
Books of Related InterestVisittheonsiteBookstoreororderonlinetoday:spie.org/publications
Nanotechnology: A Crash CoursebyRaúl J. Martín-PalmaandAkhlesh LakhtakiaVol.TT86
Physics and Applications of Negative Refractive Index MaterialsbyS. Anantha Ramakrishna andTomasz M. GrzegorczykVol.PM186
64 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Conference 8466Monday-Tuesday 13-14 August 2012 • Proceedings of SPIE Vol. 8466
Instrumentation, Metrology, and Standards for Nanomanufacturing, Optics, and Semiconductors VIConference Chair:Michael T. Postek, NationalInstituteofStandardsandTechnology(UnitedStates)
Conference Co-Chairs:Victoria A. Coleman, NationalMeasurementInstituteofAustralia(Australia);Ndubuisi G. Orji, NationalInstituteofStandardsandTechnology(UnitedStates)
Program Committee:Russell A. Chipman, CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates);Khershed P. Cooper, U.S.NavalResearchLab.(UnitedStates);Aaron Cordes, SEMATECHNorth(UnitedStates);John Cowie, Agenda2020TechnologyAlliance(UnitedStates);Nora Savage, U.S.EnvironmentalProtectionAgency(UnitedStates);John Small, NationalInstituteofStandardsandTechnology(UnitedStates);Shouhong Tang, KLA-TencorCorp.(UnitedStates);George Thompson, IntelCorp.(UnitedStates);Vladimir A. Ukraintsev, NanometrologyInternational,Inc.(UnitedStates);Xianfan Xu, PurdueUniv.(UnitedStates);Wei Zhou, RudolphTechnologies,Inc.(UnitedStates)
Sunday 12 AugustSymposium-Wide Plenary Session . . . . . . . . . . . . . . . . . . . . Sun. 6:00 to 7:25 pm6:00pm: Introduction and Opening Remarks
6:05pm: The Exciting Science of Light with Metamaterials, VladimirM.Shalaev,PurdueUniv.(USA)
6:45pm:Future of Optics and Photonics, BahaaE.A.Saleh,CREOL,TheCollegeofOpitcsandPhotonicsattheUniv.ofCentralFlorida(USA)
Monday 13 AugustNanoScience + Engineering Plenary Session . . . . . . . . . . . . . . . Mon. 8:30 am to 12:00 pm
Session Chairs:Satoshi Kawata,OsakaUniv.(Japan)and Manijeh Razeghi, NorthwesternUniv.(USA)
8:30am:The Light and Sound Fantastic: Radiation Pressure at the Nanoscale, OskarPainter,CaliforniaInstituteofTechnology(USA)
9:15am:Organics and Nanostructures for Nonlinear Optics, NasserPeyghambarian,CollegeofOpticalSciences,TheUniv.ofArizona(USA)
CoffeeBreak . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10:00to10:30am
10:30am:From Nanophotonics, to Metaphotonics, to Dynamic Photonics: Controlling Light Propagation and Light-Matter Interactions for Emerging Technologies, ParasPrasad,Univ.atBuffalo(USA)
11:15am:Global Activities in Novel-Nano Magnetic Materials for Magnetic, Optoelectronics Applications,MisoonMah,AsianOfficeofAerospaceDevelopment(Japan)
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:00to1:30pm
SESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 1:30 to 3:40 pm
Nanomanufacturing Metrology ISession Chairs: Michael T. Postek, NationalInstituteofStandards
andTechnology(UnitedStates);Victoria A. Coleman, NationalMeasurementInstituteofAustralia(Australia)
High-rate, roll-to-roll nanomanufacturing of flexible systems (Invited Paper),KhershedP.Cooper,U.S.NavalResearchLab.(UnitedStates);RalphF.Wachter,OfficeofNavalResearch(UnitedStates) . . . . . . . . . . . . . . . [8466-01]
Metrology and instrumentation challenges with high-rate, roll-to-roll manufacturing of flexible electronic systems,HarishSubbaraman,OmegaOptics,Inc.(UnitedStates);AnanthDodabalapur,TheUniv.ofTexasatAustin(UnitedStates);JayGuo,Univ.ofMichigan(UnitedStates);RayT.Chen,TheUniv.ofTexasatAustin(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . [8466-02]
Metrology challenges for high-rate nanomanufacturing of polymer structures,JoeyMead,CarolM.Barry,Univ.ofMassachusettsLowell(UnitedStates);AhmedA.Busnaina,JacquelineA.Isaacs,NortheasternUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8466-03]
Performances and limitations of lab-to-fab strategies for inline optical metrology,EmmanuelNolot,AgatheAndré,CEA-LETI-Minatec(France). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8466-04]
In-line control and characterization of nanomaterials synthesis from hyperspectral polarized light scattering,RomainCeolato,NicolasRiviere,ONERA(France);BéatriceBiscans,EcoleNationaleSupérieuredesIngénieursenArtsChimiqueetTechnologiques(France);LaurentHespel,ONERA(France). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8466-05]
Defect inspection strategies for 14 nm semiconductor technology,RalfBuengener,GLOBALFOUNDRIESInc.(UnitedStates). . . . . . . . . . . . . [8466-06]
SESSION 2 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 4:10 to 5:30 pm
Novel Instruments and Improvements ISession Chairs: Aaron Cordes, SEMATECHNorth(UnitedStates);Wei
Zhou, RudolphTechnologies,Inc.(UnitedStates)
Accelerating throughput of TEM metrology,AaronCordes,SEMATECHNorth(UnitedStates);JamesNadeau,FEICo.(UnitedStates) . . . . . . . . . . . [8466-07]
Object-depending artifacts in confocal measurements,FlorianMauch,MarcGronle,WolframLyda,WolfgangOsten,Univ.Stuttgart(Germany). . . [8466-08]
Advances in metrologies for the determination of Young’s modulus for low-k dielectric thin films,SeanKing,IntelCorp.(UnitedStates). . . [8466-09]
Blue irradiance intercomparison in the medical field,AntonioG.Ferreira,Jr.,IPT-InstitutodePesquisasTecnológicas(Brazil) . . . . . . . . . . . . . . . . [8466-10]
Tuesday 14 AugustSESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 8:30 to 9:50 am
Metrology and StandardsSession Chairs: Ndubuisi G. Orji, NationalInstituteofStandardsand
Technology(UnitedStates);Aaron Cordes, SEMATECHNorth(UnitedStates)
New reference material for transmission electron microscope calibration,ValeriyP.Gavrilenko,JSCCtr.forSurfaceandVacuumResearch(RussianFederation);MikhailFilippov,N.S.KurnakovInstituteofGeneralandInorganicChemistry(RussianFederation);MikhailKovalchuk,RussianResearchCtr.KurchatovInstitute(RussianFederation);VitaliyMityukhlyaev,AlexanderRakov,PavelTodua,JSCCtr.forSurfaceandVacuumResearch(RussianFederation);AlexanderVasiliev,RussianResearchCtr.KurchatovInstitute(RussianFederation) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8466-11]
First steps towards a scatterometry reference standard,BerndBodermann,Physikalisch-TechnischeBundesanstalt(Germany);Poul-ErikHansen,DanishFundamentalMetrologyLtd.(Denmark);SvenBurger,JCMwaveGmbH(Germany);Mark-AlexanderHenn,HermannA.Gross,MarkusBaer,AkikoKato,FrankScholze,JohannesEndres,MatthiasWurm,Physikalisch-TechnischeBundesanstalt(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8466-12]
Methodology and techniques for accurate and repeatable vertical edge height (VEH) calibration of CD-AFM probes,SeanHand,EricCottrell,JasonOsborne,AdamFeinstein,BrukerNanoInc.(UnitedStates) . . . . . . . . [8466-13]
Multiple-order imaging for optical critical dimension metrology using microscope characterization,JingQin,HuiZhou,BryanM.Barnes,FrancoisGoasmat,RonaldG.Dixson,RichardM.Silver,NationalInstituteofStandardsandTechnology(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8466-14]
spie.org/opadvance · TEL:+13606763290 · help@spie.org 65
SESSION 4 . . . . . . . . . . . . . . . . . . . . Tues. 10:20 am to 12:20 pm
Novel Instruments and Improvements IISession Chairs: Russell A. Chipman, CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates);Victoria A. Coleman, National
MeasurementInstituteofAustralia(Australia)
Design and performance of a novel near-field stimulated Raman microscope,DerekB.Nowak,MolecularVistaInc.(UnitedStates)andPortlandStateUniv.(UnitedStates);KamK.Leang,Univ.ofNevada,Reno(UnitedStates)andMolecularVista,Inc.(UnitedStates);SungI.Park,MolecularVistaInc.(UnitedStates);KumarWickramashinge,Univ.ofCalifornia,Irvine(UnitedStates)andMolecularVistaInc.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . [8466-15]
The study of light propagation in scattering and absorbing medium,DmitriiN.Vavulin,AntonV.Alfimov,AndreyPanteleev,ElizabethAryslanova,SergeyA.Chivilikhin,NationalResearchUniv.ofInformationTechnologies,MechanicsandOptics(RussianFederation) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8466-16]
Plasmonic-enhanced infrared photoexpansion nano-spectroscopy using tunable quantum cascade lasers,FengLu,MikhailA.Belkin,TheUniv.ofTexasatAustin(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8466-17]
Active retroreflector to measure the rotational orientation in conjunction with a laser tracker,OliverHofherr,Albert-Ludwigs-Univ.Freiburg(Germany);ChristianWachten,PImiCosGmbH(Germany);ClaasMueller,HolgerReinecke,Albert-Ludwigs-Univ.Freiburg(Germany). . . . . . . . . . . . . . . . . . . . . . . [8466-18]
Laser based shadow imaging of microscopic scenes: further development and investigations,CorneliusF.Hahlweg,HendrikRothe,Helmut-SchmidtUniv.(Germany). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8466-19]
A large-scale ceramic package of the CMOS image sensor chip for remote sensing application,Chia-HungChang,JerLing,Shih-HungLo,Wen-ChihHsu,NationalSpaceOrganization(Taiwan) . . . . . . . . . . . . . . . . . . . . . . . . . [8466-20]
Lunch/Exhibition Break.............................. 12:20to1:50pm
SESSION 5 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 1:50 to 3:20 pm
Characterization: Macro, Micro, and Nano ISession Chairs: Victoria A. Coleman, NationalMeasurementInstitute
ofAustralia(Australia);Ndubuisi G. Orji, NationalInstituteofStandardsandTechnology(UnitedStates)
Characterizing nanoparticles in sunscreen formulation: a case study (Invited Paper),VictoriaA.Coleman,KatherineM.Collins,NationalMeasurementInstituteofAustralia(Australia);BridgetIngham,IndustrialResearchLtd.(NewZealand);JanIlavsky,ArgonneNationalLab.(UnitedStates);JanHerrmann,NationalMeasurementInstituteofAustralia(Australia);MichaelF.Toney,SLACNationalAcceleratorLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . [8466-21]
Graphene Raman imaging and spectroscopy processing: characterization of graphene growth,MatiasG.Babenco,LaUniv.NacionaldeCórdoba(Argentina)andTheUniv.ofTexasatAustin(Argentina);LiTao,DejiAkinwande,TheUniv.ofTexasatAustin(UnitedStates). . . . . . . . . . . . . . . . . . . . . [8466-22]
Thickness and surface profile measurement of thin film stacks by using the spatial carrier phase-shifting technique,Chia-YuShen,KaiWu,Cheng-ChungLee,NationalCentralUniv.(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . [8466-23]
A portable modular optical sensor capable of measuring complex multi-axis strain fields,WeixinZhao,BurdetteT.Beck,RobertJ.Peterman,Chih-HangJ.Wu,KansasStateUniv.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . [8466-24]
SESSION 6 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 3:50 to 5:30 pm
Characterization: Macro, Micro, and Nano IISession Chairs: Wei Zhou, RudolphTechnologies,Inc.(UnitedStates);
Ndubuisi G. Orji, NationalInstituteofStandardsandTechnology(UnitedStates)
Non-destructive 3D characterization of microchannels,VilleHeikkinen,AntonNolvi,IvanKassamakov,Univ.ofHelsinki(Finland);SamiFranssila,AaltoUniv.SchoolofScienceandTechnology(Finland);EdwardHæggström,Univ.ofHelsinki(Finland). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8466-25]
Optical testing for meter level aspheric optics,PengSu,ChangJinOh,ChunyuZhao,JamesH.Burge,CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8466-26]
Comparison of refractive indices measured by m-lines and ellipsometry: application to polymer blend and ceramic thin films,ThomasM.Wood,JudikaelLeRouzo,InstitutMatériauxMicroélectroniqueNanosciencesdeProvence(France);FrançoisFlory,EcoleCentraleMarseille(France);PaulCoudray,KLOÉSA(France);PedroPelissari,ValmorMastelaro,SérgioC.Zilio,Univ.deSãoPaulo(Brazil) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8466-27]
Temperature distribution from Rosenthal calculation,MingchanQiu,AnhuiUniv.ofScienceandTechnology(China). . . . . . . . . . . . . . . . . . . . . . . [8466-28]
Compressive correlate imaging methodology for semiconductor metrology,JiangHe,YongZhang,YuanZhao,XuedongSun,HarbinInstituteofTechnology(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8466-29]
Conference 8466
66 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Conference 8467Wednesday-Thursday 15-16 August 2012 • Proceedings of SPIE Vol. 8467
Nanoepitaxy: Materials and Devices IVConference Chairs:Nobuhiko P. Kobayashi, Univ.ofCalifornia,SantaCruz(UnitedStates);A. Alec Talin, NationalInstituteofStandardsandTechnology(UnitedStates);M. Saif Islam, Univ.ofCalifornia,Davis(UnitedStates)
Program Committee:Kristine A. Bertness, NationalInstituteofStandardsandTechnology(UnitedStates);Albert Davydov, NationalInstituteofStandardsandTechnology(UnitedStates);Shadi A. Dayeh, LosAlamosNationalLab.(UnitedStates);Supratik Guha, IBMThomasJ.WatsonResearchCtr.(UnitedStates);Jung Han, YaleUniv.(UnitedStates);Chennupati Jagadish, TheAustralianNationalUniv.(Australia);Mutsumi Kimura, RyukokuUniv.(Japan);Takhee Lee, GwangjuInstituteofScienceandTechnology(Korea,Republicof);Marina S. Leite, CaliforniaInstituteofTechnology(UnitedStates);Francois Leonard, SandiaNationalLabs.,California(UnitedStates);Samuel S. Mao, LawrenceBerkeleyNationalLab.(UnitedStates);Sanjay Mathur, Univ.zuKöln(Germany);Samuel Tom Picraux, LosAlamosNationalLab.(UnitedStates);Sharka M. Prokes, U.S.NavalResearchLab.(UnitedStates);Zhifeng Ren, BostonCollege(UnitedStates);Atsuhito Sawabe, AoyamaGakuinUniv.(Japan);Fred Semendy, U.S.ArmyResearchLab.(UnitedStates);Loucas Tsakalakos, GEGlobalResearch(UnitedStates);Emanuel Tutuc, TheUniv.ofTexasatAustin(UnitedStates);Lionel Vayssieres, NationalInstituteforMaterialsScience(Japan);Deli Wang, Univ.ofCalifornia,SanDiego(UnitedStates);George T. Wang, SandiaNationalLabs.(UnitedStates)
Sunday 12 AugustSymposium-Wide Plenary Session . . . . . . . . . . . . . . . . . . . . Sun. 6:00 to 7:25 pm6:00pm: Introduction and Opening Remarks
6:05pm: The Exciting Science of Light with Metamaterials, VladimirM.Shalaev,PurdueUniv.(USA)
6:45pm:Future of Optics and Photonics, BahaaE.A.Saleh,CREOL,TheCollegeofOpitcsandPhotonicsattheUniv.ofCentralFlorida(USA)
Monday 13 AugustNanoScience + Engineering Plenary Session . . . . . . . . . . . . . . . Mon. 8:30 am to 12:00 pm
Session Chairs:Satoshi Kawata,OsakaUniv.(Japan)and Manijeh Razeghi, NorthwesternUniv.(USA)
8:30am:The Light and Sound Fantastic: Radiation Pressure at the Nanoscale, OskarPainter,CaliforniaInstituteofTechnology(USA)
9:15am:Organics and Nanostructures for Nonlinear Optics, NasserPeyghambarian,CollegeofOpticalSciences,TheUniv.ofArizona(USA)
CoffeeBreak . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10:00to10:30am
10:30am:From Nanophotonics, to Metaphotonics, to Dynamic Photonics: Controlling Light Propagation and Light-Matter Interactions for Emerging Technologies, ParasPrasad,Univ.atBuffalo(USA)
11:15am:Global Activities in Novel-Nano Magnetic Materials for Magnetic, Optoelectronics Applications,MisoonMah,AsianOfficeofAerospaceDevelopment(Japan)
Wednesday 15 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . . .Wed. 8:00 to 9:55 am
Nanowires ISession Chair: Nobuhiko P. Kobayashi, Univ.ofCalifornia,SantaCruz
(UnitedStates)
Bio-functionalized Si, SiC, and GaN nanowires for sensor applications,ElissaH.Williams,GeorgeMasonUniv.(UnitedStates)............ [8467-01]
III-V nanowires for energy applications (Invited Paper),SilvijaGradecak,MassachusettsInstituteofTechnology(UnitedStates). . . . . . . . . . . . [8467-02]
Engineering new phenomena and functionality in complex oxide thin film heterostructures: highly strained BiFeO 3 (Invited Paper),LaneW.Martin,Univ.ofIllinoisatUrbana-Champaign(UnitedStates). . . . . . . . . . . . . [8467-03]
Novel combinations of III-V materials in ternary and heterostructure nanowires (Invited Paper),KimberleyA.Dick,LundUniv.(Sweden). . [8467-04]
III-nitride nanowires: from the bottom-up to the top-down (Invited Paper),GeorgeT.Wang,QimingLi,JonathanJ.Wierer,DanielD.Koleske,JeffreyJ.Figiel,JeremyB.Wright,TingS.Luk,IgalBrener,SandiaNationalLabs.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8467-05]
SESSION 2 . . . . . . . . . . . . . . . . . . . . Wed. 10:30 am to 12:20 pm
Low-Dimensional Materials ISession Chair: A. Alec Talin, NationalInstituteofStandardsand
Technology(UnitedStates)
Selected topics in compound semiconductor research at Sandia National Laboratories (Keynote Presentation), RobertM.Biefeld,SandiaNationalLabs.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8467-06]
To Be Announced (Invited Paper),DianaL.Huffaker,Univ.ofCalifornia,LosAngeles(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8467-07]
AFM-assisted deposition and etching of nanoscale electronic materials on silicon and related materials (Invited Paper),MassoodTabib-Azar,TheUniv.ofUtah(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8467-08]
Core-shell heterostructures for advanced catalysis, diagnostics, and energy conversion (Invited Paper),IvanoAlessandri,Univ.degliStudidiBrescia(Italy) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8467-09]
Lunch/Exhibition Break.............................. 12:20to1:40pm
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 1:40 to 3:10 pm
Low-Dimensional Devices ISession Chair: Silvija Gradecak, MassachusettsInstituteofTechnology
(UnitedStates)
Comparison of radial junction fabrication methods for Si micro/nanowire array solar cells (Invited Paper),JoanM.Redwing,ThePennsylvaniaStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8467-10]
MOCVD growth of GaN nanopyramid and nanopillar LED with emission in green to orange color (Invited Paper),Hao-ChungKuo,NationalChiaoTungUniv.(Taiwan) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8467-11]
III-V compound semiconductor nanowires for optoelectronic device applications (Invited Paper),ChennupatiJagadish,TheAustralianNationalUniv.(Australia). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8467-12]
Indium phosphide nanowire network’s growth and characterization for thermoelectric conversion,KateJ.Norris,JunceZhang,TimothyJ.Longson,DavidFryauf,AndrewJ.Lohn,NobuhikoP.Kobayashi,Univ.ofCalifornia,SantaCruz(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8467-13]
spie.org/opadvance · TEL:+13606763290 · help@spie.org 67
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 3:40 to 5:00 pm
Atomic Layer DepositionSession Chair: Albert V. Davydov, NationalInstituteofStandardsand
Technology(UnitedStates)
Novel optical properties of Ag films deposited by plasma-enhanced atomic layer deposition (Invited Paper),SharkaM.Prokes,U.S.NavalResearchLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8467-14]
To Be Announced (Invited Paper),JillBecker,CambridgeNanoTechInc.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8467-15]
Plasma-enhanced atomic layer deposition of silver thin films for applications in plasmonics and surface-enhanced Raman scattering,ErinCleveland,U.S.NavalResearchLab.(UnitedStates)andAmericanSocietyforEngineeringEducation(UnitedStates);JoshuaD.Caldwell,EdwardE.Foos,U.S.NavalResearchLab.(UnitedStates);JaakkoNiinisto,MikkoRitala,Univ.ofHelsinki(Finland);OrestJ.Glembocki,SharkaM.Prokes,U.S.NavalResearchLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8467-16]
Electrical properties of epitaxial LaAlO 3/SrTiO 3 devices fabricated using atomic tayer deposition,NickM.Sbrockey,EricJ.Gallo,GaryS.Tompa,StructuredMaterialsIndustries,Inc.(UnitedStates);AndrewAkbashev,GuannanChen,JonathanSpanier,DrexelUniv.(UnitedStates). . . . . . . . . . . . . [8467-17]
Thursday 16 AugustSESSION 5 . . . . . . . . . . . . . . . . . . . . . . . . Thurs. 8:00 to 9:55 am
Nanowires IISession Chair: Joan M. Redwing, ThePennsylvaniaStateUniv.
(UnitedStates)
Enhanced field ionization current enabled by gold induced surface states to silicon nanowires,HakanKaraagac,M.SaifIslam,Univ.ofCalifornia,Davis(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8467-18]
Nanoscale effects on heterojunction electron gases in core/shell nanowires (Invited Paper),FrancoisLeonard,SandiaNationalLabs.,California(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8467-19]
Graded nanowire deep ultraviolet LEDs without impurity doping by polarization engineering (Invited Paper),RobertoC.Myers,TheOhioStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8467-20]
Ordered array of III-V nanowire growth by MOCVD and applications in nanoelectronics (Invited Paper),XiulingLi,Univ.ofIllinoisatUrbana-Champaign(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8467-21]
Thermal stability of gallium nitride: nanowires versus films (Invited Paper),AlbertV.Davydov,NationalInstituteofStandardsandTechnology(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8467-22]
SESSION 6 . . . . . . . . . . . . . . . . . . . Thurs. 10:30 am to 12:20 pm
Low-Dimensional Materials IISession Chair: M. Saif Islam, Univ.ofCalifornia,Davis(UnitedStates)
Towards nanoscale control of semiconductor nanostructure architectures using focused ion beam templating(Keynote Presentation),RobertHull,RensselaerPolytechnicInstitute(UnitedStates) . . . . . . . . . . . . . . . . . [8467-23]
Engineering nanostructures in active regions for high-efficiency III-nitride light-emitting diodes: epitaxy and physics (Invited Paper),NelsonTansu,LehighUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8467-24]
Growth structure and work function of monolayer and bilayer graphene on Pd(111) (Invited Paper),SuneelKodambaka,YuyaMurata,HoiSingMok,Univ.ofCalifornia,LosAngeles(UnitedStates);ShuNie,SandiaNationalLabs.,California(UnitedStates);AbbasEbnonnasir,ColoradoSchoolofMines(UnitedStates);NormanC.Bartelt,KevinF.McCarty,SandiaNationalLabs.,California(UnitedStates);CristianV.Ciobanu,ColoradoSchoolofMines(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8467-25]
VLSI-ready strategy for heterogeneous integration of epitaxial nanostructures (Invited Paper),ChiOnChui,Univ.ofCalifornia,LosAngeles(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8467-26]
Lunch/Exhibition Break.............................. 12:20to1:40pm
SESSION 7 . . . . . . . . . . . . . . . . . . . . . . . . Thurs. 1:40 to 2:45 pm
Nano CharacterizationSession Chair: Sharka M. Prokes, U.S.NavalResearchLab.(United
States)
Imaging carrier transport in nanowires using integrated SEM/NSOM (Invited Paper),NancyM.Haegel,NavalPostgraduateSchool(UnitedStates) [8467-27]
In-situ TEM observations of electrochemical reactions of individual nanowire or nanoparticle electrodes in lithium ion batteries (Invited Paper),JianyuHuang,SandiaNationalLabs.(UnitedStates). . . . . . . . . . . . . . [8467-28]
Study on indium phosphide nanowires grown by metal organic chemical vapor deposition and coated with aluminum oxides deposited by atomic layer deposition,AndrewJ.Lohn,Univ.ofCalifornia,SantaCruz(UnitedStates);NoelM.Dawson,TheUniv.ofNewMexico(UnitedStates);RobertD.Cormia,FoothillCollege(UnitedStates);KateJ.Norris,NobuhikoP.Kobayashi,Univ.ofCalifornia,SantaCruz(UnitedStates). . . . . . . . . . . . . . . . . . . [8467-29]
SESSION 8 . . . . . . . . . . . . . . . . . . . . . . . . Thurs. 3:15 to 4:55 pm
Low-Dimensional Devices IISession Chair: Nobuhiko P. Kobayashi, Univ.ofCalifornia,SantaCruz
(UnitedStates)
New epitaxial metallic nanostructure materials for photonic devices (Invited Paper),SethR.Bank,TheUniv.ofTexasatAustin(UnitedStates). . . [8467-30]
Characterization of AlGaN/AlN/GaN high-electron mobility transistor structure with a nano-scale AlN interlayer,Shih-ChunHuang,Wen-RayChen,NationalFormosaUniv.(Taiwan);Yu-TingHsu,NationalChiaoTungUniv.(Taiwan);Jia-ChingLin,Kuo-JenChang,Wen-JenLin,Chung-ShanInstituteofScienceandTechnology(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8467-31]
Fully functional Li-ion nanobatteries,A.AlecTalin,DmitryRuzmetov,VladimirOleshko,HenriLezec,PaulM.Haney,NationalInstituteofStandardsandTechnology(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8467-32]
3D silicon micro-pillars/-walls decorated with aluminum-ZnO/ZnO nanowires for opto-electronic device applications,HakanKaraagac,LogeeswaranVeerayahJayaraman,M.SaifIslam,Univ.ofCalifornia,Davis(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8467-33]
Contact metal effects in indium phosphide nanowire transistors,Jin-WooHan,NASAAmesResearchCtr.(UnitedStates);AndrewJ.Lohn,Univ.ofCalifornia,SantaCruz(UnitedStates);MeyyaMeyyappan,NASAAmesResearchCtr.(UnitedStates);NobuhikoP.Kobayashi,Univ.ofCalifornia,SantaCruz(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8467-34]
Investigation of indium-tin oxide based nonvolatile memory,NitishPadgaonkar,MichaelM.Oye,NobuhikoP.Kobayashi,Univ.ofCalifornia,SantaCruz(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8467-35]
Conference 8467
68 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Watch for this icon next to conferences and courses discussing innovative ways to help our planet.
GREEN PHOTONICS
SPIE Optics + Photonics is a leading conference on green photonics technologies such as energy, sustainability, conservation, and environmental monitoring.
Symposium Chair
Martha Symko-Davies,NationalRenewableEnergyLab.(USA)
Technical Organizing CommitteeNeelkanth G. Dhere, Univ.ofCentralFlorida(USA)Louay A. Eldada, Amprius,Inc.(USA)Jeffrey M. Gordon, Ben-GurionUniv.oftheNegev(Israel)Zakya H. Kafafi, NationalScienceFoundation(USA)Adam P. Plesniak, AmonixInc.(USA)Edward W. Reutzel, AppliedResearchLab.,ThePennsylvaniaStateUniv.
(USA)Loucas Tsakalakos, GEGlobalResearch(USA)Kaitlyn VanSant,NationalRenewableEnergyLab.(USA)Lionel Vayssieres, Xi’anJiaotongUniv.(China)Roland Winston, Univ.ofCalifornia,Merced(USA)
Solar Energy+TechnologySPIEOptics+Photonics
8468 High and Low Concentrator Systems for Solar Electric Applications VII(VanSant/Plesniak) . . . . . . .69
8469 Solar Hydrogen and Nanotechnology VII(Vayssieres). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 71
8470 Thin Film Solar Technology IV(Eldada) . . . . . . . . . . . 73
8471 Next Generation (Nano) Photonic and Cell Technologies for Solar Energy Conversion III(Tsakalakos) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 75
8472 Reliability of Photovoltaic Cells, Modules, Components, and Systems V(Dhere). . . . . . . . . . . . .77
NEW 8473 Laser Material Processing for Solar Energy Devices
(Reutzel) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .80
8477 Organic Photovoltaics XIII (Kafafi) . . . . . . . . . . . . . . .92
8485 Nonimaging Optics: Efficient Design for Illumination and Solar Concentration IX(Winston/Gordon) . . . .111
Aconferencefocusedonthedevelopmentofnewsolar-basedenergysources,technologies,andsystems.ConcentratingPhotovoltaics(CPV)andConcentratingSolarPower(CSP)aretwoareasofsolarenergyresearchanddevelopment(R&D)thatarerapidlyevolvingandattractingahighlevelofinterestandinnovation.
- Thin Films- Concentrators- Reliability- Cell Technologies- Solar Hydrogen- Materials Processing- Nonimaging Optics- OPVs
spie.org/opadvance · TEL:+13606763290 · help@spie.org 69
Conference 8468Monday-Wednesday 13-15 August 2012 • Proceedings of SPIE Vol. 8468
High and Low Concentrator Systems for Solar Electric Applications VIIConference Chairs:Kaitlyn VanSant, NationalRenewableEnergyLab.(UnitedStates);Adam P. Plesniak, AmonixInc.(UnitedStates)
Program Committee:Lori E. Greene, Univ.ofCalifornia,Irvine(UnitedStates);Raed A. Sherif, Ra3SolarConsulting(UnitedStates);Daniel J. Friedman, NationalRenewableEnergyLab.(UnitedStates);Kanchan Ghosal, Semprius,Inc.(UnitedStates);Raymond Kostuk, TheUniv.ofArizona(UnitedStates)
Monday 13 AugustSolar Energy Plenary Session . . . . . . . . Mon. 1:30 to 5:00 pm
SessionChair: Martha Symko-Davies,NationalRenewableEnergyLab.(USA)
1:30pm:Understanding the Generation of Charge Carriers in Organic Photovoltaic Devices, GarryRumbles,NationalRenewableEnergyLab.(USA)andUniv.ofColoradoatBoulder(USA)
2:00pm:Light Management in Single-Junction III-V Solar Cells, BrendanM.Kayes,AltaDevices,Inc.(USA)
2:30pm:Carbon Nanotubes for Photovoltaics, MichaelJ.Heben,TheUniv.ofToledo(USA)
CoffeeBreak. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3:00to3:30pm
3:30pm:Advanced Solar Cell Technologies for Concentrating Photovoltaics Systems, VijitSabnis,SolarJunction(USA)
4:00pm:High-Rate Processing and Advanced Emitter Structures for CIGS PV Module Manufacturing,BillyJ.Stanbery,HelioVoltCorp.(USA)
4:30pm:On the Way to Accelerated Life Testing, MichaelKöhl,Fraunhofer-InstitutfürSolareEnergiesysteme(Germany)
Posters-Monday . . . . . . . . . . . . . . . . . . . . Mon. 5:30 to 7:30 pmConference attendees are invited to attend the poster session on Monday
evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
A concentrator photovoltaic system based on branched planar waveguides,KazumaArizono,YuutoOkuda,IchiroFujieda,RitsumeikanUniv.(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8468-19]
The enhanced electricity by textured water film cover on solar module system,Cheng-YuPeng,Fu-MingLin,Ray-ChienLai,Fang-YaoYeh,IndustrialTechnologyResearchInstitute(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . [8468-20]
Low-cost characterization of multijunction photovoltaic cells,ThomasE.Stalcup,Jr.,TheUniv.ofArizona(UnitedStates)andRehnu,Inc.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8468-21]
Tuesday 14 AugustPanel Discussion . . . . . . . . . . . . . Tues. 10:30 am to 12:00 pm
Commercialization of Emerging Photovoltaic Technologies
Moderator:Loucas Tsakalakos,GEGlobalResearch(USA)
Panelists:
Vahan Garboushian, AmonixInc.(USA)
Garry Rumbles, NationalRenewableEnergyLab.(USA)andUniv.ofColoradoatBoulder(USA)
Brendan M. Kayes, AltaDevices,Inc.(USA)
Billy J. Stanbery,HelioVoltCorp.(USA)
SESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 1:30 to 3:20 pm
Low- to Mid-Concentration SystemsSession Chair: Adam P. Plesniak, AmonixInc.(UnitedStates)
Mirror designs and receiver glass coatings for enhanced peak power and energy harvest of a Medium Concentration PV system (MCPV) (Invited Paper),HaroldD.Ackler,MarcFinot,BrianIgnaut,TamirLance,SkylineSolar,Inc.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8468-01]
Comparison of three different CPC geometries for a low-cost, low-concentration PV module (Invited Paper),KaraShell,DavidHollingshead,MarkSchuetz,GregReinbolt,ReplexPlastics(UnitedStates);RobertDavis,TheOhioStateUniv.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8468-02]
Comparison of collection and land use efficiency for various solar concentrating field geometries,KyleStephens,CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates);RogerP.Angel,TheUniv.ofArizona(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8468-03]
Site-specific approach for selecting ideal geometric concentration ratio to maximize optical efficiency in CPV systems,ShelbyVorndran,JuanRusso,DemingZhang,TheUniv.ofArizona(UnitedStates);MichaelGordon,CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates);RaymondKostuk,TheUniv.ofArizona(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8468-04]
SESSION 2 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 4:00 to 5:40 pm
CPV/ Reliability: Joint Session with Conference 8472Session Chair: Neelkanth G. Dhere, Univ.ofCentralFlorida(United
States)
Degradation of back surface acrylic mirrors for low concentration and mirror augmented photovoltaics,MylesP.Murray,LauraS.Bruckman,SamuelRichardson,CaseWesternReserveUniv.(UnitedStates);ScottA.Brown,GregReinbolt,MarkSchuetz,ReplexPlastics(UnitedStates);RogerH.French,CaseWesternReserveUniv.(UnitedStates). . . . . . . . . . . . . . [8472-04]
Designing reliability into a 1000X concentration CPV system through targeted stress testing (Invited Paper),MichaelWinter,IanAeby,JamesS.Foresi,EMCORECorp.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . [8468-05]
The BOS-X approach: achieving drastic cost reduction in CPV through holistic power plant level innovation (Invited Paper),AdamP.Plesniak,VahanGarboushian,AmonixInc.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . [8468-06]
Evolution and field performance of Soitec’s Concentrix CPV systems,AndreasGombert,SoitecSolar(Germany);ClarkCrawford,SoitecSolar(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8472-05]
Wednesday 15 AugustSESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . .Wed. 9:00 to 10:15 am
Holographic Solar ConcentratorsSession Chair: Lori E. Greene, Univ.ofCalifornia,Irvine(UnitedStates)
Comparative study of acceptance angle of a holographic and a conventional concentrators,RajeevRanjan,NationalInstituteofTechnology,Jamshedpur(India);A.Khan,KarimCityCollege(India);AbhijitGhosh,BirlaInstituteofTechnology(India);NirmalenduDeo,NextGenerationTechnology,Inc.(UnitedStates);N.R.Chakraborty,KolhanUniv.(India);HiralalYadav,NationalInstituteofTechnology,Jamshedpur(India). . . . . . . . . . . . . . [8468-07]
Reflection hologram solar spectrum-splitting filters,DemingZhang,ShelbyVorndran,TheUniv.ofArizona(UnitedStates);MichaelGordon,CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates);JuanRusso,RaymondKostuk,TheUniv.ofArizona(UnitedStates) . . . . . . . . . . . . . . . . . . . . [8468-08]
70 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Planar holographic spectrum-splitting PV module design,MichaelGordon,CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates);ShelbyVorndran,DemingZhang,JuanRusso,RaymondKostuk,TheUniv.ofArizona(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8468-09]
SESSION 4 . . . . . . . . . . . . . . . . . . . . Wed. 10:45 am to 12:00 pm
Luminescent Solar ConcentratorsSession Chair: Raymond Kostuk, TheUniv.ofArizona(UnitedStates)
Performance enhancement of LSC materials through nonradiative energy transfer in blended dye films,BenjaminBalaban,SageDoshay,CarleyCorrado,SueCarter,Univ.ofCalifornia,SantaCruz(UnitedStates). . [8468-10]
Wavelength selective solar concentrators for sustainable electricity generation in coexistence with agriculture and natural ecosystems,SueCarter,GlennB.Alers,CarleyCorrado,ShinWoeiLeow,MelissaOsborn,IanCarbone,DerekPadilla,MichaelLoik,Univ.ofCalifornia,SantaCruz(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8468-11]
Photocurrent enhancement in plasmonic solar cells attached to luminescent solar concentrators,RenzeWang,XingjunWang,ZhipingZhou,PekingUniv.(China) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8468-12]
Lunch/Exhibition Break.............................. 12:00to1:40pm
SESSION 5 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 1:40 to 3:00 pm
High-Concentration Systems ISession Chair: Raed A. Sherif, Ra3SolarConsulting(UnitedStates)
1000x shadow-free mirror-based Köhler concentrator (Invited Paper),MaikelHernández,LightPrescriptionsInnovatorsEurope,S.L.(Spain);PabloBenítez,LightPrescriptionsInnovators,LLC(UnitedStates)andUniv.PolitécnicadeMadrid(Spain);JoãoMendes-Lopes,Univ.PolitécnicadeMadrid(Spain);AleksandraCvetkovic,LightPrescriptionsInnovatorsEurope,S.L.(Spain);YupinSun,JuanCarlosMiñano,LightPrescriptionsInnovators,LLC(UnitedStates);JúlioChaves,RubénMohedano,LightPrescriptionsInnovatorsEurope,S.L.(Spain). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8468-13]
Photovoltaic performance of the dome-shaped Fresnel-Köhler concentrator,PabloZamora,PabloBenítez,Univ.PolitécnicadeMadrid(Spain);LiYang,ZhejiangUniv.(China);JuanCarlosMiñano,Univ.PolitécnicadeMadrid(Spain);KenjiAraki,DaidoSteelCo.,Ltd.(Japan). . . . . . . . [8468-14]
Illumination efficiency comparison of glass and metal secondary optical concentrator elements in a high-concentration PV system,BlakeCoughenour,BrianWheelwright,CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates);RogerP.Angel,TheUniv.ofArizona(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8468-15]
SESSION 6 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 3:30 to 4:55 pm
High-Concentration Systems IISession Chair: Kaitlyn VanSant, NationalRenewableEnergyLab.
(UnitedStates)
Dish-based HCPV system initial on-sun performance (Invited Paper),ThomasE.Stalcup,Jr.,TheUniv.ofArizona(UnitedStates)andRehnu,Inc.(UnitedStates);RogerP.Angel,TheUniv.ofArizona(UnitedStates);BlakeCoughenour,BrianWheelwright,CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates);TomConnors,WarrenDavison,BlainOlbert,DavidLesser,TheUniv.ofArizona(UnitedStates);BrianE.Quinn,JustinElliott,REhnu,Inc.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8468-16]
Performance of silicone-on-glass Fresnel lenses in EMCORE’s Gen 3 high-concentration concentrator photovoltaic system (Invited Paper),JamesS.Foresi,RickHoffman,DavidKing,DavidCorelis,EMCORECorp.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8468-17]
New dish CPV dense array design that overcomes the requirement for flux uniformity,HerbHayden,SouthwestSolarTechnologies,Inc.(UnitedStates);MemoRomero,MaxQTechnology,LLC(UnitedStates). . . . . . . . . . . [8468-18]
Conference 8468
spie.org/opadvance · TEL:+13606763290 · help@spie.org 71
Conference 8469Monday-Thursday 13-16 August 2012 • Proceedings of SPIE Vol. 8469
Solar Hydrogen and Nanotechnology VIIConference Chair:Lionel Vayssieres, Xi’anJiaotongUniv.(China)
Program Committee:Hironori Arakawa, TokyoUniv.ofScience(Japan);Jan Augustynski, Univ.ofWarsaw(Poland);Michael Grätzel, EcolePolytechniqueFédéraledeLausanne(Switzerland);Jinghua Guo, LawrenceBerkeleyNationalLab.(UnitedStates);Hicham Idriss, Univ.ofAberdeen(UnitedKingdom)andSABIC(UnitedKingdom);Claude Levy-Clement, Ctr.NationaldelaRechercheScientifique(France);Frank E. Osterloh, Univ.ofCalifornia,Davis(UnitedStates);Yasuhiro Tachibana, RMITUniv.(Australia);John A. Turner, NationalRenewableEnergyLab.(UnitedStates);Heli Wang, NationalRenewableEnergyLab.(UnitedStates);Gunnar Westin, UppsalaUniv.(Sweden);Upul Wijayantha, LoughboroughUniv.(UnitedKingdom);Jin Zhang, Univ.ofCalifornia,SantaCruz(UnitedStates)
Monday 13 AugustSolar Energy Plenary Session . . . . . . . . Mon. 1:30 to 5:00 pm
SessionChair: Martha Symko-Davies,NationalRenewableEnergyLab.(USA)
1:30pm:Understanding the Generation of Charge Carriers in Organic Photovoltaic Devices, GarryRumbles,NationalRenewableEnergyLab.(USA)andUniv.ofColoradoatBoulder(USA)
2:00pm:Light Management in Single-Junction III-V Solar Cells, BrendanM.Kayes,AltaDevices,Inc.(USA)
2:30pm:Carbon Nanotubes for Photovoltaics, MichaelJ.Heben,TheUniv.ofToledo(USA)
CoffeeBreak . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3:00to3:30pm
3:30pm:Advanced Solar Cell Technologies for Concentrating Photovoltaics Systems, VijitSabnis,SolarJunction(USA)
4:00pm:High-Rate Processing and Advanced Emitter Structures for CIGS PV Module Manufacturing,BillyJ.Stanbery,HelioVoltCorp.(USA)
4:30pm:On the Way to Accelerated Life Testing, MichaelKöhl,Fraunhofer-InstitutfürSolareEnergiesysteme(Germany)
Posters-Monday . . . . . . . . . . . . . . . . . . . . Mon. 5:30 to 7:30 pmConference attendees are invited to attend the poster session on Monday
evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
Three dimensional ZnO/CdS heterojunction film electrode for efficient photoelectrochemical water splitting,JiangangJiang,LiejinGuo,Xi’anJiaotongUniv.(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8469-33]
Improved hydrogen production ability of Rhodobacter capsulatus under ammonium rich condition,ChaoMa,Xi’anJiaotongUniv.(China);HonghuiYang,NorthwesternPolytechnicalUniv.(China);LiejinGuo,Xi’anJiaotongUniv.(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8469-34]
Study on the charge separation mechanism of ZnS/Cd 1-xZnxS photocatalyst,KaiZhang,LiejinGuo,Xi’anJiaotongUniv.(China) . . [8469-35]
Photoelectrochemical water splitting using cupper gallium chalcogenides,TsutomuMinegishi,JaehongKim,MakotoMoriya,JunKubota,KazunariDomen,TheUniv.ofTokyo(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8469-36]
Characterization of nanostructured GaN as a photoanode for solar water splitting,SooheeKim,So-YoungYu,Sang-WanRyu,ChonnamNationalUniv.(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8469-37]
Investigation of Ag xCu 1-xGaSe 2 films for photoelectrochemical water splitting,LiZhang,TsutomuMinegishi,JunKubota,KazunariDomen,TheUniv.ofTokyo(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8469-38]
Low-temperature hollow cathode plasma-jets deposition of porous hematite thin films for photoelectrochemical oxidation of water,StepanKment,Palack?Univ.Olomouc(CzechRepublic);ZdenekHubicka,JiriOlejnicek,InstituteofPhysicsoftheASCR,v.v.i.(CzechRepublic);NataleJ.Ianno,RodneyJ.Soukup,Univ.ofNebraska-Lincoln(UnitedStates);LubomirJastrabik,InstituteofPhysicsoftheASCR,v.v.i.(CzechRepublic);MiroslavHrabovsky,Palack?Univ.Olomouc(CzechRepublic). . . . . . . . . . . . . [8469-39]
Tuesday 14 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . Tues. 8:30 to 10:00 am
Solar Hydrogen and NanotechnologySession Chair: Lionel Vayssieres, Xi’anJiaotongUniv.(China)
Assessment of research and development needs in solar to hydrogen production technologies (Keynote Presentation),EricL.Miller,SaraDillich,SarahStuder,U.S.Dept.ofEnergy(UnitedStates). . . . . . . . . . . . . . . [8469-01]
Quantum mechanical design and evaluation of new solar energy conversion materials (Keynote Presentation),EmilyA.Carter,PrincetonUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8469-02]
SESSION 2 . . . . . . . . . . . . . . . . . . . . Tues. 10:30 am to 12:10 pm
Advances in Iron Oxide-based Nanophotocatalysts for Solar Hydrogen Generation I
Session Chair: Sanjay Mathur, Univ.zuKöln(Germany)
Solving challenges of hematite-based solar water splitting (Invited Paper),DunweiWang,BostonCollege(UnitedStates). . . . . . . . . . . . . . . . . . . [8469-03]
A facile solvothermal method for fabricating vertically-oriented α-Fe 2O
3 nanowire arrays and their application in photoelectrochemical water oxidation (Invited Paper),CraigA.Grimes,NingzhongBao,NanjingUniv.ofTechnology(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8469-04]
Interfacial electronic structure in oxide photoelectrodes investigated by soft x-ray spectroscopy,ColemanKronawitter,LawrenceBerkeleyNationalLab.(UnitedStates);LionelVayssieres,Xi’anJiaotongUniv.(China);SamuelMao,LawrenceBerkeleyNationalLab.(UnitedStates). . . . . . . . . . . . [8469-05]
Lunch/Exhibition Break.............................. 12:10to1:30pm
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 1:30 to 3:30 pm
Advances in Iron Oxide-based Nanophotocatalysts for Solar Hydrogen Generation II
Session Chair: Craig A. Grimes, ThePennsylvaniaStateUniv.(UnitedStates)
Room temperature water splitting at the surface of magnetite (Invited Paper),GarethS.Parkinson,ZbynekNovotny,PeterJacobson,MichaelSchmid,UlrikeDiebold,TechnischeUniv.Wien(Austria);ThomasManz,DavidSholl,GeorgiaInstituteofTechnology(UnitedStates). . . . . . . . . . . . . . . . . . [8469-06]
Effect of dopant profile on charge separation in α-Fe 2O 3 for water splitting,ChristopherBohn,PaulM.Haney,A.AlecTalin,VeronikaA.Szalai,NationalInstituteofStandardsandTechnology(UnitedStates) . . . . . . . . . . . . [8469-07]
Mechanism of water photo-oxidation in nanostructured hematite photoanodes: a transient absorption study (Invited Paper),MonicaBarrosoSilvadaCruz,StephanieR.Pendlebury,AlexanderJ.Cowan,DavidR.Klug,JamesR.Durrant,ImperialCollegeLondon(UnitedKingdom) . . . . . . [8469-08]
Aqueous chemical growth of Ti-doped hematite nanorods for photoelectrochemical water splitting,ShaohuaShen,Xi’anJiaotongUniv.(China)andUniv.ofCalifornia,Berkeley(UnitedStates);ColemanKronawitter,Univ.ofCalifornia,Berkeley(UnitedStates);SamuelMao,LawrenceBerkeleyNationalLab.(UnitedStates)................................. [8469-09]
72 spie.org/opadvance · TEL:+13606763290 · help@spie.org
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 4:00 to 5:20 pm
Advances in Iron Oxide-based Nanophotocatalysts for Solar Hydrogen Generation III
Session Chair: Dunwei Wang, BostonCollege(UnitedStates)
Functional nanoparticles and nanowires: from materials engineering to application (Invited Paper),SanjayMathur,Univ.zuKöln(Germany). [8469-10]
All-oxide hetero-nanostructures for direct solar water splitting (Invited Paper),LionelVayssieres,Xi’anJiaotongUniv.(China) . . . . . . . . . . . . [8469-11]
Wednesday 15 AugustSESSION 5 . . . . . . . . . . . . . . . . . . . . . . . . .Wed. 8:45 to 10:05 am
Spectroscopy and Electronic Structure of Nanophotocatalysts for Solar Hydrogen Generation ISession Chair: Lionel Vayssieres, Xi’anJiaotongUniv.(China)
What electronic structure should a PEC device have (and can we measure it)? (Invited Paper),ClemensHeske,Univ.ofNevada,LasVegas(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8469-12]
Electronic structure of wide-band-gap semiconductors as evidenced by first-principles calculations and simulated x-ray absorption spectroscopy (Invited Paper),DavidPrendergast,LawrenceBerkeleyNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8469-13]
SESSION 6 . . . . . . . . . . . . . . . . . . . . Wed. 10:30 am to 12:10 pm
Spectroscopy and Electronic Structure of Nanophotocatalysts for Solar Hydrogen Generation II
Session Chair: Clemens Heske, Univ.ofNevada,LasVegas(UnitedStates)
In-situ soft x-ray spectroscopy study of artificial nanocatalysts in photoelectrochemical reactions (Invited Paper),Jeng-LungChen,Wei-ChengWang,TamkangUniv.(Taiwan);Per-AndersGlans,LawrenceBerkeleyNationalLab.(UnitedStates);ChinglinChang,TamkangUniv.(Taiwan);LionelVayssieres,Xi’anJiaotongUniv.(China);JinghuaGuo,LawrenceBerkeleyNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8469-14]
A simple technique for minority carrier diffusion length measurement of tungsten oxide (Invited Paper),RagipPala,AndrewJ.Leenheer,NathanS.Lewis,HarryAtwater,Jr.,CaliforniaInstituteofTechnology(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8469-15]
Using surface photovoltage spectroscopy to study the charge separation properties of CdSe quantum dots and niobium oxide nanocrystals for photocatalytic solar energy conversion and hydrogen generation,JingZhao,MichaelA.Holmes,MollieR.Waller,FrankE.Osterloh,Univ.ofCalifornia,Davis(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8469-16]
Lunch/Exhibition Break.............................. 12:10to1:30pm
SESSION 7 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 1:30 to 3:30 pm
Novel Synthesis, Materials and Device Fabrication ISession Chair: Heli Wang, NationalRenewableEnergyLab.(United
States)
Facile synthetic routes of various metal-oxide nano-building blocks for application in photocatalysts (Invited Paper),Il-DooKim,KAIST(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8469-17]
Measurement of photoelectrochemical properties of metal-oxide-semiconductor photoelectrodes with high spatial resolution,DanielV.Esposito,A.AlecTalin,ThomasP.Moffat,NationalInstituteofStandardsandTechnology(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8469-18]
Complex oxide, metal, and composite materials synthesis (Invited Paper),GunnarWestin,UppsalaUniv.(Sweden) . . . . . . . . . . . . . . . . . . . . . . . [8469-19]
Metal-free photocatalytic graphitic C 3N 4 on p-type chalcopyrite as new thin film composite photocathodes for hydrogen evolution under visible light illumination,ThomasJ.Schedel-Niedrig,FlorentYang,MichaelLublow,ChristophMerschjann,StevenOrthmann,VadymKuznietsov,TobiasTyborski,JoKlaer,AlexanderGrimm,TheHelmholtzZentrumBerlin(Germany);ArneThomas,TechnischeUniv.Berlin(Germany);MarkusAntonietti,Max-Planck-InstitutfürKolloid-undGrenzflächenforschung(Germany). . . . . . . . . [8469-20]
SESSION 8 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 4:00 to 5:40 pm
Novel Synthesis, Materials and Device Fabrication IISession Chair: Gunnar Westin, UppsalaUniv.(Sweden)
Protecting p-GaInP 2 from corrosion for durable photoelectrochemical water splitting (Invited Paper),HeliWang,NationalRenewableEnergyLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8469-21]
Ionic conducting thin films and multilayers for energy applications (Invited Paper),EnricoTraversa,Xi’anJiaotongUniv.(China). . . . . . . . . . . . . . [8469-22]
Syngas production by thermochemical conversion of H 2O and CO 2 mixtures using a high-temperature heat pipe based reactor,HowardPearlman,Chien-HuaChen,AdvancedCoolingTechnologies,Inc.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8469-23]
Thursday 16 AugustSESSION 9 . . . . . . . . . . . . . . . . . . . . . . . Thurs. 9:00 to 10:00 am
Novel TiO2-based Nanophotocatalysts for Solar Hydrogen Generation I
Session Chair: Yasuhiro Tachibana, RMITUniv.(Australia)
Ultrafast charge carrier dynamics of metal oxide-based nanostructures for PEC water splitting (Invited Paper),JinZhang,Univ.ofCalifornia,SantaCruz(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8469-24]
Chemically-induced electric field for light-induced charge separation: example of titanium dioxide,ZaipingGuo,Univ.ofWollongong(Australia);ArmandAtanacio,AustralianNuclearScienceandTechnologyOrganisation(Australia);TadeuszBak,JanuszNowotny,Univ.ofWesternSydney(Australia). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8469-25]
SESSION 10 . . . . . . . . . . . . . . . . . . Thurs. 10:30 am to 12:10 pm
Novel TiO2-based Nanophotocatalysts for Solar Hydrogen Generation II
Session Chair: Jin Zhang, Univ.ofCalifornia,SantaCruz(UnitedStates)
Controlling photo-induced charge transfer reactions at semiconductor quantum dot interfaces (Invited Paper),YasuhiroTachibana,RMITUniv.(Australia). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8469-26]
1D and 3D oxide nanostructures for photoelectrochemical anodes (Invited Paper),HongjinFan,NanyangTechnologicalUniv.(Singapore). . . . . . [8469-27]
1D metal oxide nanowire array synthesis and photoelectrochemical application,JinzhanSu,LiejinGuo,Xi’anJiaotongUniv.(China). . . . [8469-28]
Lunch/Exhibition Break.............................. 12:10to1:30pm
SESSION 11 . . . . . . . . . . . . . . . . . . . . . . . Thurs. 1:30 to 3:10 pm
Novel TiO2-based Nanophotocatalysts for Solar Hydrogen Generation III
Session Chair: Lionel Vayssieres, Xi’anJiaotongUniv.(China)
Branched TiO 2 nanorods for photoelectrochemical hydrogen production (Invited Paper),InSunCho,ZheboChen,ArnoldJ.Forman,DongRipKim,PratapM.Rao,ThomasF.Jaramillo,XiaolinZheng,StanfordUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8469-29]
Plasmonic enhancement of photocatalytic reactions,WenboHou,ZuweiLiu,PrathameshPavaskar,StephenB.Cronin,TheUniv.ofSouthernCalifornia(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8469-30]
Novel hierarchical TiO 2 nanostructures for photoelectrochemical water splitting,FabioDiFonzo,IstitutoItalianodiTecnologia(Italy);ChuanweiCheng,TongjiUniv.(China);JingshanLuo,NanyangTechnologicalUniv.(Singapore);MehrdadBalandeh,IstitutoItalianodiTecnologia(Italy);HongjinFan,NanyangTechnologicalUniv.(Singapore). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8469-31]
Study on optoelectronic properties of (sulfur, transition metal) co-doped TiO 2 using first principle calculation,SherminArab,Univ.ofSouthernCalifornia(UnitedStates);RogerK.Lake,Univ.ofCalifornia,Riverside(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8469-32]
Conference 8469
spie.org/opadvance · TEL:+13606763290 · help@spie.org 73
Conference 8470Sunday-Tuesday 12-13 August 2012 • Proceedings of SPIE Vol. 8470
Thin Film Solar Technology IVConference Chair:Louay A. Eldada, Amprius,Inc.(UnitedStates)
Program Committee:Bulent Basol, EncoreSolar,Inc.(UnitedStates);Howard M. Branz, NationalRenewableEnergyLab.(UnitedStates);Paola Delli Veneri, ENEA(Italy);David S. Ginley, NationalRenewableEnergyLab.(UnitedStates);Ivan Gordon, IMEC(Belgium);William N. Shafarman, Univ.ofDelaware(UnitedStates);Ayodhya N. Tiwari, EMPA(Switzerland);Baojie Yan, UnitedSolarOvonic,LLC(UnitedStates)
Sunday 12 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 8:10 to 10:10 am
Nanostructured Thin Film PVSession Chair: Louay A. Eldada, Amprius,Inc.(UnitedStates)
Nanocone-based three dimensional thin film silicon solar cells (Invited Paper),JeehwanKim,AugustinHong,DevendraK.Sadana,IBMThomasJ.WatsonResearchCtr.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . [8470-01]
Plasmonic reflection grating back contacts in thin film silicon solar cells,UlrichW.Paetzold,EtienneMoulin,KarstenBittkau,MatthiasMeier,ReinhardCarius,UweRau,ForschungszentrumJülichGmbH(Germany) . . . . . [8470-02]
One step process to synthesize single crystal semiconductor thin films to fabricate bio-hybrid and bio-mimetic solar PV devices (Invited Paper),PratimBiswas,WooJinAn,VivekShah,WashingtonUniv.inSt.Louis(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8470-03]
Optimization of light trapping in polycrystalline silicon thin film solar cells using nanoparticle surface plasmons,JingRao,SergeyVarlamov,TheUniv.ofNewSouthWales(Australia). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8470-04]
Fabrication of nanostructure TiO 2 DSSC by using evaporation induced self-assembly (EISA) method,NorHabibiS.Musa,Univ.KebangsaanMalaysia(Malaysia). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8470-05]
SESSION 2 . . . . . . . . . . . . . . . . . . . . . Sun. 10:40 am to 12:30 pm
Advances in Thin Film Silicon PVSession Chair: Baojie Yan, UnitedSolarOvonic,LLC(UnitedStates)
Advances in thin film silicon photovoltaic (Invited Paper),SubhenduGuha,JeffreyYang,BaojieYan,UnitedSolarOvonic,LLC(UnitedStates). . [8470-06]
Double-pulsed PECVD to increase grain size in hydrogenated nanocrystalline silicon thin films,JeremyD.Fields,ColoradoSchoolofMines(UnitedStates)andMVSystems,Inc.(UnitedStates);JoshuaB.Gallon,JianHu,EdValentich,MVSystems,Inc.(UnitedStates);P.CraigTaylor,ColoradoSchoolofMines(UnitedStates);ArunMadan,MVSystems,Inc.(UnitedStates)[8470-07]
Experiments with resonant thin film hydrogenated amorphous silicon solar cells,TanzinaKhaleque,RobertMagnusson,TheUniv.ofTexasatArlington(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8470-08]
High-rate deposition of silicon thin film layers using linear plasma sources operated at very high excitation frequencies (80-140 MHz),BarbaraLeszczynska,CarstenStrobel,SebastianLeszczynski,MatthiasAlbert,JohannW.Bartha,TechnischeUniv.Dresden(Germany);UlfStephan,JurgenKuske,Forschungs-undApplikationslaborPlasmatechnikGmbH(Germany). [8470-09]
Blue response enhancement of evaporated polycrystalline silicon thin film solar cells on glass by optimizing inverted p +n -n + structure,ChaoweiXue,TheUniv.ofNewSouthWales(Australia);OliverKunz,SuntechR&DAustraliaPtyLtd.(Australia);SergeyVarlamov,TheUniv.ofNewSouthWales(Australia). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8470-10]
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:30to1:40pm
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 1:40 to 3:00 pm
Advances in c-Si PVSession Chair: Pratim Biswas, WashingtonUniv.inSt.Louis(United
States)
Silicon epitaxy below 200°C: toward thin crystalline solar cells,RomainCariou,EcolePolytechnique(France)andIII-VLab.(France);PereRocaCabarrocas,EcolePolytechnique(France);RosaRuggeri,Univ.degliStudidiMessina(Italy). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8470-11]
Hybrid PV Systems for rural electrification, mine exploration, irrigation, and desalination,LouayA.Eldada,Amprius,Inc.(UnitedStates). . . . . . [8470-12]
Back Enhanced Heterostructure with INterDigitated (BEHIND) contact solar cell on thin c-Si wafer,MarioTucci,LucaSerenelli,MassimoIzzi,EnricoSalza,ENEA(Italy);DomenicoCaputo,GiampierodeCesare,Univ.degliStudidiRomaLaSapienza(Italy). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8470-13]
Best practice quality control in solar module back sheet production,JohnJordon,DUNMORECorp.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . [8470-14]
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 3:30 to 5:10 pm
Novel PV Materials and Characterization MethodsSession Chair: Jeehwan Kim, IBMThomasJ.WatsonResearchCtr.
(UnitedStates)
Growth of high-quality SnS thin films on graphene buffer layer,WeiWang,KaKuenLeung,CharlesC.Surya,TheHongKongPolytechnicUniv.(HongKong,China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8470-15]
Characterization and quality control of semiconductor wafers using time-correlated single photon counting,VolkerBuschmann,PicoQuantGmbH(Germany);SamanthaFore,PicoQuantPhotonicsNorthAmerica,Inc.(UnitedStates);FelixKoberling,PicoQuantGmbH(Germany);AndreaKnigge,Ferdinand-Braun-Institut(Germany);PeterKapusta,UweOrtmann,PicoQuantGmbH(Germany);MaurizioRoczen,Helmholtz-InstitutfürMaterialienundEnergie(Germany);RainerErdmann,PicoQuantGmbH(Germany). . . [8470-16]
Variable temperature hall measurements on low-mobility materials, high-resistivity materials,JeffreyR.Lindemuth,LakeShoreCryotronics,Inc.(UnitedStates);Shin-IchiroMizuta,ToyoCorp.(Japan). . . . . . . . . . . . . . . . . . [8470-17]
Optical and structural properties of silver doped ZnSe thin films prepared by CSS and ion exchange process,AkramK.S.Aqili,TheHashemiteUniv.(Jordan);ZulfiqarAli,LawrenceBerkeleyNationalLab.(UnitedStates)andOpticsLabs.(Pakistan);ZahidHussain,LawrenceBerkeleyNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8470-18]
Properties of the thin-film solar cells with heterojunctions Cu 2S-Cd 1-xZn xS and Cu 2Se-Cd 1-xZn xSe,MaarifJafarov,BakuStateUniv.(Azerbaijan)[8470-19]
Symposium-Wide Plenary Session . . . . . . . . . . . . . . . . . . . . Sun. 6:00 to 7:25 pm6:00pm: Introduction and Opening Remarks
6:05pm: The Exciting Science of Light with Metamaterials, VladimirM.Shalaev,PurdueUniv.(USA)
6:45pm:Future of Optics and Photonics, BahaaE.A.Saleh,CREOL,TheCollegeofOpitcsandPhotonicsattheUniv.ofCentralFlorida(USA)
Monday 13 AugustSESSION 5 . . . . . . . . . . . . . . . . . . . . . . . . .Mon. 8:30 to 10:00 am
CIGS PV Modeling, Fabrication, and CharacterizationSession Chair: Louay A. Eldada, Amprius,Inc.(UnitedStates)
Processing and performance of low weight flexible CIGS cells and modules (Invited Paper),MustafaPinarbasi,SoloPower,Inc.(UnitedStates). . . [8470-20]
Photoreflectance analysis of CIGS electrodeposited solar cell devices,AntoninMoreau,InstitutMatériauxMicroélectroniqueNanosciencesdeProvence(France). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8470-21]
Investigation of the CIGS thin film with different pairs of CuGa/In sputtered layers,Yu-TingHsu,Kai-FengHuang,NationalChiaoTungUniv.(Taiwan);Shang-iTsai,Wen-HouLan,NationalUniv.ofKaohsiung(Taiwan);MingYuehChuang,NationalChengKungUniv.(Taiwan);Jia-ChingLin,Kuo-JenChang,Wen-JenLin,Chung-ShanInstituteofScienceandTechnology(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8470-22]
Developing a 3D distributed model for CIGS cells and modules,CarmenM.Ruiz,AdrienBou,AntoninMoreau,BertrandBertrand,VeronicaBermudez,NEXCIS(France). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8470-23]
74 spie.org/opadvance · TEL:+13606763290 · help@spie.org
SESSION 6 . . . . . . . . . . . . . . . . . . . . Mon. 10:30 am to 12:00 pm
Transparent Conducting OxidesSession Chair: Shubhra Bansal, U.S.Dept.ofEnergy(UnitedStates)
Amorphous InZnO transparent conductors for improved Epi-Si heterojunction PV performance (Invited Paper),ThomasGennett,CharlesW.Teplin,JohnD.Perkins,SachitGrover,DavidYoung,DavidS.Ginley,NationalRenewableEnergyLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . [8470-24]
Transparent conducting materials: overview and recent results,JoopvanDeelen,ArnjanHovestad,PascalBuskens,BasKniknie,MirjamTheelen,LennaertKlerk,FrankGrob,Pieter-JanBolt,TNOScienceandIndustry(Netherlands). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8470-25]
High-rate, high-throughput plasma deposition (~ 5 nm/s) of ZnO:Al thin films for industrial applications,RaniMaryJoy,OTBSolar(Netherlands);KashishSharma,TechnischeUniv.Eindhoven(Netherlands);BasKniknie,TNOScienceandIndustry(Netherlands);MariadrianaCreatore,TechnischeUniv.Eindhoven(Netherlands);RoelC.Bosch,OTBSolar(Netherlands). . . [8470-26]
Electrical and optical properties of TiO 2:Nb thin films prepared by spray pyrolysis technique,MghendiM.Mwamburi,ChepkiolelUniv.College(Kenya). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8470-27]
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:00to1:30pm
Solar Energy Plenary Session . . . . . . . . Mon. 1:30 to 5:00 pm
SessionChair: Martha Symko-Davies,NationalRenewableEnergyLab.(USA)
1:30pm:Understanding the Generation of Charge Carriers in Organic Photovoltaic Devices, GarryRumbles,NationalRenewableEnergyLab.(USA)andUniv.ofColoradoatBoulder(USA)
2:00pm:Light Management in Single-Junction III-V Solar Cells, BrendanM.Kayes,AltaDevices,Inc.(USA)
2:30pm:Carbon Nanotubes for Photovoltaics, MichaelJ.Heben,TheUniv.ofToledo(USA)
CoffeeBreak . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3:00to3:30pm
3:30pm:Advanced Solar Cell Technologies for Concentrating Photovoltaics Systems, VijitSabnis,SolarJunction(USA)
4:00pm:High-Rate Processing and Advanced Emitter Structures for CIGS PV Module Manufacturing,BillyJ.Stanbery,HelioVoltCorp.(USA)
4:30pm:On the Way to Accelerated Life Testing, MichaelKöhl,Fraunhofer-InstitutfürSolareEnergiesysteme(Germany)
Posters-Monday . . . . . . . . . . . . . . . . . . . . Mon. 5:30 to 7:30 pmConference attendees are invited to attend the poster session on Monday
evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
Electron transport inside ZnO/CNTs-based dye-sensitized solar cell,AzimahOmar,HudaAbdullah,Univ.KebangsaanMalaysia(Malaysia) . . . . . . [8470-28]
Determination of the optical properties of thin films using ellipsometer and spectrophotometer techniques,LinShu,YuFeng,IvanP.Wurfl,TheUniv.ofNewSouthWales(Australia). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8470-29]
X-ray absorption and infrared studies of CdTe thin films,Yu-ChangYang,NationalTaiwanUniv.(Taiwan);J.W.Tsu,NationalTaiwanNormalUniv.(Taiwan);TingSahnChan,NationalSynchrotronRadiationResearchCtr.(Taiwan);Tzuen-RongYang,NationalTaiwanNormalUniv.(Taiwan);ZheChuanFeng,NationalTaiwanUniv.(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . [8470-30]
The effect of sputtering power on the properties of Zr-Ga co-doped ZnO films by DC magnetron sputtering,XiaoliWu,ShandongUniv.ofTechnology(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8470-31]
CIGS absorbers formed by selenziation of non-vacuum metallic precursors with chemical selenium layer,Lung-TengCheng,Ding-WenChiou,Ke-YuLai,Tsung-YehChuang,IndustrialTechnologyResearchInstitute(Taiwan)[8470-32]
Preparation and characterization of FTO thin films by RF magnetron sputtering for sensor applications,MajeeshM.Mangalasseril,ShijeeshR.Methatta,HasnaKudilattu,B.Pradeep,MadambiK.Jayaraj,CochinUniv.ofScience&Technology(India) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8470-33]
Structural and morphology of Zn 1-xCu xS films as anti-reflecting coating affected the cell performance,HudaAbdullah,Univ.KebangsaanMalaysia(Malaysia). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8470-34]
Preparation and characterization of ZnO thin films deposited by surfatron produced discharge,JiriOlejnicek,ZdenekHubicka,JiriSmid,StepanKment,OlexandrChurpita,LubomirJastrabik,InstituteofPhysicsoftheASCR,v.v.i.(CzechRepublic);ChristopherL.Exstrom,ScottA.Darveau,TheUniv.ofNebraskaatKearney(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . [8470-35]
Peculiarities of obtaining of ZnCdS nanolayers by chemical vapor deposition for solar cells,MaarifJafarov,BakuStateUniv.(Azerbaijan) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8470-36]
Performance analysis of selective emitter structures for multi-crystalliner Si solar cells,Jyh-JierJ.Ho,NationalTaiwanOceanUniv.(Taiwan)andIndustrialTechnologyResearchInstitute(Taiwan);Sheng-ShihWang,NationalTaiwanOceanUniv.(Taiwan);Jia-JheLiou,NationalTaiwanOceanUniv.(Taiwan)andIndustrialTechnologyResearchInstitite(Taiwan);Jia-ShowHo,NationalTaiwanOceanUniv.(Taiwan);KangL.Wang,Univ.ofCalifornia,LosAngeles(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8470-37]
Tuesday 14 AugustPanel Discussion . . . . . . . . . . . . . Tues. 10:30 am to 12:00 pm
Commercialization of Emerging Photovoltaic Technologies
Moderator:Loucas Tsakalakos,GEGlobalResearch(USA)
Panelists:
Vahan Garboushian, AmonixInc.(USA)
Garry Rumbles, NationalRenewableEnergyLab.(USA)andUniv.ofColoradoatBoulder(USA)
Brendan M. Kayes, AltaDevices,Inc.(USA)
Billy J. Stanbery,HelioVoltCorp.(USA)
Conference 8470
spie.org/opadvance · TEL:+13606763290 · help@spie.org 75
Conference 8471Sunday-Tuesday 12-14 August 2012 • Proceedings of SPIE Vol. 8471
Next Generation (Nano) Photonic and Cell Technologies for Solar Energy Conversion IIIConference Chair:Loucas Tsakalakos, GEGlobalResearch(UnitedStates)
Program Committee:Amanda J. Chatten, ImperialCollegeLondon(UnitedKingdom);Gavin Conibeer, TheUniv.ofNewSouthWales(Australia);Alberto Salleo, StanfordUniv.(UnitedStates);Sean E. Shaheen, Univ.ofDenver(UnitedStates);Wilfried G. J. H. M. van Sark, UtrechtUniv.(Netherlands);Deli Wang, Univ.ofCalifornia,SanDiego(UnitedStates);Xianfan Xu, PurdueUniv.(UnitedStates);Edward T. Yu, TheUniv.ofTexasatAustin(UnitedStates)
Sunday 12 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . Sun. 10:30 am to 12:10 pm
Advanced Solar Energy Conversion Mechanisms ISession Chair: Loucas Tsakalakos, GEGlobalResearch(UnitedStates)
Exciton fission and solar energy conversion beyond the limit (Invited Paper),XiaoyangZhu,TheUniv.ofTexasatAustin(UnitedStates). . . . . . . . . [8471-01]
Analysis on carrier energy relaxation in superlattices and its implications on the design of hot carrier solar cell absorbers,YuFeng,PasqualeAliberti,RobPatterson,BineshVeettil,SantoshShrestha,MartinGreen,GavinConibeer,TheUniv.ofNewSouthWales(Australia). . . . . . . . . . . . . . . . . . . . . . . . . . [8471-02]
Theoretical performance of hot carrier solar cells based on InN/InGaN nanostructures,PasqualeAliberti,GavinConibeer,SantoshShrestha,YuFeng,TheUniv.ofNewSouthWales(Australia);RaphaelClady,TheUniv.ofSydney(Australia). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8471-03]
To be announced (Invited Paper),AlexandreFreundlich,Univ.ofHouston(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8471-04]
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:10to1:10pm
SESSION 2 . . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 1:10 to 3:30 pm
Photonic Structures for Solar Energy Conversion ISession Chair: Deli Wang, Univ.ofCalifornia,SanDiego(UnitedStates)
To be announced (Invited Paper),JenniferA.Dionne,Univ.ofCalifornia,Berkeley(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8471-05]
Nanostructured solar irradiation control materials for solar energy conversion,JinHoKang,IseleyA.Marshall,NationalInstituteofAerospace(UnitedStates);MattewN.Torrico,TheUniv.ofTennessee(UnitedStates);ChaseR.Taylor,Univ.ofNebraska-Lincoln(UnitedStates);JeffryEly,AngelHenderson,OldDominionUniv.(UnitedStates);GodfreySauti,LukeJ.Gibbons,NationalInstituteofAerospace(UnitedStates);Jae-WooKim,NationalInsititueofAerospace(UnitedStates);CheolPark,SharonE.Lowther,NationalInstituteofAerospace(UnitedStates);PeterT.Lillehei,RobertG.Bryant,NASALangleyResearchCtr.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8471-06]
Molecular photon upconversion for solar energy conversion,AndrewJ.Ferguson,GarryRumbles,AndrewNorman,WilliamNemeth,QiWang,NationalRenewableEnergyLab.(UnitedStates);FelixCastellano,BowlingGreenStateUniv.(UnitedStates);MichaelTherien,DukeUniv.(UnitedStates) . . . [8471-07]
Nanostructured crystalline silicon solar cells with angle-insensitive broadband absorption enhancement,RagipPala,CaliforniaInstituteofTechnology(UnitedStates);KorayAydin,NorthwesternUniv.(UnitedStates);DurmusKaratay,RyanBriggs,HarryAtwater,Jr.,CaliforniaInstituteofTechnology(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8471-26]
Using oblique angle scatter depolarization as a metric of absorption for front surface nanoparticle-enhanced solar collectors,ThomasM.Fitzgerald,Univ.ofDayton(UnitedStates);MichaelMarciniak,AirForceInstituteofTechnology(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8471-09]
Quantum wells and superlattices for III-V photovoltaics and photodetectors (Invited Paper),MatthewP.Lumb,RobertJ.Walters,U.S.NavalResearchLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8471-10]
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 4:00 to 5:30 pm
Nano Excitonic Solar CellsSession Chair: Sean E. Shaheen, Univ.ofDenver(UnitedStates)
Formation of silicon nanoparticles from high-temperature annealed Si-rich silicon oxynitride films,AbdelilahSlaoui,FabienEhrhardt,FlorianDelachat,GeraldFerblantier,DominiqueMuller,Institutd’ÉlectroniqueduSolideetdesSystèmes(France). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8471-11]
Excitonic sensitization of ultrathin silicon layers for future photovoltaic architectures,AntonV.Malko,TheUniv.ofTexasatDallas(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8471-12]
Plasmonic-enhanced organic solar Cells,ShivaShahin,PalashGangopadhyay,RobertNorwood,CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8471-13]
Sun-light upconversion in multi-component organic systems and its application for dye-sensitized solar cells efficiency enhancement (Invited Paper),StanislavBaluschev,Max-Planck-InstitutfürPolymerforschung(Germany);GabrielleNelles,SonyDeutschlandGmbH(Germany);KatharinaLandfester,Max-Planck-InstitutfürPolymerforschung(Germany);TzenkaMiteva,SonyDeutschlandGmbH(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . [8471-14]
Symposium-Wide Plenary Session . . . . . . . . . . . . . . . . . . . . Sun. 6:00 to 7:25 pm6:00pm: Introduction and Opening Remarks
6:05pm: The Exciting Science of Light with Metamaterials, VladimirM.Shalaev,PurdueUniv.(USA)
6:45pm:Future of Optics and Photonics, BahaaE.A.Saleh,CREOL,TheCollegeofOpitcsandPhotonicsattheUniv.ofCentralFlorida(USA)
Monday 13 AugustSESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . .Mon. 8:00 to 9:50 am
Advanced Solar Energy Conversion Mechanisms IISession Chair: Loucas Tsakalakos, GEGlobalResearch(UnitedStates)
To be announced (Invited Paper),ArthurJ.Nozik,NationalRenewableEnergyLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8471-15]
Nanowire device concepts for thin film photovoltaics (Invited Paper),SilkeChristiansen,InstitutfürPhotonischeTechnologiene.V.(Germany) . . [8471-16]
Efficiency of carrier-multiplication in semiconductor quantum dots: theory and simulations (Invited Paper),ChristopheDelerue,GuyAllan,Institutd’Electronique,deMicroélectronique,etdeNanotechnologie(France)[8471-17]
Ultrafast electronic relaxation of CdSe nanocrystals: the effects of morphology in colloidal and sample-substrate interaction,BryanT.Spann,LiangliangChen,XiulinRuan,XianfanXu,PurdueUniv.(UnitedStates)[8471-18]
SESSION 5 . . . . . . . . . . . . . . . . . . . . Mon. 10:30 am to 12:00 pm
Advanced Solar Energy Conversion Mechanisms IIISession Chair: Xianfan Xu, PurdueUniv.(UnitedStates)
Up-conversion for photovoltaics (Invited Paper),GavinConibeer,CraigM.Johnson,SanghunWoo,TheUniv.ofNewSouthWales(Australia) . . [8471-19]
Effects of silicon nanowire morphology on its optical properties and hybrid solar cell performance,Hong-JhangSyu,Shu-ChiaShiu,NationalTaiwanUniv.(Taiwan);Yung-JrHung,San-LiangLee,NationalTaiwanUniv.ofScienceandTechnology(Taiwan);Ching-FuhLin,NationalTaiwanUniv.(Taiwan). [8471-20]
76 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Improving the characteristics of intermediate-band solar cell devices using a vertically aligned InAs/GaAsSb quantum dot structure,Wei-ShengLiu,Hong-MingWu,Fu-HsiangTsao,Tsan-LinHsu,YuanZeUniv.(Taiwan);Jen-InnChyi,NationalCentralUniv.(Taiwan) . . . . . . . . . . . . . . . . . . . . . . . . . . [8471-21]
Factors determining charge separation at nanoscopic photovoltaic hetero-junctions,AndreasF.Bartelt,ChristianStrothkämper,RobertSchütz,RainerEichberger,TheHelmholtzZentrumBerlin(Germany). . . . . . . . . . . . . [8471-22]
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:00to1:30pm
Solar Energy Plenary Session . . . . . . . . Mon. 1:30 to 5:00 pm
SessionChair: Martha Symko-Davies,NationalRenewableEnergyLab.(USA)
1:30pm:Understanding the Generation of Charge Carriers in Organic Photovoltaic Devices, GarryRumbles,NationalRenewableEnergyLab.(USA)andUniv.ofColoradoatBoulder(USA)
2:00pm:Light Management in Single-Junction III-V Solar Cells, BrendanM.Kayes,AltaDevices,Inc.(USA)
2:30pm:Carbon Nanotubes for Photovoltaics, MichaelJ.Heben,TheUniv.ofToledo(USA)
CoffeeBreak . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3:00to3:30pm
3:30pm:Advanced Solar Cell Technologies for Concentrating Photovoltaics Systems, VijitSabnis,SolarJunction(USA)
4:00pm:High-Rate Processing and Advanced Emitter Structures for CIGS PV Module Manufacturing,BillyJ.Stanbery,HelioVoltCorp.(USA)
4:30pm:On the Way to Accelerated Life Testing, MichaelKöhl,Fraunhofer-InstitutfürSolareEnergiesysteme(Germany)
Posters-Monday . . . . . . . . . . . . . . . . . . . . Mon. 5:30 to 7:30 pmConference attendees are invited to attend the poster session on Monday
evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
Plasmon induced NIR response of thin-film a-Si:H solar cells,FlorianLükermann,UlrichHeinzmann,Univ.Bielefeld(Germany);HelmutStiebig,MalibuGmbH&Co.KG(Germany)andUniv.Bielefeld(Germany). . . . . . . . . [8471-28]
Study of silicon solar cell top and bottom nano-grating location,MichaelJ.Marshall,AshtonEllaboudy,DouglasCattarusa,XiaominJin,CaliforniaPolytechnicStateUniv.,SanLuisObispo(UnitedStates) . . . . . . . . . . [8471-29]
Nanowire tandem solar cells,RenzeWang,ZhipingZhou,PekingUniv.(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8471-30]
Plasmonic-assisted absorption enhancement in thin-film semiconductors,MariaAntoniettaVincenti,DomenicodeCeglia,TheAEgisTechnologiesGroup,Inc.(UnitedStates);MichaelScalora,U.S.ArmyAviationandMissileCommand(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8471-31]
Broadband light trapping in Si solar cells by Al nanoparticles,YinanZhang,OuyangZi,NicholasStokes,BaohuaJia,ZhengrongShi,MinGu,SwinburneUniv.ofTechnology(Australia). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8471-32]
Hybrid heterostructures from organic semiconductors and semiconductor quantum dots for advanced photovoltaic applications,SergeyDaineko,NationalResearchNuclearUniv.MEPhI(RussianFederation);M.G.Tedoradze,A.N.FrumkinInstituteofPhysicalChemistryandElectrochemistry(RussianFederation);MikhailArtemyev,NationalResearchNuclearUniv.MEPhI(RussianFederation);IgorR.Nabiev,TrinityCollege(Ireland);AlexanderA.Chistyakov,NationalResearchNuclearUniv.MEPhI(RussianFederation). . . . . . . [8471-33]
Modification of surface defects in vertically-aligned ZnO nanostructures to improve power conversion efficiency of excitonic solar cells,IreneGonzalez-Valls,CIN2(Spain);JuanS.Reparaz,TechnischeUniv.Berlin(Spain);FrankGüell,Univ.deBarcelona(Spain);MarkusR.Wagner,GordonCallsen,TechnischeUniv.Berlin(Germany);BelenBallesteros,CIN2(Spain);AxelHoffman,TechnischeUniv.Berlin(Germany);MonicaLira-Cantu,CIN2(Spain). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8471-34]
Quantum dot solar cell simulation within the non-equilibrium green function formalism,AudeBerbezier,InstitutMatériauxMicroélectroniqueNanosciencesdeProvence(France);FabienneMichelini,InstitutMateriauxNanoelectroniquedeProvence(France) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8471-35]
Solar cells based on artificial superposition compound eye,AnelGarzaRivera,InstitutoNacionaldeAstrofísica,ÓpticayElectrónica(Mexico);FranciscoJ.Renero-Carrillo,InstitutoNacionaldeAstrofisica,OpticayElectronica(Mexico). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8471-36]
Surface plasmon enhanced P3HT:PCBM photodetecting/photovoltaic devices,SandraR.Zivanovic,DentchoA.Genov,AnilThapa,MarkKoorie,ShravanrakeshAnimilli,LouisianaTechUniv.(UnitedStates) . . . . . . . [8471-37]
Tuesday 14 AugustSESSION 6 . . . . . . . . . . . . . . . . . . . . . . . . Tues. 8:20 to 10:00 am
Photonic Structures for Solar Energy Conversion IISession Chair: Gavin Conibeer, TheUniv.ofNewSouthWales
(Australia)
Nano-imprinted rear-side diffraction gratings for absorption enhancement in solar cells,AlexanderMellor,Univ.PolitécnicadeMadrid(Spain);HubertHauser,AronGuttowski,ChristineWellens,MichaelNitsche,BenediktBläsi,Fraunhofer-InstitutfürSolareEnergiesysteme(Germany);IgnacioTobías,AntonioMartí,AntonioLuque,Univ.PolitécnicadeMadrid(Spain). . . [8471-23]
Angle independent broadband absorption in thin-film metal-semiconductor stacks,DomenicodeCeglia,MariaAntoniettaVincenti,TheAEgisTechnologiesGroup,Inc.(UnitedStates);MirkoG.Cappeddu,Univ.degliStudidiRomaLaSapienza(Italy);MichaelScalora,U.S.ArmyAviationandMissileCommand(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8471-24]
Plasmonic silver nanowire fingers on silicon wafer solar cells,ShouyiXie,OuyangZi,BaohuaJia,MinGu,SwinburneUniv.ofTechnology(Australia). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8471-25]
Coupled optical and electrical modeling for optimization of nanostructured solar cells,MichaelG.Deceglie,CaliforniaInstituteofTechnology(UnitedStates);VivianE.Ferry,LawrenceBerkeleyNationalLab.(UnitedStates);A.PaulAlivisatos,Univ.ofCalifornia,Berkeley(UnitedStates)andLawrenceBerkeleyNationalLab.(UnitedStates);HarryAtwater,Jr.,CaliforniaInstituteofTechnology(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8471-08]
Upconverting electrodes for enhanced light absorption in photovoltaics,DiM.Wu,JenniferA.Dionne,AlbertoSalleo,StanfordUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8471-27]
Panel Discussion . . . . . . . . . . . . . Tues. 10:30 am to 12:00 pm
Commercialization of Emerging Photovoltaic Technologies
Moderator:Loucas Tsakalakos,GEGlobalResearch(USA)
Panelists:
Vahan Garboushian, AmonixInc.(USA)
Garry Rumbles, NationalRenewableEnergyLab.(USA)andUniv.ofColoradoatBoulder(USA)
Brendan M. Kayes, AltaDevices,Inc.(USA)
Billy J. Stanbery,HelioVoltCorp.(USA)
Conference 8471
spie.org/opadvance · TEL:+13606763290 · help@spie.org 77
Conference 8472Tuesday-Thursday 14-16 August 2012 • Proceedings of SPIE Vol. 8472
Reliability of Photovoltaic Cells, Modules, Components, and Systems VConference Chair:Neelkanth G. Dhere, Univ.ofCentralFlorida(UnitedStates)
Conference Co-Chairs:John H. Wohlgemuth, NationalRenewableEnergyLab.(UnitedStates);Kevin W. Lynn, U.S.Dept.ofEnergy(UnitedStates)
Program Committee:David S. Albin, NationalRenewableEnergyLab.(UnitedStates);Glenn B. Alers, Univ.ofCalifornia,SantaCruz(UnitedStates);Ward I. Bower, SandiaNationalLabs.(UnitedStates);Leila R. O. Cruz, InstitutoMilitardeEngenharia(Brazil);Takuya Doi, NationalInstituteofAdvancedIndustrialScienceandTechnology(Japan);Fernando Fabero, Ctr.deInvestigacionesEnergéticas,MedioambientalesyTecnológicas(Spain);Vivek S. Gade, JabilCircuit,Inc.(UnitedStates);William J. Gambogi, Jr., Dupont(UnitedStates);Werner Herrmann, TÜVRheinlandGroup(Germany);Stephen J. Hogan, SpireCorp.(UnitedStates);Michael Köhl, Fraunhofer-InstitutfürSolareEnergiesysteme(Germany);Ralf Leutz, ConcentratorOpticsGmbH(Germany);Xavier Mathew, Ctr.deInvestigaciónenEnergia(Mexico);Robert McConnell, AmonixInc.(UnitedStates);Yoichi Murakami, JapanElectricalSafety&EnvironmentTechnologyLabs.(Japan);F. J. John Pern, NationalRenewableEnergyLab.(UnitedStates);Shirish Pethe, Solopower,Inc.(UnitedStates);Marianne Rodgers, Univ.ofCentralFlorida(UnitedStates);Ivan Sinicco, OerlikonSolarLtd.(Switzerland);Bolko von Roedern, Consultant(UnitedStates)
Monday 13 AugustSolar Energy Plenary Session . . . . . . . . Mon. 1:30 to 5:00 pm
SessionChair: Martha Symko-Davies,NationalRenewableEnergyLab.(USA)
1:30pm:Understanding the Generation of Charge Carriers in Organic Photovoltaic Devices, GarryRumbles,NationalRenewableEnergyLab.(USA)andUniv.ofColoradoatBoulder(USA)
2:00pm:Light Management in Single-Junction III-V Solar Cells, BrendanM.Kayes,AltaDevices,Inc.(USA)
2:30pm:Carbon Nanotubes for Photovoltaics, MichaelJ.Heben,TheUniv.ofToledo(USA)
CoffeeBreak . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3:00to3:30pm
3:30pm:Advanced Solar Cell Technologies for Concentrating Photovoltaics Systems, VijitSabnis,SolarJunction(USA)
4:00pm:High-Rate Processing and Advanced Emitter Structures for CIGS PV Module Manufacturing,BillyJ.Stanbery,HelioVoltCorp.(USA)
4:30pm:On the Way to Accelerated Life Testing, MichaelKöhl,Fraunhofer-InstitutfürSolareEnergiesysteme(Germany)
Posters-Monday . . . . . . . . . . . . . . . . . . . . Mon. 5:30 to 7:30 pmConference attendees are invited to attend the poster session on Monday
evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
Electric current generation by sulfur-reducing bacteria in microbial-anode fuel cell,OrestaM.Vasyliv,OleksandrI.Bilyy,YaroslavP.Ferensovych,SvitlanaO.Hnatush,IvanFrankoNationalUniv.ofL’viv(Ukraine) . . . . . . . . . . [8472-35]
Effect of cross-linking degree on PV module performance,CorneliaPeike,PhilipHülsmann,StephanHoffmann,MichaelKöhl,Karl-AndersWeiss,Fraunhofer-InstitutfürSolareEnergiesysteme(Germany);AnneleneDethlefsen,SCHOTTSolarAG(Germany);NorbertLenck,HarryEngelmann,SCHOTTSolarGmbH(Germany);UrbanWeber,KurtNattermann,SCHOTTAG(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8472-36]
Tuesday 14 AugustPanel Discussion . . . . . . . . . . . . . Tues. 10:30 am to 12:00 pm
Commercialization of Emerging Photovoltaic Technologies
Moderator:Loucas Tsakalakos,GEGlobalResearch(USA)
Panelists:
Vahan Garboushian, AmonixInc.(USA)
Garry Rumbles, NationalRenewableEnergyLab.(USA)andUniv.ofColoradoatBoulder(USA)
Brendan M. Kayes, AltaDevices,Inc.(USA)
Billy J. Stanbery,HelioVoltCorp.(USA)
Lunch/ExhibitionBreak. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:00to1:30pm
SESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 1:30 to 3:30 pm
Progress towards Stable Organic Solar Cells: Joint Session with Conference 8477
Session Chair: Ifor D. Samuel, Univ.ofSt.Andrews(UnitedKingdom)
Electrodes, interface materials, and architectures to enhance the efficiency and lifetime of organic photovoltaic cells ( Keynote Presentation),PaulL.Heremans,AfshinHadipour,EszterVoroshazi,DavidCheyns,BarryP.Rand,IMEC(Belgium). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8477-01]
The role of electron affinity in determining whether fullerenes catalyze photoxidation of polymers or prevent it by scavenging electrons,IsaacT.Sachs-Quintana,EricT.Hoke,StanfordUniv.(UnitedStates);MatthewT.Lloyd,NextEnergyTechnologies,Inc.(UnitedStates);IsaacV.Kauvar,StanfordUniv.(UnitedStates);NikosKopidakis,AlexandreNardes,NationalRenewableEnergyLab.(UnitedStates);MichaelD.McGehee,StanfordUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8472-01]
Stability and degradation of organic photovoltaics fabricated, aged, and characterized by the ISOS 3 inter-laboratory collaboration,DavidM.Tanenbaum,PomonaCollege(UnitedStates);MartinHermenau,TechnischeUniv.Dresden(Germany);EszterVoroshazi,IMEC(Belgium);MatthewT.Lloyd,NationalRenewableEnergyLab.(UnitedStates);YuliaGalagan,NationalTaiwanUniv.(Taiwan);BirgerZimmermann,Fraunhofer-InstitutfürSolareEnergiesysteme(Germany);MarkusHösel,HenrikF.Dam,TechnicalUniv.ofDenmark(Denmark);MikkelJørgensen,SurenGevorgyan,RisøNationalLab.(Denmark);SuleymanKudret,WouterMaes,LaurenceLutsen,DirkVanderzande,Univ.Hasselt(Belgium);UliWürfel,Fraunhofer-InstitutfürSolareEnergiesysteme(Germany);RonnAndriessen,HolstCtr.(Netherlands);RolandRösch,TechnischeUniv.Ilmenau(UnitedStates);HaraldHoppe,TechnischeUniv.Ilmenau(Germany);MonicaLira-Cantu,GerardoTeran-Escobar,CIN2(Spain);AurélieDupuis,Pierre-OlivierBussière,AgnesRivaton,Univ.BlaisePascal(France);GülsahUzunoglu,TÜBITAKNationalMetrologyInstitute(Turkey);DavidGermack,NationalInstituteofStandardsandTechnology(UnitedStates);BirgittaAndreasen,MortenMadsen,KionNorrman,EvaBundgaard,RisøNationalLab.(Denmark);FrederikC.Krebs,TechnicalUniv.ofDenmark(Denmark) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8477-02]
78 spie.org/opadvance · TEL:+13606763290 · help@spie.org
On the stability of a variety of organic photovoltaic devices by the IPCE and in situ IPCE analyses: the ISOS-3 inter-laboratory collaboration,MonicaLira-Cantu,GerardoTeran-Escobar,CIN2(Spain);DavidTanenbaumb,PomonaCollege(UnitedStates);EszterVoroshazidd,IMEC(Belgium);MartinHermenau,TechnischeUniv.Dresden(Germany);KionNorrman,TechnialUniv.ofDenmark(Denmark);MatthewLloyd,NationalRenewableEnergyLab.(UnitedStates);YuliaGalagan,HolstCtr.(Netherlands);BirgerZimmermannh,Fraunhofer-InstitutfürSolareEnergiesysteme(Germany);MarkusHösel,HenrikF.Dam,MikkelJogersen,SurenGevorgyan,RisøNationalLab.(Denmark);LaurenLutsen,DirkVanderzande,Univ.Hasselt(Belgium);UliWürfel,FraunhoferInstituteforSolarEnergySystemsISE(Germany);RonnAndriessen,HOLSTCtr.(Netherlands);RolandRösch,TechnischeUniv.Ilmenau(Georgia);HaraldHoppe,TechnischeUniv.Ilmenau(Germany);AgnèsRivatonn,Univ.BlaisePascal(France);GülsahY.Uzunoglu,TÜBITAKNationalMetrologyInstitute(Turkey);DavidGermack,BrookhavenNationalLab.(UnitedStates);BrigittaAndearsen,MortenV.Madsenb,EvaBundgaard,FrederkC.Krebs,RisøNationalLab.(Denmark) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8472-02]
Investigation of the degradation mechanism of a variety of organic photovoltaic devices by combination of imaging techniques: the ISOS-3 inter-laboratory collaboration,RolandRösch,TechnischeUniv.Ilmenau(Germany);DavidM.Tanenbaum,PomonaCollege(UnitedStates);MikkelJorgensen,RisøNationalLab.(Denmark);MarcoSeeland,MaikBärenklau,TechnischeUniv.Ilmenau(Germany);MartinHermenau,TechnischeUniv.Dresden(Germany);EszterVoroshazi,IMEC(Belgium);MatthewT.Lloyd,NationalRenewableEnergyLab.(UnitedStates);YuliaGalagan,NationalTaiwanUniv.(Taiwan);BirgerZimmermann,Albert-Ludwigs-Univ.Freiburg(Germany);UliWürfel,Fraunhofer-InstitutfürSolareEnergiesysteme(Germany);MarkusHösel,HenrikF.Dam,SurenA.Gevorgyan,RisøNationalLab.(Denmark);SuleymanKudret,WouterMaes,LaurenceLutsen,DirkVanderzande,Univ.Hasselt(Belgium);RonnAndriessen,HolstCtr.(Netherlands);GerardoTeran-Escobar,MonicaLira-Cantu,CIN2(Spain);AgnesRivaton,Univ.BlaisePascal(France);GülsahY.Uzunoglu,TÜBITAKNationalMetrologyInstitute(Turkey);DavidGermack,NationalInstituteofStandardsandTechnology(UnitedStates);BirgittaAndreasen,MortenV.Madsen,KionNorrman,RisøNationalLab.(Denmark);HaraldHoppe,TechnischeUniv.Ilmenau(Germany);FrederikC.Krebs,RisøNationalLab.(Denmark) . . . . . . . . . . . . . . . . . . . . . . . . . . [8472-03]
Efficient organic vacuum deposited tandem solar cells and modules on glass and PET (Invited Paper),ChristianL.Uhrich,RicoMeerheim,ToniMüller,MartinP.Pfeiffer,heliatekGmbH(Germany) . . . . . . . . . . . . . . . . . . . . [8477-03]
SESSION 2 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 4:00 to 5:40 pm
CPV/Reliability: Joint Session with Conference 8468Session Chair: Neelkanth G. Dhere, Univ.ofCentralFlorida
(UnitedStates)
Degradation of back surface acrylic mirrors for low concentration and mirror augmented photovoltaics,MylesP.Murray,LauraS.Bruckman,SamuelRichardson,CaseWesternReserveUniv.(UnitedStates);ScottA.Brown,GregReinbolt,MarkSchuetz,ReplexPlastics(UnitedStates);RogerH.French,CaseWesternReserveUniv.(UnitedStates). . . . . . . . . . . . . . [8472-04]
Designing reliability into a 1000X concentration CPV system through targeted stress testing (Invited Paper),MichaelWinter,IanAeby,JamesS.Foresi,EMCORECorp.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . [8468-05]
The BOS-X approach: achieving drastic cost reduction in CPV through holistic power plant level innovation (Invited Paper),AdamP.Plesniak,VahanGarboushian,AmonixInc.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . [8468-06]
Evolution and field performance of Soitec’s Concentrix CPV systems,AndreasGombert,SoitecSolar(Germany);ClarkCrawford,SoitecSolar(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8472-05]
Wednesday 15 AugustSESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . .Wed. 8:30 to 11:50 am
PV Module ReliabilitySession Chair: Bolko von Roedern, Consultant(UnitedStates)
Reproducing wind-induced excitation of PV modules in the laboratory without the need of a dedicated wind tunnel (Invited Paper),HerbertSchueneman,Westpak,Inc.(UnitedStates). . . . . . . . . . . . . . . . . . . . . [8472-06]
Predicted thermal stresses in a silicon-based photovoltaic (PV) module,EphraimSuhir,Univ.ofCalifornia,SantaCruz(UnitedStates);DongkaiShangguan,FlextronicsInternational(UnitedStates). . . . . . . . . . . . . . [8472-07]
Determination of moisture ingress through back and edge side in PV module under continuously varying environment,NamsuKim,WonsikHong,KoreaElectronicsTechnologyInstitute(Korea,Republicof);ChaeyongLee,ByongsuKim,SukwonKim,HwanyeonKim,YongSong,LGElectronicsInc.(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8472-08]
Effect of humidity and temperature on the potential induced degradation,StephanHoffmann,MichaelKöhl,Fraunhofer-InstitutfürSolareEnergiesysteme(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8472-09]
Outdoor high-voltage bias study of commercially available PV modules from leading manufacturers in hot and humid conditions,NeelkanthG.Dhere,AshwaniKaul,EricSchneller,NarendraShiradkar,Univ.ofCentralFlorida(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8472-10]
Statistical modeling of 10+ years field exposed c-Si modules performance degradation,JosephM.Kuitche,GovindasamyTamizhMani,RongPan,ArizonaStateUniv.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8472-11]
Systematic reliability studies of back-contact photovoltaic modules,VictorRosca,IanJ.Bennett,WilmaEerenstein,EnergyResearchCtr.oftheNetherlands(Netherlands). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8472-12]
Modelling of artifacts and the characterisation of the effect of temperature on a monocrystalline solar cell via the LBIC/LBIV technique,MghendiM.Mwamburi,ChepkiolelUniv.College(Kenya). . . . . . . . . . . . . . . . . . . . [8472-13]
Lunch/Exhibition Break........................... 11:50amto1:30pm
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 1:30 to 3:20 pm
Reliability of Thin-Film PV ModulesSession Chair: Shubhra Bansal, U.S.Dept.ofEnergy(UnitedStates)
Statistical evaluation of PV modules with extended damp heat test and extended thermal cycling test: 1st report (Invited Paper),TakuyaDoi,MasanaoInoue,AtsushiMasuda,NationalInstituteofAdvancedIndustrialScienceandTechnology(Japan);YasunoriUchida,HiroshiKato,KohjiMasuda,YoshikuniAsano,JapanElectricalSafety&EnvironmentTechnologyLabs.(Japan);ShinjiKawai,YutakaFukumoto,IndustrialTechnologyCtr.ofSaga(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8472-14]
Light soaking behavior and alternate stabilization method for polycrystalline thin-film photovoltaic modules,ChrisDeline,AdamStokes,SarahR.Kurtz,JohnH.Wohlgemuth,StevenRummel,TimothyJ.Silverman,NationalRenewableEnergyLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . [8472-15]
Comparative study of two types of a-Si:H PV modules in hot and humid climate,NeelkanthG.Dhere,AshwaniKaul,ShirishPethe,Univ.ofCentralFlorida(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8472-16]
Ineffectiveness of some transparent metal oxides as damp heat protective coating for CIGS solar cells,F.J.JohnPern,RommelN.Noufi,NationalRenewableEnergyLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . [8472-17]
Stability of CIGS solar cells and component materials evaluated by a step-stress accelerated life test method,F.J.JohnPern,RommelN.Noufi,NationalRenewableEnergyLab.(UnitedStates). . . . . . . . . . . . . . . . . [8472-18]
Conference 8472
spie.org/opadvance · TEL:+13606763290 · help@spie.org 79
SESSION 5 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 3:50 to 5:40 pm
Reliability of PV System and ComponentsSession Chair: Takuya Doi, NationalInstituteofAdvancedIndustrial
ScienceandTechnology(Japan)
PV and firefighter safety (Invited Paper),BobG.Backstrom,ULLLC(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8472-19]
Method for site characterization of anisotropic diffuse illumination of PV systems,JuanRusso,DemingZhang,ShelbyVorndran,TheUniv.ofArizona(UnitedStates);MichaelGordon,CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates);AdriaBrooks,VincentLonij,AlexanderCronin,RaymondKostuk,TheUniv.ofArizona(UnitedStates) . . . . . . . . . . . . . . . . . . . . [8472-20]
A novel modelling method for determining the reliability and optimum size of a standalone photovoltaic system using Markovian models,MariosTheristis,TapasK.Mallick,Heriot-WattUniv.(UnitedKingdom);GeorgiosC.Bakos,DemokritosUniv.ofThrace(Greece);IoannisA.Papazoglou,NationalCtr.forScientificResearchDemokritos(Greece). . . . . . . . . . . . . . . . . [8472-21]
Examination of a junction-box adhesion test for use in PV module qualification,DavidC.Miller,JohnH.Wohlgemuth,SarahR.Kurtz,NationalRenewableEnergyLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . [8472-22]
Reliability of sequenced inverter architecture for integrated AC module,DeanColeman,AnnGargiulo,ArrayPower(UnitedStates) . . . . . . . . . [8472-23]
Thursday 16 AugustSESSION 6 . . . . . . . . . . . . . . . . . . . . Thurs. 8:00 am to 12:10 pm
Encapsulant, Backsheet, and Packaging MaterialsSession Chair: F. J. John Pern, NationalRenewableEnergyLab.(United
States)
Measurement of moisture content in photovoltaic panel encapsulants using spectroscopic optical coherence tomography: a feasibility study,ShabnamRashtchi,PabloRuiz,RickyWildman,IanAshcroft,LoughboroughUniv.(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8472-24]
Interdependency of mechanical failure rate of encapsulated solar cells and module design parameters,SaschaDietrich,Fraunhofer-Ctr.fürSilizium-Photovoltaik(Germany). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8472-25]
Sol-gel antireflective coatings for photovoltaic module efficiency enhancement,KarineValle,BertrandBertussi,PhilippeBelleville,ChristopheBoscher,Commissariatàl’ÉnergieAtomique(France);PaulLefillastre,PhilippeVoarino,JulieStendera,StephaneGuillerez,InstitutNationaldel’EnergieSolaire(France). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8472-26]
Damage summation method for lifetime prediction of backsheets used in PV module under continuously varying environment,NamsuKim,WonsikHong,HyunwooKang,KoreaElectronicsTechnologyInstitute(Korea,Republicof);ChaeyongLee,ByongsuKim,SukwonKim,HwanyeonKim,YongSong,LGElectronicsInc.(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . [8472-27]
Thermogravimetric analysis of the kinetics of thermal degradation of ethylene vinyl acetate,AmirBadiee,RickyWildman,IanAshcroft,PabloRuiz,LoughboroughUniv.(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . [8472-28]
Examination of a shrinkage test for PV encapsulation materials,DavidC.Miller,NationalRenewableEnergyLab.(UnitedStates);LiangJi,UnderwritersLabs.Inc.(UnitedStates);GeorgeKelly,BPSolarInternationalInc.(UnitedStates);XiaohongGu,NationalInstituteofStandardsandTechnology(UnitedStates);NicholeNickel,TheDowChemicalCo.(UnitedStates);PaulNorum,SolarWorldAG(UnitedStates);TsuyoshiShioda,MitsuiChemicals,Inc.(Japan);GovindasamyTamizhMani,ArizonaStateUniv.(UnitedStates);JohnH.Wohlgemuth,NationalRenewableEnergyLab.(UnitedStates). . . . . . [8472-29]
Conference 8472Permeation impact on metallization degradation,CorneliaPeike,StephanHoffmann,PhilipHülsmann,Karl-AndersWeiss,MichaelKöhl,MarcoTranitz,BenjaminThaidigsmann,Fraunhofer-InstitutfürSolareEnergiesysteme(Germany);PeterBentz,Solar-FabrikAG(Germany) . . . . . . . . . . . . . . [8472-30]
Indoor vs. outdoor aging: polymer degradation in PV modules investigated by Raman spectroscopy,CorneliaPeike,ThomasKaltenbach,Karl-AndersWeiss,MichaelKöhl,Fraunhofer-InstitutfürSolareEnergiesysteme(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8472-31]
Temperature control in highly accelerated UV degradation testing of organic materials for photovoltaics,GlennB.Alers,Univ.ofCalifornia,SantaCruz(UnitedStates);JeremyOlson,APVResearch(UnitedStates) . . [8472-32]
Long-term performance of edge seal materials for PV applications,MichaelD.Kempe,MatthewReese,ArrelaineDameron,DhananjayPanchagade,NationalRenewableEnergyLab.(UnitedStates). . . . . . . . . . . . . . . . . [8472-33]
Predicting the reliability of Polyisobutylene seal for photovoltaic application,HuaLiu,JieFeng,EdoardoNicoli,LeonardoLópez,KeithKauffmann,KwanhoYang,NarayanRamesh,TheDowChemicalCo.(UnitedStates). . . . . [8472-34]
80 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Conference 8473 · NEWWednesday-Thursday 15-16 August 2012 • Proceedings of SPIE Vol. 8473
Laser Material Processing for Solar EnergyConference Chair:Edward W. Reutzel, AppliedResearchLab.,ThePennsylvaniaStateUniv.(UnitedStates)
Program Committee:David E. Carlson, CarlsonPVConsulting(UnitedStates);Corey M. Dunsky, VeecoInstrumentsInc.(UnitedStates);Costas Grigoropoulos, Univ.ofCalifornia,Berkeley(UnitedStates);Aravinda Kar, CREOL,TheCollegeofOpticsandPhotonics,Univ.ofCentralFlorida(UnitedStates);Jan Nekarda, Fraunhofer-InstitutfürSolareEnergiesysteme(Germany);Bhushan L. Sopori, NationalRenewableEnergyLab.(UnitedStates)
Wednesday 15 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . . .Wed. 8:00 to 9:50 am
Special Topics ISession Chair: Bhushan L. Sopori, NationalRenewableEnergyLab.
(UnitedStates)
Laser processing of solar cells (Keynote Presentation),DavidE.Carlson,CarlsonPVConsulting(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . [8473-01]
Influencing and enabling laser processing of solar materials through temporal pulse shaping (Invited Paper),MathewN.Rekow,ESI-PyroPhotonicsLasersInc.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8473-02]
Modeling of contact geometry and dopant profile during laser-silicon interaction,AshwinS.Raghavan,JaredJ.Blecher,ToddA.Palmer,EdwardW.Reutzel,TarasankarDebRoy,ThePennsylvaniaStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8473-03]
Synthesis of composite metal nanoparticle colloids by liquid-phase pulsed laser ablation for fabrication of CIGS solar cells on flexible substrates,WeiGuo,SomaPerooly,BingLiu,IMRAAmerica,Inc.(UnitedStates) . . . [8473-04]
Laser and thermal treatments for reclamation of silicon solar cells performance,AhlamH.J.Al-Musawi,Univ.ofBaghdad(Iraq). . . . . . [8473-05]
SESSION 2 . . . . . . . . . . . . . . . . . . . . . . . .Wed. 10:20 to 11:50 am
Laser Doping and Contacting ISession Chair: David E. Carlson, CarlsonPVConsulting(UnitedStates)
Laser-based foil metallization for crystalline silicon solar cells (Keynote Presentation),JanNekarda,MartinGraf,RalfPreu,Fraunhofer-InstitutfürSolareEnergiesysteme(Germany). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8473-06]
Influence of wavelength on laser doping and laser-fired contact processes for c-Si solar cells (Invited Paper),CarlosMolpeceres,MaríaIsabelSánchez-Aniorte,MiguelMorales,Univ.PolitécnicadeMadrid(Spain);IsidroMartín,PabloOrtega,MónicaColina,CristóbalVoz,RamónAlcubilla,Univ.PolitècnicadeCatalunya(Spain) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8473-07]
Laser doping for high-efficiency silicon solar cells,UlrichJäger,AndreasWolf,BerndSteinhauser,JanBenick,JanNekarda,RalfPreu,Fraunhofer-InstitutfürSolareEnergiesysteme(Germany). . . . . . . . . . . . . . . . . . . . . . . . . . [8473-08]
Laser doping from spin-on sources for selective emitter silicon solar cells,AbdelilahSlaoui,PathiPrathap,JeremyBartringerII,Institutd’ÉlectroniqueduSolideetdesSystèmes(France). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8473-09]
Lunch/Exhibition Break........................... 11:50amto1:20pm
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 1:20 to 3:00 pm
Laser Annealing and CrystallizationSession Chair: Costas Grigoropoulos, Univ.ofCalifornia,Berkeley
(UnitedStates)
Direct-pulsed laser crystallization of photoactive thin films at room temperature,GaryCheng,YiZhang,PurdueUniv.(UnitedStates) . . [8473-10]
Laser processing for thin film crystalline silicon solar cells,AbdelilahSlaoui,AmartyaChowdhurya,PathiPrathap,ZabardjadeSaid,Institutd’ÉlectroniqueduSolideetdesSystèmes(France);ArmelBahouka,FredericMermetII,Univ.deStrasbourg(France). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8473-11]
Introducing a laser annealing process to enable low-damage ps-laser ablation for structuring dielectric layers on textured silicon solar cells,AndreasA.Brand,AnneroseKnorz,JanNekarda,RalfPreu,Fraunhofer-InstitutfürSolareEnergiesysteme(Germany). . . . . . . . . . . . . . . . . . . . . . . . . . [8473-12]
Stress relief effects on thermal annealed PECVD a-Si:H films,MatthewDabney,A.HarvMahan,MaikelvanHest,DavidS.Ginley,NationalRenewableEnergyLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8473-13]
Solid phase laser annealing of electrodeposited CuInSe 2 thin films,AshishBhatia,TheUniv.ofUtah(UnitedStates);HelenMeadows,PhillipJ.Dale,Univ.duLuxembourg(Luxembourg);MichaelA.Scarpulla,TheUniv.ofUtah(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8473-14]
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 3:30 to 5:00 pm
Laser Scribing and Structuring ISession Chair: Corey M. Dunsky, VeecoInstrumentsInc.(United
States)
Review of laser material interaction to improve CIGSeS thin film solar cells (Invited Paper),NeelkanthG.Dhere,Univ.ofCentralFlorida(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8473-15]
Laser-assisted micro/nanoscale material processing and in-situ diagnostics for solar applications (Invited Paper),DavidJ.Hwang,StonyBrookUniv.(UnitedStates);CostasGrigoropoulos,Univ.ofCalifornia,Berkeley(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8473-16]
Femtosecond-laser structuring of thin films on solar glasses,StephanKrause,Paul-TiberiuMiclea,GerhardSeifert,StefanSchweizer,Fraunhofer-Ctr.fürSilizium-Photovoltaik(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . [8473-17]
Picosecond laser processing of thin films for photovoltaics,PauliusGecys,GediminasRaciukaitis,InstituteofPhysics(Lithuania). . . . . . . . . . . . . [8473-18]
Thursday 16 AugustSESSION 5 . . . . . . . . . . . . . . . . . . . . . . . . Thurs. 8:00 to 9:50 am
Special Topics IISession Chair: Aravinda Kar, CREOL,TheCollegeofOpticsand
Photonics,Univ.ofCentralFlorida(UnitedStates)
Laser applications in PV: then and now (Keynote Presentation),CoreyM.Dunsky,VeecoInstrumentsInc.(UnitedStates). . . . . . . . . . . . . . . . . . [8473-19]
Benefits of using laser in the production of solarthermal and photovoltaic energy generating devices (Invited Paper),UweStute,LaserZentrumHannovere.V.(Germany). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8473-20]
Laser parameters for silicon solar processing: a simulation of heat transfer and material modification,TobiasBaier,GerdaGlaeser,HaraldWanka,DieterManz,ManzAG(Germany). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8473-21]
Extending the limits of laser beam shaping for PV-cell manufacturing,IngoSteiner,ThomasMitra,LIMOLissotschenkoMikrooptikGmbH(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8473-22]
Applying field mapping refractive beam shapers in laser technologies for solar energy,AlexanderV.Laskin,VadimLaskin,AdlOpticaOpticalSystemsGmbH(Germany).......................................... [8473-23]
spie.org/opadvance · TEL:+13606763290 · help@spie.org 81
SESSION 6 . . . . . . . . . . . . . . . . . . . Thurs. 10:20 am to 12:05 pm
Laser Scribing and Structuring IISession Chair: Edward W. Reutzel, AppliedResearchLab.(United
States)
Pulsed laser micro/nano-textured surfaces for photovoltaic devices (Invited Paper),MoolC.Gupta,BaradaK.Nayak,VikramV.Iyengar,Univ.ofVirginia(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8473-24]
Investigation of short-pulse and ultra-short pulse laser ablation of silicon nitride passivation layers,MalteA.Schulz-Ruhtenberg,DanielTrusheim,MichaelSmeets,Fraunhofer-InstitutfürLasertechnik(Germany);JoDas,IMEC(Belgium);JensHoltkamp,ArnoldGillner,Fraunhofer-InstitutfürLasertechnik(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8473-25]
Laser-assisted patterning of amorphous silicon for interdigitated back contact silicon heterojunction solar cell,SylvainDeVecchi,ThibautDesrues,FlorentSouche,DelfinaMuñoz,Pierre-JeanRibeyron,InstitutNationaldel’EnergieSolaire(France);MustaphaLemiti,InstitutNationaldesSciencesAppliquéesdeLyon(France). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8473-26]
Mechanisms of lifetime degradation in Si/ARC samples patterned by laser lift-off,KatherineL.Saenger,IBMThomasJ.WatsonResearchCtr.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8473-27]
Ytterbium-pulsed fiber laser percussion drilling silicon for emitter wrap through solar cells,YongguangHuang,HongliangZhu,InstituteofSemiconductors(China) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8473-28]
Lunch/Exhibition Break.............................. 12:05to1:35pm
SESSION 7 . . . . . . . . . . . . . . . . . . . . . . . . Thurs. 1:35 to 3:05 pm
Laser Doping and Contacting IISession Chair: Jan Nekarda, Fraunhofer-InstitutfürSolare
Energiesysteme(Germany)
Laser processing for crystalline silicon photovoltaics: an enabler for low-cost, high-efficiency solar cell manufacturing (Invited Paper),MarkT.Winkler,ChristieB.Simmons,JoeT.Sullivan,RileyBrandt,MassachusettsInstituteofTechnology(UnitedStates);DanielL.Recht,HarvardUniv.(UnitedStates);ElifErtekin,Univ.ofIllinoisatUrbana-Champaign(UnitedStates);NouarTabet,KingFahdUniv.ofPetroleum&Minerals(SaudiArabia);EricMazur,HarvardUniv.(UnitedStates);MarcoMendes,JPSA(UnitedStates);StevenG.Hegedus,Univ.ofDelaware(UnitedStates);JeffreyC.Grossman,MassachusettsInstituteofTechnology(UnitedStates);MichaelJ.Aziz,HarvardUniv.(UnitedStates);TonioBuonassisi,MassachusettsInstituteofTechnology(UnitedStates) . . [8473-29]
Femtosecond laser hyperdoping and nanostructuring of semiconductors and metals (Invited Paper),KatherineC.Phillips,BenjaminFranta,Yu-TingLin,Meng-JuSher,EricMazur,HarvardUniv.(UnitedStates). . . . . . . . . . [8473-30]
Parameter optimization of laser-doped selective emitters for applications in silicon solar cells,HollyE.Heinrichs,S.Ashok,ThePennsylvaniaStateUniv.(UnitedStates);EdwardW.Reutzel,AppliedResearchLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8473-31]
Laser processes and system technology for the production of high-efficient crystalline solar cells,RolandM.Mayerhofer,RichardHendel,StephanGeiger,Rofin-BaaselLasertechnikGmbH&Co.KG(Germany). . . . . . . . . . . . [8473-32]
Conference 8473
Books of Related InterestVisittheonsiteBookstoreororderonlinetoday:spie.org/publications
Applied Prismatic and Reflective OpticsbyDennis F. VanderwerfVol.PM200
Polymer Photovoltaics: A Practical ApproachEditor:Frederik C. KrebsVol.PM175
Optoelectronics of Solar Cellsby Greg P. SmestadVol.PM115
82 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Watch for this icon next to conferences and courses discussing innovative ways to help our planet.
GREEN PHOTONICS
SPIE Optics + Photonics is a leading conference on green photonics technologies such as energy, sustainability, conservation, and environmental monitoring.
Symposium Chair
Zakya H. Kafafi, NationalScienceFoundation(USA)
Technical Organizing CommitteeZhenan Bao, StanfordUniv.(USA)Rachel Jakubiak,AirForceResearchLab.(USA)Zakya H. Kafafi, NationalScienceFoundation(USA)Iam Choon Khoo,ThePennsylvaniaStateUniv.(USA)Iain McCulloch,ImperialCollegeLondon(UnitedKingdom)Ruth Shinar,IowaStateUniv.(USA)Franky So, Univ.ofFlorida(USA)
8474 Optical Processes in Organic Materials and Nanostructures(Jakubiak) . . . . . . . . . . . . . . . . . . . . . . . . . . .83
8475 Liquid Crystals XVI(Khoo) . . . . . . . . . . . . . . . . . . . . . . . . . . .86
8476 Organic Light Emitting Materials and Devices XVI (So). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .88
8477 Organic Photovoltaics XIII (Kafafi) . . . . . . . . . . . . . . .92
8478 Organic Field-Effect Transistors XI(Bao/McCulloch) . . . .96
8479 Organic Semiconductors in Sensors and Bioelectronics V(Shinar). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .98
Organic Photonics + ElectronicsSPIEOptics+Photonics
Organic-basedmaterialshavegreatpotentialforprovidingrenewableenergysourcesaswellasplayingamajorroleincreatingsignificantcommercialapplications.Ifyouworkwithorganicmaterialsanddevices,thisconferenceisagoodfitforyou.
- OLEDs- OTFTs- OPVs- Liquid Crystals- Large-Scale Fabrication- Organic Semiconductors
spie.org/opadvance · TEL:+13606763290 · help@spie.org 83
Conference 8474Sunday-Wednesday 12-15 August 2012 • Proceedings of SPIE Vol. 8474
Optical Processes in Organic Materials and NanostructuresConference Chair:Rachel Jakubiak, AirForceResearchLab.(UnitedStates)
Conference Co-Chairs:Manfred Eich, TechnischeUniv.Hamburg-Harburg(Germany);Jean-Michel Nunzi, Queen’sUniv.(Canada)
Program Committee:Kevin D. Belfield, Univ.ofCentralFlorida(UnitedStates);Antao Chen, Univ.ofWashington(UnitedStates);Koen Clays, KatholiekeUniv.Leuven(Belgium);Alain F. Fort, InstitutdePhysiqueetChimiedesMatériauxdeStrasbourg(France);Theodore G. Goodson III, Univ.ofMichigan(UnitedStates);François Kajzar, PolytechnicalUniv.ofBucharest(Romania);Satoshi Kawata, OsakaUniv.(Japan);Mark G. Kuzyk, WashingtonStateUniv.(UnitedStates);Charles Y. C. Lee, AirForceOfficeofScientificResearch(UnitedStates);Kwang-Sup Lee, HannamUniv.(Korea,Republicof);Geoffrey A. Lindsay, NavalAirWarfareCtr.AircraftDiv.(UnitedStates);Aristides Marcano, DelawareStateUniv.(UnitedStates);Robert A. Norwood, CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates);André P. Persoons, KatholiekeUniv.Leuven(Belgium);Joy E. Rogers-Haley, AirForceResearchLab.(UnitedStates);Jayan Thomas, Univ.ofCentralFlorida(UnitedStates)
Sunday 12 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 8:30 to 10:10 am
Optical Processes in NLO MaterialsSession Chair: Rachel Jakubiak, AirForceResearchLab.
(UnitedStates)
Optical power limiting in novel nanoengineered media (Invited Paper),JayanThomas,NanoScienceTechnologyCtr.,Univ.ofCentralFlorida(UnitedStates)andCREOL,TheCollegeofOpticsandPhotonics,Univ.ofCentralFlorida(UnitedStates);PanitChantharasupawong,CREOL,TheCollegeofOpticsandPhotonics,Univ.ofCentralFlorida(UnitedStates);RejiPhilip,NanoScienceTechnologyCtr.,Univ.ofCentralFlorida(UnitedStates). . . . . . . . . . . [8474-01]
Femtosecond two-photon fluorescence excitation and nonlinear transmission spectroscopy of platinum acetylide complexes and related chromophores (Invited Paper),AleksanderK.Rebane,MikhailDrobizhev,GeoffreyWicks,AlexandrMikhailov,MontanaStateUniv.(UnitedStates);ThomasM.Cooper,AirForceResearchLab.(UnitedStates);YuriyStepanenko,PawelWnuk,InstituteofPhysicalChemistry(Poland). . . . . . . . . . . . . [8474-02]
Measurement of excited-state absorption cross sections of a novel platinum complex in nano- and picosecond top-hat Z-scan experiments employing partially coherent beams,TimothyM.Pritchett,MichaelJ.Ferry,WilliamM.ShenskyIII,AndrewG.Mott,U.S.ArmyResearchLab.(UnitedStates);RuiLiu,WenfangSun,NorthDakotaStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8474-03]
SHG/2PF microscopy of single and multi-layer graphene,IngeAsselberghs,IMEC(Belgium);AlexanderV.Klekachev,IMEC(Belgium)andKatholiekeUniv.Leuven(Belgium);AndréL.Stesmans,KatholiekeUniv.Leuven(Belgium);StefanDeGendt,IMEC(Belgium);ThierryVerbiest,MoniqueA.VanderVeen,KatholiekeUniv.Leuven(Belgium). . . . . . . . . . . . . . . . . . . . . . . . . . . . [8474-04]
SESSION 2 . . . . . . . . . . . . . . . . . . . . . Sun. 10:40 am to 12:10 pm
Nonlinear Optical MaterialsSession Chair: Jayan Thomas, CREOL,TheCollegeofOpticsand
Photonics,Univ.ofCentralFlorida(UnitedStates)
Nonlinear processes in graphenes with peripheral substitute groups (Invited Paper),XingzhongYan,SouthDakotaStateUniv.(UnitedStates);YuChen,EastChinaUniv.ofScienceandTechnology(China). . . . . . . . . . . . . . . . . . [8474-05]
Exciplex formation in solid state blends of charge-transfer-type AFX dyes and bisimide compounds,MatthewJ.Dalton,RamamurthiKannan,RachelN.Swiger,JoyE.Rogers-Haley,ThomasM.Cooper,Loon-SengTan,AirForceResearchLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8474-06]
Non-coherent low-power photon upconversion,FelixN.Castellano,BowlingGreenStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8474-07]
Synthesis, crystal growth, and second-order nonlinear optical properties of new pyridinium salts,ZhouYang,JifengTan,YiqiangDai,Univ.ofScienceandTechnologyBeijing(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8474-08]
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:10to1:40pm
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 1:40 to 3:20 pm
Nanophotonic Materials and ApplicationsSession Chair: Dean R. Evans, AirForceResearchLab.(UnitedStates)
Towards understanding the photomechanical effect in polymeric fibers: analysis of free volume in a model polymeric matrix (Invited Paper),AntoniC.Mitus,PawelWrobel,GrzegorzPawlik,WroclawUniv.ofTechnology(Poland);MarkG.Kuzyk,WashingtonStateUniv.(UnitedStates) . . . . . . . . . . . [8474-09]
Dynamic photo-driven optical architectures using azo-benzene and liquid crystal material combinations (Invited Paper),TimothyJ.Bunning,AirForceResearchLab.(UnitedStates);NelsonV.Tabiryan,SvetlanaSerak,UladzimirHrozhyk,BEAMEngineeringforAdvancedMeasurementsCo.(UnitedStates);JonathanVernon,VincentTondiglia,TimothyWhite,AirForceResearchLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8474-10]
Janus-like 3D tectons as functional nanostructures for self-assembled functional thin films towards nanophotonics,André-JeanAttias,AntoineColas,DavidKreher,FabriceMathevet,Univ.PierreetMarieCurie(France);BrettHelms,LawrenceBerkeleyNationalLab.(UnitedStates);FabriceCharra,Univ.PierreetMarieCurie(France). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8474-11]
Multi-photon laser lithography of positive photoresist for T-gate fabrication,Hong-ZhongCao,TechnicalInstituteofPhysicsandChemistry(China)andGraduateUniv.ofChineseAcademyofSciences(China);Xian-ZiDong,FengJin,Zhen-ShengZhao,Xuan-MingDuan,TechnicalInstituteofPhysicsandChemistry(China) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8474-12]
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 3:50 to 5:30 pm
Plasmonic Materials and ApplicationsSession Chair: Antoni C. Mitus, WroclawUniv.ofTechnology
(UnitedStates)
Stimulated Raman scattering near metal nanostructures (Invited Paper),MichaelScalora,U.S.ArmyAviationandMissileCommand(UnitedStates);MariaA.Vincenti,DomenicodeCeglia,TheAEgisTechnologiesGroup,Inc.(UnitedStates);MarcoGrande,PolitecnicodiBari(Italy);JosephW.Haus,Univ.ofDayton(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8474-13]
Design and evaluation of cascaded plasmonic metamaterials (Invited Paper),PieterG.Kik,CREOL,TheCollegeofOpticsandPhotonics,Univ.ofCentralFlorida(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8474-14]
Plasmon-mediated two-photon absorption enhancement in a gold nanorod-dye spin-coated film,JarrettVella,Jr.,AugustineUrbas,KyoungweonPark,RichardVaia,AirForceResearchLab.(UnitedStates). . . . . . . . . . . . . [8474-15]
Increased optical performance of silver/dielectric multilayers,RachelJakubiak,AirForceResearchLab.(UnitedStates);LirongSun,GeneralDynamicsInformationTechnology(UnitedStates)andAirForceResearchLab.(UnitedStates);NeilMurphy,AirForceResearchLab.(UnitedStates);JohnGrant,Univ.ofDaytonResearchInstitute(UnitedStates);JohnJones,AirForceResearchLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8474-16]
Symposium-Wide Plenary Session . . . . . . . . . . . . . . . . . . . . Sun. 6:00 to 7:25 pm6:00pm: Introduction and Opening Remarks
6:05pm: The Exciting Science of Light with Metamaterials, VladimirM.Shalaev,PurdueUniv.(USA)
6:45pm:Future of Optics and Photonics, BahaaE.A.Saleh,CREOL,TheCollegeofOpitcsandPhotonicsattheUniv.ofCentralFlorida(USA)
84 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Monday 13 AugustSESSION 5 . . . . . . . . . . . . . . . . . . . . . . . . .Mon. 8:30 to 10:00 am
Biological ImagingSession Chair: Aleksander K. Rebane, MontanaStateUniv.(United
States)
Two-photon fluorescence bioimaging with AIE dyes and nanoparticles (Invited Paper),Kwang-SupLee,HannamUniv.(Korea,Republicof) . [8474-17]
Stochastic photon transport model in multilayer skin tissue: using reflectance spectroscopy measurements to model normal and bruised skins,CollinLines,OlegKim,Univ.ofNotreDame(UnitedStates);SusanDuffy,HasbroChildren’sHospital(UnitedStates);MarkS.Alber,GregoryP.Crawford,Univ.ofNotreDame(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . [8474-18]
Water-soluble conjugated polyelectrolytes for two-photon biological imaging and fluorescence biosensors,HanYoungWoo,BoramKim,PusanNationalUniv.(Korea,Republicof);OkhilK.Nag,TheUniv.ofOklahomaHealthSciencesCtr.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8474-19]
Determination of chromophore distribution in skin by spectral imaging,IngaSaknite,JanisSpigulis,Univ.ofLatvia(Latvia). . . . . . . . . . . . . . . . . . . [8474-20]
SESSION 6 . . . . . . . . . . . . . . . . . . . . Mon. 10:30 am to 12:20 pm
Nonlinear Optical Devices and MechanismsSession Chair: Jean-Michel Nunzi, Queen’sUniv.(Canada)
Liquid photonics: a new platform for ultra-efficient nonlinear optics (Invited Paper),RobertA.Norwood,CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8474-21]
From universal properties to cascading: using sum rules for developing broad principles and phenomena,MarkG.Kuzyk,DavidS.Watkins,NathanJ.Dawson,JenniferL.Schei,BenjaminR.Anderson,WashingtonStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8474-22]
Universal scaling power-laws for the molecular optical response in the nonlinear regime,JavierPérez-Moreno,KatholiekeUniv.Leuven(Belgium);MarkG.Kuzyk,WashingtonStateUniv.(UnitedStates) . . . . . . . . . . . [8474-23]
Nonlinear optics of complex quantum graphs,RichardLytel,MarkG.Kuzyk,ShoreshShafei,WashingtonStateUniv.(UnitedStates). . . . . . . . . . . [8474-24]
Using geometry to enhance the nonlinear response of quantum confined systems,ShoreshShafei,MarkG.Kuzyk,WashingtonStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8474-25]
LunchBreak . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:20to2:00pm
SESSION 7 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 2:00 to 5:00 pm
Nanobiosystems and Optical Processes in Organic Materials and Nanostructures: Joint Session with
Conference 8464Session Chair: James G. Grote, AirForceResearchLab.(UnitedStates)
Nanophotonics technology and applications,YeshaiahuFainman,Univ.ofCalifornia,SanDiego(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . [8464-15]
Semiconductor nano photonics for bio sensing,ManijehRazeghi,NorthwesternUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . [8464-16]
TBD,KennethD.Singer,CaseWesternReserveUniv.(UnitedStates) [8464-17]
Towards hybrid nanoscale, nonlinear photonics: metals, semiconductors, and organics,JosephZyss,EcoleNormaleSupérieuredeCachan(France). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8464-18]
Tuesday 14 AugustSESSION 8 . . . . . . . . . . . . . . . . . . . . . . . . Tues. 8:30 to 10:20 am
Photorefractive Materials and ApplicationsSession Chair: Mark G. Kuzyk, WashingtonStateUniv.(UnitedStates)
Beam coupling in organic-inorganic photorefractive hybrid devices doped with ferroelectric nanoparticles (Invited Paper),DeanR.Evans,AirForceResearchLab.(UnitedStates);GaryCook,AirForceResearchLab.(UnitedStates)andAzimuthCorp.(UnitedStates);VictorY.Reshetnyak,NationalTarasShevchenkoUniv.ofKyiv(Ukraine) . . . . . . . . . . . . . . . . . . . . . . . . . . . [8474-26]
Digitalising nanoparticle-enabled polymeric photorefractivity for three-dimensional display,ChengmingyueLi,SwinburneUniv.ofTechnology(Australia)andTsinghuaUniv.(China);XiangpingLi,SwinburneUniv.ofTechnology(Australia);GuofanJin,TsinghuaUniv.(China);MinGu,SwinburneUniv.ofTechnology(Australia). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8474-27]
Real-time formation of dynamic hologram in photorefractive ferroelectric liquid crystals,TakeoSasaki,TokyoUniv.ofScience(Japan). . . . . . [8474-28]
Dynamic holographic images using polyvinylcarbazole-based photorefractive composites,KenjiKinashi,YuWang,AsatoNonomura,WataruSakai,NaotoTsutsumi,KyotoInstituteofTechnology(Japan) . . . . . . [8474-29]
Formation of photo-induced index grating in azo-carbazole dye-doped polymer,YutakaKawabe,KodaiFukuzawa,TakuyaUemura,Jun-ichiNishide,KatsufumiMatsuura,ToshioYoshikawa,HiroyukiSasabe,ChitoseInstituteofScienceandTechnology(Japan) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8474-30]
SESSION 9 . . . . . . . . . . . . . . . . . . . . Tues. 10:50 am to 12:20 pm
Polymer Materials for Optics and PhotonicsSession Chair: Rachel Jakubiak, AirForceResearchLab.(United
States)
Solution-processable molecular functional materials for organic optoelectronics (Invited Paper),XuhuiZhu,JunbiaoPeng,YongCao,SouthChinaUniv.ofTechnology(China) . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8474-31]
Solution-processable high-refractive index hybrid systems for micro-cavities and advanced photonic structures,NatalieStingelin-Stutzmann,ImperialCollegeLondon(UnitedKingdom) . . . . . . . . . . . . . . . . . . . . . [8474-32]
The importance of Forster transfer in the determination of the exciton mobility edge for organic polymers,RodrigoJ.Noriega-Manez,AlbertoSalleo,StanfordUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8474-33]
Studies of mechanisms of decay and recovery in organic dye-doped polymers using spatially-resolved white light interferometry,BenjaminR.Anderson,MarkG.Kuzyk,WashingtonStateUniv.(UnitedStates). . . [8474-34]
Wednesday 15 AugustOrganic Photonics + Electronics Plenary Session . . . . . . . . . . . . . . . . . . .Wed. 8:15 to 10:00 am
Session Chair:Zakya H. Kafafi, NationalScienceFoundation(USA)
8:15am:Announcement of the Organic Photonics + Electronics Best Student Paper Award Winner
8:30am:Liquid Crystal Lasers: From Concepts to Practical Realisation,HarryJ.Coles,Univ.ofCambridge(UnitedKingdom)
9:00am:The Role of Solution Processing in the Future of OLED TVs, MarieO’Regan,DuPontDisplays(USA)
9:30am:Plastic Solar Cells: Breaking the 10% Commercialization Barrier,YangYang,Univ.ofCalifornia,LosAngeles(USA)
Conference 8474
spie.org/opadvance · TEL:+13606763290 · help@spie.org 85
Posters-Wednesday . . . . . . . . . . . . . . . . . Wed. 5:30 to 7:30 pmConference attendees are invited to attend the poster session on Wednesday evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
Photorefractivity of triphenylamine polymers,ShoTsujimura,KenjiKinashi,WataruSakai,NaotoTsutsumi,KyotoInstituteofTechnology(Japan) [8474-35]
Photorefractive composite based on monolithic polymer,HaN.Giang,KenjiKinashi,WataruSakai,NaotoTsutsumi,KyotoInstituteofTechnology(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8474-36]
Bistable optical transmission properties of polyethylene-glycol,MitsunoriSaito,YoshihiroNishimura,RyukokuUniv.(Japan) . . . . . . . . . . . . . . . [8474-37]
Synthesis and optical properties of a crosslinkable polymer system containing TCF and TCP chromophores with excellent electro-optic activity and thermal stability,ZhuoChen,ShuhuiBo,ZhenZhen,XinhouLiu,TechnicalInstituteofPhysicsandChemistry(China). . . . . . . . . . . . . . . . . . . . . . [8474-38]
The synthesis of branched TCP chromophores and the research on their electro-optical properties,ShuhuiBo,ZhuoChen,XinhouLiu,ZhenZhen,TechnicalInstituteofPhysicsandChemistry(China). . . . . . . . . . . . . . [8474-39]
Photoisomerization of azobenzene moiety in crosslinking polymer materials,HuiWang,TechnicalInstituteofPhysicsandChemistry(China)andGraduateUniv.ofChineseAcademyofSciences(China);Wei-QiangChen,FengJin,Xian-ZiDong,Zhen-ShengZhao,Xuan-MingDuan,TechnicalInstituteofPhysicsandChemistry(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8474-40]
Laser direct writing nanolithography based on non-degenerate two-photon absorption,ShuChen,TechnicalInstituteofPhysicsandChemistry(China)andGraduateUniv.ofChineseAcademyofSciences(China);Mei-LingZheng,Zhen-ShengZhao,Xuan-MingDuan,TechnicalInstituteofPhysicsandChemistry(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8474-41]
Photo-reduction of silver ion by two-photon excitation using femtosecond laser,RyotaroNakamura,KenjiKinashi,WataruSakai,NaotoTsutsumi,KyotoInstituteofTechnology(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8474-42]
Potentially chargeable carbon black particles as electrophoretic ink,JooYeonKim,ChulAmKim,KyungSooSuh,ElectronicsandTelecommunicationsResearchInstitute(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . [8474-43]
Spectrophotometric study of the influence Rhodamine dyes on E. coli cells,EldarN.Kurtaliev,NegmatN.Nizomov,SamarkandStateUniv.(Uzbekistan);GayratKhodjayev,SamarkandAgricultureinstitute(Uzbekistan). . . . . [8474-44]
Preliminary study of the nonlinear optical properties of chlorophyll derivatives from spinach by mean of the diffraction pattern analysis,NormaMedina-Villalobos,Univ.deGuadalajara(Mexico)andInstitutoPolitecnicoNacional(Mexico);VirginiaMarañon-Ruiz,MiguelMora-González,JesusCastañeda-Contreras,Univ.deGuadalajara(Mexico);RogerChiu-Zarate,Univ.deGuadalajara(Mexico)andUniv.deDelaSalleBajio(Mexico). . . . . . [8474-45]
Polymer encapsulated titanium dioxide core-shell particles for an electrophoretic display by modified dispersion polymerization,ChulAmKim,JiyoungOh,ElectronicsandTelecommunicationsResearchInstitute(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8474-46]
The role of the polymer host on reversible photodegradation in Anthraquinone derivatives,Sheng-TingHung,WashingtonStateUniv.(UnitedStates)andKatholiekeUniv.Leuven(Belgium);ShivaK.Ramini,WashingtonStateUniv.(UnitedStates);KoenClays,KatholiekeUniv.Leuven(Belgium)andWashingtonStateUniv.(UnitedStates);MarkG.Kuzyk,WashingtonStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8474-47]
Testing the diffusion hypothesis as a candidate for reversible photodegradation in disperse orange 11 dye-doped PMMA thin films,ShivaK.Ramini,WashingtonStateUniv.(UnitedStates);NathanJ.Dawson,YoungstownStateUniv.(UnitedStates);BenjaminR.Anderson,MarkG.Kuzyk,WashingtonStateUniv.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . [8474-48]
Conference 8474
86 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Conference 8475Sunday-Wednesday 12-15 August 2012 • Proceedings of SPIE Vol. 8475
Liquid Crystals XVIConference Chair:Iam Choon Khoo, ThePennsylvaniaStateUniv.(UnitedStates)
Program Committee:Timothy J. Bunning, AirForceResearchLab.(UnitedStates);Shaw-Horng Chen, Univ.ofRochester(UnitedStates);Neil Collings, Univ.ofCambridge(UnitedKingdom);Jean-Pierre Huignard, Jphopto(France);Tomiki Ikeda, ChuoUniv.(Japan);Oleg D. Lavrentovich, KentStateUniv.(UnitedStates);Francesco Simoni, Univ.PolitecnicadelleMarche(Italy);David M. Walba, Univ.ofColoradoatBoulder(UnitedStates)
Sunday 12 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 8:15 to 10:00 am
Novel EO and NLO ProcessesSession Chair: Iam Choon Khoo, ThePennsylvaniaStateUniv.(United
States)
Novel electro-optical effects in negative dielectric polymer stabilized cholesteric liquid crystals (Invited Paper),TimothyJ.Bunning,ChristopherA.Bailey,MichaelE.McConney,AirForceResearchLab.(UnitedStates);Deng-keYang,KentStateUniv.(UnitedStates);LalgudiNatarajan,VincentTondiglia,TimothyJ.White,AirForceResearchLab.(UnitedStates) . . . . . . . . . [8475-01]
Cholesteric liquid crystals doped with gold nanoparticles: self-organization process and optical properties from the pure film to the nanocomposite material (Invited Paper),MichelMitov,Ctr.d’ElaborationdeMatériauxetd’EtudesStructurales(France);RajaaBitar,CNRS,NationalCtr.forScientificResearch(France)andCtr.d’ElaborationdeMatériauxetd’EtudesStructurales(France);GonzagueAgez,Univ.Paul-SabatierdeToulouse(France)andCtr.d’ElaborationdeMatériauxetd’EtudesStructurales(France). . . . . . . [8475-02]
Optically recorded tunable microlenses based on dye-doped liquid crystal cells,LianaLucchetti,Univ.PolitecnicadelleMarche(Italy) . . . . . . . . [8475-03]
Photochemical manipulation of microparticles on azobenzene-doped liquid-crystal films with homogeneous or homeotropic alignment structures (Invited Paper),TakahiroYamamoto,MasaruYoshida,NationalInstituteofAdvancedIndustrialScienceandTechnology(Japan). . . . . . . . . . . . . [8475-04]
UV durable colour pigment doped SmA liquid crystal composites for outdoor trans-reflective bi-stable displays,HuanXu,AnthonyB.Davey,WilliamA.Crossland,DapingChu,Univ.ofCambridge(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8475-05]
SESSION 2 . . . . . . . . . . . . . . . . . . . . . Sun. 10:30 am to 12:15 pm
Novel Liquid Crystals and Optical FluidsSession Chair: Timothy J. Bunning, AirForceResearchLab.(United
States)
Liquid crystals in optofluidics (Invited Paper),AndreasE.Vasdekis,JulienCuennet,DemetriPsaltis,EcolePolytechniqueFédéraledeLausanne(Switzerland) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8475-06]
Optimization of cloak effect in nanosphere dispersed liquid crystal metamaterial (Invited Paper),GrzegorzPawlik,AntoniC.Mitus,WroclawUniv.ofTechnology(Poland);WiktorWalasik,InstitutFresnel(France);IamChoonKhoo,ThePennsylvaniaStateUniv.(UnitedStates)............... [8475-07]
On the analysis of nanoparticle induced vertical alignment of liquid crystals,GuoqiangLi,TheOhioStateUniv.(UnitedStates). . . . . . . . . . . . . . . . [8475-08]
Singular orientational optical nonlinearities of liquid crystals (Invited Paper),EtienneBrasselet,MohamedElKetara,Univ.Bordeaux1(France). . . [8475-09]
Coupled system of photothermal driven liquid crystal elastomer photomechanical optical devices in a series configuration,NathanJ.Dawson,YoungstownStateUniv.(UnitedStates);MarkG.Kuzyk,WashingtonStateUniv.(UnitedStates);JeremyR.Neal,PaulLuchette,PeterPalffy-Muhoray,KentStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8475-10]
LunchBreak . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:15to1:45pm
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 1:45 to 3:25 pm
LC with Enhanced Material and Optical Properties ISession Chair: Kenneth L. Marshall, Univ.ofRochester(UnitedStates)
What roles do alkyl chains of mesogens play? (Invited Paper),KazuyaSaito,Univ.ofTsukuba(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8475-11]
Tailoring liquid crystals to become fast and efficient terahertz devices (Invited Paper),EmmaPickwell-MacPherson,HongKongUniv.ofScienceandTechnology(HongKong,China);EdwardParrott,TheChineseUniv.ofHongKong(HongKong,China);HongkyuPark,FanFan,VladimirChigrinov,HongKongUniv.ofScienceandTechnology(HongKong,China). . . . . . . . [8475-12]
Electronic functions of nanosegregated liquid crystals (Invited Paper),MasahiroFunahashi,KagawaUniv.(Japan). . . . . . . . . . . . . . . . . . . . . [8475-13]
Liquid-crystalline polymer holograms for high-density optical storage and photomechanical analysis (Invited Paper),AtsushiShishido,TokyoInstituteofTechnology(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8475-14]
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 3:55 to 5:50 pm
Novel Optical Switches, Modulators, and Dynamical Effects
Session Chair: Neil Collings, Univ.ofCambridge(UnitedKingdom)
Optical manifestation of thermal expansion of a nematic liquid crystal (Invited Paper),OlegD.Lavrentovich,Young-KiKim,BohdanI.Senyuk,KentStateUniv.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8475-15]
Recent studies of active liquid-crystal-plasmonics nanostructures (Invited Paper),YanhuiZhao,IamChoonKhoo,YiMa,TonyJunHuang,ThePennsylvaniaStateUniv.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . [8475-16]
Liquid crystals topological defects for singular photonics applications,EtienneBrasselet,CharlesLoussert,Univ.Bordeaux1(France). . . . . [8475-17]
Photoinduced motions and nonlinear optical properties of azobenzene-based materials (Invited Paper),ArriPriimagi,AaltoUniv.SchoolofScienceandTechnology(Finland)andTokyoInstituteofTechnology(Japan);AtsushiShishido,TokyoInstituteofTechnology(Japan) . . . . . . . . . . . . . . . . . [8475-18]
Optimization of nematic spatial light modulators for photo-activation of neurons (Invited Paper),MarcGuillon,INSERM,CNRS,Univ.ParisDescartes(France). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8475-19]
Symposium-Wide Plenary Session . . . . . . . . . . . . . . . . . . . . Sun. 6:00 to 7:25 pm6:00pm: Introduction and Opening Remarks
6:05pm: The Exciting Science of Light with Metamaterials, VladimirM.Shalaev,PurdueUniv.(USA)
6:45pm:Future of Optics and Photonics, BahaaE.A.Saleh,CREOL,TheCollegeofOpitcsandPhotonicsattheUniv.ofCentralFlorida(USA)
Monday 13 AugustSESSION 5 . . . . . . . . . . . . . . . . . . . . . . . . .Mon. 8:05 to 10:00 am
LC with Enhanced Material and Optical Properties IISession Chair: Iam Choon Khoo, ThePennsylvaniaStateUniv.(United
States)
Liquid crystal materials with close to 45-degree tilt angle (Invited Paper),EvaKorblova,MichiNakata,DongChen,RenfanShao,JosephE.Maclennan,MatthewA.Glaser,NoelA.Clark,DavidM.Walba,Univ.ofColoradoatBoulder(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8475-20]
spie.org/opadvance · TEL:+13606763290 · help@spie.org 87
Self-organized discotic liquid crystals derived from phthalocyanine-fullerene dyad (Invited Paper),KazuchikaOhta,TakahiroNakagaki,AyaIshikawa,EllySasaki,ShinshuUniv.(Japan) . . . . . . . . . . . . . . . . . . . . [8475-21]
In silico liquid crystals in the bulk and at interfaces (Invited Paper),ClaudioZannoni,Univ.degliStudidiBologna(Italy). . . . . . . . . . . . . . . . . . . . . [8475-22]
Cholesteric liquid crystals and photoalignment surfaces,JonathanVernon,AirForceResearchLab.(UnitedStates);SvetlanaSerak,UladzimirHrozhyk,BEAMEngineeringforAdvancedMeasurementsCo.(UnitedStates);VincentTondiglia,TimothyJ.White,AirForceResearchLab.(UnitedStates);NelsonV.Tabiryan,BEAMEngineeringforAdvancedMeasurementsCo.(UnitedStates);TimothyJ.Bunning,AirForceResearchLab.(UnitedStates) . . . . . . . [8475-23]
Enantiomeric anchoring of liquid crystals at surfaces presenting spontaneously formed monolayers of chiral adsorbates (Invited Paper),NicholasL.Abbott,Univ.ofWisconsin-Madison(UnitedStates). . . . . [8475-24]
SESSION 6 . . . . . . . . . . . . . . . . . . . . Mon. 10:30 am to 12:25 pm
Novel LCs and Optical Processes ISession Chair: Kenneth L. Marshall, Univ.ofRochester(UnitedStates)
Liquid crystal q-plates: classical and quantum photonic applications (Invited Paper),LorenzoMarrucci,Univ.degliStudidiNapoliFedericoII(Italy)[8475-25]
Liquid crystal gratings, from nematic to blue phase (Invited Paper),Yan-qingLu,WeiHu,NanjingUniv.(China);AbhishekSrivastava,VladimirChigrinov,HongKongUniv.ofScienceandTechnology(HongKong,China). . . . . . . . [8475-26]
Hysteresis of polymer stabilized blue phase liquid crystals (Invited Paper),Hung-ShanChen,Chun-HungWu,MichaelChen,Yi-HsinLin,NationalChiaoTungUniv.(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8475-27]
A polarization-independent liquid crystal phase modulation using polymer-network liquid crystals with orthogonal alignment layers,Ming-SyuanChen,Wei-ChihLin,Yu-ShihTsou,Yi-HsinLin,NationalChiaoTungUniv.(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8475-28]
Theory and simulation of cholesteric blue phases: effect of the elastic constants on the stability of blue phases and the response of a blue phase cell to an electric field (Invited Paper),Jun-ichiFukuda,NationalInstituteofAdvancedIndustrialScienceandTechnology(Japan). . . . . . . . . . . . . [8475-29]
LunchBreak . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:25to1:55pm
SESSION 7 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 1:55 to 3:35 pm
Novel LCs and Optical Processes IISession Chair: Timothy J. Bunning, AirForceResearchLab.(United
States)
Photo-aligned liquid crystal devices for high-peak-power laser applications (Invited Paper),KennethL.Marshall,MarisaVargas,AveryGnolek,MichaelStatt,ChristopheDorrer,Shaw-HorngChen,Univ.ofRochester(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8475-30]
Complex field-induced nematic defect structures in Laguerre-Gaussian optical tweezers (Invited Paper),SlobodanZumer,TinePorenta,Univ.ofLjubljana(Slovenia);MihaRavnik,Univ.ofOxford(UnitedKingdom). . [8475-31]
Broadband photosensitive response of nanocomposite liquid crystal structures (Invited Paper),MalgosiaKaczmarek,Univ.ofSouthampton(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8475-32]
Optodielectrophoretic hologram recording in hybrid liquid crystals devices (Invited Paper),AngelFuentes-Garcia,InstitutoNacionaldeAstrofísica,ÓpticayElectrónica(Mexico);MartinH.Vazquez-Nicolas,Univ.Veracruzana(Mexico);MariaC.Grados-Luyando,BeneméritaUniv.AutónomadePuebla(Mexico);PereRocaCabarrocas,EcolePolytechnique(France);RubénRamos-Garcia,InstitutoNacionaldeAstrofísica,ÓpticayElectrónica(Mexico). . . . . . [8475-33]
SESSION 8 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 4:05 to 5:25 pm
Novel Optical Switches, Emitters, ModulatorsSession Chair: Iam Choon Khoo, ThePennsylvaniaStateUniv.(United
States)
Design of a compact reconfigurable optical interconnect using a nematic liquid crystal spatial light modulator (Invited Paper),TianxinLu,BowenWang,BrianRobertson,NeilCollings,Univ.ofCambridge(UnitedKingdom) [8475-34]
Soft programmable interfaces for liquid crystals (Invited Paper),TigranV.Galstian,Univ.Laval(Canada) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8475-35]
Electromechanical tuning of negative dielectric anisotropy cholesteric liquid crystals,KyungMinLee,VincentTondiglia,LalgudiNatarajan,ChristopherA.Bailey,TimothyWhite,TimothyJ.Bunning,AirForceResearchLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8475-36]
Electrostatic V-shaped switching and optical latching in the SmAPf banana phase,DavidM.Walba,TaoGong,Univ.ofColoradoatBoulder(UnitedStates);AmaranathaReddy,PPGIndustries,Inc.(UnitedStates);EvaKorblova,RenfanShao,MatthewA.Glaser,JosephE.Maclennan,ChenhuiZhu,YongqiangShen,Univ.ofColoradoatBoulder(UnitedStates);EdgardoGarcia,Univ.deBrasilia(Brazil);NoelA.Clark,Univ.ofColoradoatBoulder(UnitedStates) . . [8475-37]
Wednesday 15 AugustOrganic Photonics + Electronics Plenary Session . . . . . . . . . . . . . . . . . . .Wed. 8:15 to 10:00 am
Session Chair:Zakya H. Kafafi, NationalScienceFoundation(USA)
8:15am:Announcement of the Organic Photonics + Electronics Best Student Paper Award Winner
8:30am:Liquid Crystal Lasers: From Concepts to Practical Realisation,HarryJ.Coles,Univ.ofCambridge(UnitedKingdom)
9:00am:The Role of Solution Processing in the Future of OLED TVs, MarieO’Regan,DuPontDisplays(USA)
9:30am:Plastic Solar Cells: Breaking the 10% Commercialization Barrier,YangYang,Univ.ofCalifornia,LosAngeles(USA)
Posters-Wednesday . . . . . . . . . . . . . . . . . Wed. 5:30 to 7:30 pmConference attendees are invited to attend the poster session on Wednesday evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
Mechanisms and dynamics of sub-microseconds and nanoseconds nonlinear optical responses of nematic liquid crystals,IamChoonKhoo,ShuoZhao,KuanLunHong,ThePennsylvaniaStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8475-38]
A fast-response liquid crystal display by the VA-IPS display mode with nematic liquid crystal and polymer networks,Tien-JungChen,NationalTaipeiUniv.ofTechnology(Taiwan);Guan-JhongLin,NationalTaiwanUniv.(Taiwan);Bo-YuChen,Jin-JeiWu,NationalTaipeiUniv.ofTechnology(Taiwan)[8475-39]
MEMS-based micro-optical switch for display device,Dong-SikShim,SamsungAdvancedInstituteofTechnology(Korea,Republicof). . . . [8475-40]
Novel cholesteric materials doped with CdSe/ZnS quantum dots with photo- and electro-tunable circularly polarized emission,AlexeyBobrovsky,LomonosovMoscowStateUniv.(RussianFederation);KonstantinE.Mochalov,VladimirA.Oleinikov,MoscowEngineeringPhysicsInstitute(RussianFederation);ValeryP.Shibaev,LomonosovMoscowStateUniv.(RussianFederation);MikhailV.Artemyev,MoscowEngineeringPhysicsInstitute(RussianFederation);IgorR.Nabiev,TrinityCollegeDublin(Ireland). . . . . . . . . [8475-41]
A concentration photovoltaic system adopting a liquid crystal light modulation,Yu-ShihTsou,Yi-HsinLin,NationalChiaoTungUniv.(Taiwan);An-ChiWei,PowerLensTechnologyInc.(Taiwan) . . . . . . . . . . . . . . . . . . [8475-42]
Photomechanical mechanism in the generation of photomechanical behavior of the polydomain azobenzene liquid crystal polymer networks,KyungMinLee,AirForceResearchLab.(UnitedStates);NelsonV.Tabiryan,BeamEngineeringforAdvancedMeasurementsCo.(UnitedStates);TimothyJ.Bunning,TimothyJ.White,AirForceResearchLab.(UnitedStates). . [8475-43]
Nano-dimensional short pitch ferroelectric liquid crystal materials and devices with improved performance,HadarReisman,Ben-GurionUniv.oftheNegev(Israel);EvgenyP.Pozhidaev,SofiaI.Torgova,P.N.LebedevPhysicalInstitute(RussianFederation);IbrahimAbdulhalim,Ben-GurionUniv.oftheNegev(Israel). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8475-44]
Spectral investigation of chiral photonic structure with laser dye-doped isotropic polymer film,RomanB.Alaverdyan,TigranDadalyan,AsyaS.Karapetyan,YerevanStateUniv.(Armenia) . . . . . . . . . . . . . . . . . . . . . [8475-45]
Conference 8475
88 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Conference 8476Sunday-Wednesday 12-15 August 2012 • Proceedings of SPIE Vol. 8476
Organic Light Emitting Materials and Devices XVIConference Chair:Franky So, Univ.ofFlorida(UnitedStates)Conference Co-Chair:Chihaya Adachi, KyushuUniv.(Japan)
Program Committee:Andrew B. Holmes, Bio21MolecularScienceandBiotechnologyInstitute(Australia);Hisao Ishii, ChibaUniv.(Japan);Hironori Kaji, KyotoUniv.(Japan);Jang-Joo Kim, SeoulNationalUniv.(Korea,Republicof);Jaewon Lee, LGDisplay(Korea,Republicof);Mathew K. Mathai, Plextronics,Inc.(UnitedStates);Jongwook Park, TheCatholicUniv.ofKorea(Korea,Republicof);Yong-Jin Pu, YamagataUniv.(Japan);Ifor D. W. Samuel, Univ.ofSt.Andrews(UnitedKingdom);Joseph Shinar, AmesLab.(UnitedStates);Richard J. Wilson, CambridgeDisplayTechnologyLtd.(UnitedKingdom);Takeshi Yamada, SumitomoChemicalCo.,Ltd.(Japan)
Sunday 12 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 8:30 to 11:50 am
MaterialsSession Chairs: Chihaya Adachi, KyushuUniv.(Japan);Sunghun Lee,
SeoulNationalUniv.(Korea,Republicof)
Extremely high-efficiency multiphoton emission blue phosphorescent OLEDs with external quantum efficiency exceeding 40% (Invited Paper),HisahiroSasabe,KazuhiroMinamoto,Yong-JinPu,MasakatsuHirasawa,JunjiKido,YamagataUniv.(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8476-01]
The development of poly(dendrimers) for OLEDs (Invited Paper),PaulL.Burn,TheUniv.ofQueensland(Australia);IforD.W.Samuel,Univ.ofSt.Andrews(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8476-02]
Highly efficient new emitting materials based on core-side concepts for blue fluorescence OLEDs (Invited Paper),BeomjinKim,YoungilPark,TheCatholicUniv.ofKorea(Korea,Republicof);DaisukeYokoyama,YamagataUniv.(Japan);HyeMoonLee,KoreaInstituteofMaterialsScience(Korea,Republicof);JongwookPark,TheCatholicUniv.ofKorea(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8476-03]
Water-soluble iridium phosphorescent complexes for OLED applications (Invited Paper),Min-SikEum,TaeHyungKim,DoosanHeavyIndustries&ConstructionCo.,Ltd.(Korea,Republicof) . . . . . . . . . . . . . . . . . . . . . [8476-04]
Efficient electrophosphorescent hosts for printable OLEDs,HyeyeonYang,WonjaeJoo,JhunmoSon,YongsikJung,HosukKang,HyeonhoChoi,In-TaekHan,YonghwanKim,SAMSUNGElectronicsCo.,Ltd.,SamsungAdvancedInstituteofTechnology(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . [8476-05]
Functional group orientation in amorphous films of OLED materials (Invited Paper),DaisukeYokoyama,YamagataUniv.(Japan);KoichiTsutsumi,MichioSuzuki,J.A.WoollamJapanCo.(Japan);NorimasaYokoyama,HodogayaChemicalCo.(Japan);MasayaMiyamura,YukioFurukawa,WasedaUniv.(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8476-06]
Solution processable hole injection layers (HILs) as a viable alternative to vapor analogs (Invited Paper),VenkataramananSeshadri,NeetuChopra,ChristineMcGuiness,MathewK.Mathai,ChristopherT.Brown,BrianWoodworth,RobertSwisher,Plextronics,Inc.(UnitedStates). . . . . . . [8476-07]
Design of charge transport molecules for organic light emitting devices (Invited Paper),AsangaB.Padmaperuma,JamesS.Swensen,EvgueniPolikarpov,LeliaCosimbescu,PacificNorthwestNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8476-08]
Highly efficient yellow organic light emitting diode with a solution-processed emissive layer,Wei-BenWang,Cheng-IChiang,Yung-ChengJou,Shih-MingShen,Jwo-HueiJou,NationalTsingHuaUniv.(Taiwan) . . [8476-09]
LunchBreak . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11:50amto1:20pm
SESSION 2 . . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 1:20 to 5:45 pm
Device PhysicsSession Chairs: Bernard Kippelen, GeorgiaInstituteofTechnology
(UnitedStates);Asanga B. Padmaperuma, PacificNorthwestNationalLab.(UnitedStates)
Recent advances in materials and device architectures for OLED technologies (Invited Paper),BernardKippelen,WojciechHaske,DenkeCai,KeithA.Knauer,EhsanM.Najafabadi,CanekFuentes-Hernandez,CarlosZuniga,SeyhanSalman,ChristopherSutton,YadongZhang,XuyangHe,StephenBarlow,JohnS.Sears,VeaceslavCoropceanu,Jean-LucBredas,SethR.Marder,GeorgiaInstituteofTechnology(UnitedStates). . . . . . . . . [8476-10]
Role of the cathode interfacial layers in improving the stability of organic optoelectronic devices (Invited Paper),QiWang,HanyAziz,Univ.ofWaterloo(Canada) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8476-11]
Interface designs for organic light emitting diodes (Invited Paper),ZhibinWang,MichaelG.Helander,JackyQiu,YiluChang,ZhenghongLu,Univ.ofToronto(Canada). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8476-12]
Investigation of aggregated structures in organic light emitting diodes: approach from solid state NMR (Invited Paper),HironoriKaji,KyotoUniv.(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8476-13]
Inverted OLEDs for flexible displays (Invited Paper),Jang-JooKim,SeoulNationalUniv.(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . [8476-78]
Effect of residual gases in high vacuum on the energy-level alignment at electrode/organic interfaces,MichaelG.Helander,ZhibinWang,JackyQiu,ZhenghongLu,Univ.ofToronto(Canada) . . . . . . . . . . . . . . . . . . . . . . [8476-15]
Energy transfer and excitation migration in organic semiconductors (Invited Paper),PaulA.Lane,MasonA.Wolak,PaulD.Cunningham,JosephS.Melinger,U.S.NavalResearchLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . [8476-16]
Efficient, single-layer organic light emitting devices based on a continuously graded emissive layer (Invited Paper),RussellJ.Holmes,Univ.ofMinnesota,TwinCities(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . [8476-17]
Blue-emissive polymer light emitting diodes through anode/cathode interfacial modification,Ming-WeiLin,NationalChengKungUniv.(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8476-18]
High-efficiency hybrid white organic light emitting diodes using fluorescent and phosphorescent dopants with interlayers,You-HyunKim,HoseoUniv.(Korea,Republicof);BoMiLee,McMasterUniv.(Canada);HyeongHwaYu,ChulGyuJhun,ChangBumMoon,HoseoUniv.(Korea,Republicof);PeterMascher,McMasterUniv.(Canada);WooYoungKim,HoseoUniv.(Korea,Republicof)andMcMasterUniv.(Canada) . . . . . . . . . . . . . . . . . . . . . [8476-19]
Effect of horizontal molecular orientation on triplet-exciton diffusion in amorphous organic films,TomoakiSawabe,IsaoTakasu,ToshiyaYonehara,ToshibaCorp.(Japan);TomioOno,ToshibaCorp(Japan);JiroYoshida,ShintaroEnomoto,IsaoAmemiya,ToshibaCorp.(Japan);ChihayaAdachi,KyushuUniv.(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8476-20]
Functional limitation of LiF/Al bilayer cathode for use in OLEDs,Dong-YingZhou,Chun-HongGao,Xiao-BoShi,Zhi-MingJin,Liang-ShengLiao,SoochowUniv.(China) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8476-21]
Influence of solvent choice on conjugated polymer morphology in solution and in spin-cast and contact printed films (Invited Paper),AlasdairJ.Campbell,AlexanderGuite,ImperialCollegeLondon(UnitedKingdom);DetlefM.Smilgies,CornellUniv.(UnitedStates);StevenTierney,MerckChemicalsLtd.(UnitedKingdom);JoachimSteinke,ImperialCollegeLondon(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8476-22]
Symposium-Wide Plenary Session . . . . . . . . . . . . . . . . . . . . Sun. 6:00 to 7:25 pm6:00pm: Introduction and Opening Remarks
6:05pm: The Exciting Science of Light with Metamaterials, VladimirM.Shalaev,PurdueUniv.(USA)
6:45pm:Future of Optics and Photonics, BahaaE.A.Saleh,CREOL,TheCollegeofOpitcsandPhotonicsattheUniv.ofCentralFlorida(USA)
spie.org/opadvance · TEL:+13606763290 · help@spie.org 89
Monday 13 AugustSESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . .Mon. 8:15 to 10:05 am
Light ExtractionSession Chairs: Jong-Lam Lee, PohangUniv.ofScienceand
Technology(Korea,Republicof);Graham A. Turnbull, Univ.ofSt.Andrews(UnitedKingdom)
Recent advances in OLED performance: efficient solution-processed small molecule OLEDs, efficient ITO-free OLEDs, and advances in light extraction (Invited Paper),MinCai,RuiLiu,ZhuoYe,Kai-MingHo,RuthShinar,JosephShinar,IowaStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . [8476-23]
Optimization of light extraction from flexible white polymer-based OLEDs (Invited Paper),StephanHarkema,HolstCtr.(Netherlands);DuncanMacKerron,KariPekka-Inno,MarkHodgson,DuPontTeijinFilmsU.K.Ltd.(UnitedKingdom);DorotheeHermes,LeoToonen,RaghuKishoroPendyala,JoanneWilson,TonvanMol,HolstCtr.(Netherlands) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8476-24]
OLED light extraction enhancement with transparent microlens arrays (Invited Paper),JiangengXue,EdwardWrzesniewskiIII,Sang-HyunEom,WeiranCao,WilliamT.Hammond,Univ.ofFlorida(UnitedStates). . . . . . . . . [8476-25]
Challenges and status of out-coupling in OLED display (Invited Paper),JaewonLee,Se-JunKim,JungsikJo,So-YoungJo,Eeon-AKim,Sung-BinSim,Jong-GeonYoon,Soo-YoungYoon,LGDisplay(Korea,Republicof). [8476-26]
Compatibility of micro lens film and circular polarizer on bottom-emitting OLED display,JungsikJo,JaewonLee,So-YoungJo,Jong-GeonYoon,Soo-YoungYoon,LGDisplay(Korea,Republicof) . . . . . . . . . . . . . . . . . . . [8476-27]
Light extraction from buckled OLEDs by lithography-free and imprinting-free process,WonhoeKoo,YinZhe,FrankySo,Univ.ofFlorida(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8476-28]
SESSION 4 . . . . . . . . . . . . . . . . . . . . Mon. 10:35 am to 12:15 pm
Transparent ElectrodeSession Chairs: Jong-Lam Lee, PohangUniv.ofScienceand
Technology(Korea,Republicof);Graham A. Turnbull, Univ.ofSt.Andrews(UnitedKingdom)
Transparent composite electrode for high-efficiency polymer LEDs (Invited Paper),QibingPei,Univ.ofCalifornia,LosAngeles(UnitedStates). . . [8476-29]
Large area organic light emitting diodes with multilayered graphene anodes (Invited Paper),JaehyunMoon,JoohyunHwang,ElectronicsandTelecommunicationsResearchInstitute(Korea,Republicof);HongKywChoi,Univ.ofScience&Technology(Korea,Republicof);TaekyongKim,Sung-YoolChoi,KAIST(Korea,Republicof);Jun-HanHan,Jin-WookShin,ChulWoongJoo,Doo-HeeCho,JinWooHuh,HyeYongChu,Jeong-IkLee,ElectronicsandTelecommunicationsResearchInstitute(Korea,Republicof) . . . . . . . [8476-30]
Flexible organic light emitting diodes using graphene electrodes (Invited Paper),Tae-HeeHan,PohangUniv.ofScienceandTechnology(Korea,Republicof);YoungbinLee,SungkyunkwanUniv.(Korea,Republicof);Mi-RiChoi,Seong-HoonWoo,PohangUniv.ofScienceandTechnology(Korea,Republicof);SanghoonBae,SungkyunkwanUniv.(Korea,Republicof);ByungHeeHong,SeoulNationalUniv.(Korea,Republicof);Jong-HyunAhn,SungkyunkwanUniv.(Korea,Republicof);Tae-WooLee,PohangUniv.ofScienceandTechnology(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8476-31]
Transparent electrode engineering: application to white OLEDs (Invited Paper),SeunghyupYoo,Tae-WookKoh,HyunsuCho,Jung-MinChoi,JinChung,EunhyeKim,KAIST(Korea,Republicof) . . . . . . . . . . . . . . . . . [8476-32]
Transparent electrodes for plastic electronics (Invited Paper),JohnC.deMello,ImperialCollegeLondon(UnitedKingdom). . . . . . . . . . . . . . . . [8476-33]
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:15to1:45pm
SESSION 5 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 1:45 to 3:30 pm
Lasers and Novel DevicesSession Chairs: Qibing Pei, Univ.ofCalifornia,LosAngeles(United
States);John C. de Mello, ImperialCollegeLondon(UnitedKingdom)
Solution processed polymer light emitting diodes with single layer graphene anode,JaeheungHa,YongtaekHong,SubeomPark,DonghyunKim,SeoulNationalUniv.(Korea,Republicof);JaechulRyu,SungkyunkwanUniv.(Korea,Republicof);ChangheeLee,ByungHeeHong,SeoulNationalUniv.(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8476-34]
Investigation of the influence of laser radiation on material properties of transparent conductive layers,MoritzSchaefer,MalteA.Schulz-Ruhtenberg,AlexanderEsser,JensHoltkamp,ArnoldGillner,Fraunhofer-InstitutfürLasertechnik(Germany)..................................... [8476-35]
Triplet management in continuous-wave organic semiconductor lasers (Invited Paper),YifanZhang,StephenR.Forrest,Univ.ofMichigan(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8476-36]
Nanoimprinted polymer lasers pumped by light emitting diodes (Invited Paper),GrahamA.Turnbull,YueWang,GeorgiosTsiminis,AlexanderKanibolotsky,PeterJ.Skabara,IforD.W.Samuel,Univ.ofSt.Andrews(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8476-37]
Electrically-pumped organic laser device with a coupled microcavity structure,XingyuanLiu,JieLin,YantaoLi,SongnanQu,ChangchunInstituteofOptics,FineMechanicsandPhysics(China) . . . . . . . . . . . . . . . . . . . . [8476-38]
Tunable organic semiconductor lasers for sensing applications (Invited Paper),UliLemmer,SönkeKlinkhammer,XinLiu,TimoMappes,ChristophVannahme,KarlsruherInstitutfürTechnologie(Germany). . . . . . . . . . [8476-39]
SESSION 6 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 4:00 to 5:35 pm
Novel DevicesSession Chairs: Qibing Pei, Univ.ofCalifornia,LosAngeles(United
States);John C. de Mello, ImperialCollegeLondon(UnitedKingdom)
Metal substrates with nanometer scale surface roughness for flexible electronics (Invited Paper),Jong-LamLee,KisooKim,PohangUniv.ofScienceandTechnology(Korea,Republicof) . . . . . . . . . . . . . . . . . . . . . . . . . . [8476-40]
Strongly modified angular dependence of emission from OLEDs (Invited Paper),ShuyuZhang,GrahamA.Turnbull,IforD.W.Samuel,Univ.ofSt.Andrews(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8476-41]
Methods to protect and recover work function of air exposed transition metal oxide thin films (Invited Paper),IrfanIrfan,ChenggongWang,Univ.ofRochester(UnitedStates);AlexanderJ.Turinske,Univ.ofWisconsin-Oshkosh(UnitedStates);YongliGao,Univ.ofRochester(UnitedStates)andCentralSouthUniv.(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8476-42]
In situ photoluminescence spectroscopy study of dynamic doping in sandwich-type light emitting electrochemical cells (Invited Paper),SebastianB.Meier,DavidHartmann,WiebkeSarfert,SiemensAG(Germany);DanielTordera,HenkJ.Bolink,Univ.deValència(Spain);AlbrechtWinnacker,Friedrich-Alexander-Univ.Erlangen-Nürnberg(Germany) . . . . . . . . . . [8476-43]
Organic light emitting diodes employing efficient reverse intersystem crossing for triplet to singlet state conversion, ChihayaAdachi,KyushuUniv.(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8476-77]
Conference 8476
90 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Tuesday 14 AugustOLEDs and Solid State Lighting Plenary Session . . . . . . . . . . . . . . . . . . Tues. 8:30 to 10:00 am
Session Chairs: Franky So, Univ.ofFlorida(UnitedStates);Matthew H. Kane, MassachusettsMaritimeAcademy(UnitedStates)
Development of charge generation layers for multiphoton emission OLED,JunjiKido,HisahiroSasabe,Yong-JinPu,YamagataUniv.(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8476-101]
LED development with nanostructures and nanophotonics,Chih-ChungYang,NationalTaiwanUniv.(Taiwan) . . . . . . . . . . . . . . . . . . . . . . [8484-102]
SESSION 7 . . . . . . . . . . . . . . . . . . . . Tues. 10:30 am to 12:30 pm
Solid State Lighting and OLEDs: Joint Session with Conference 8484
Session Chairs: Ian T. Ferguson, TheUniv.ofNorthCarolinaatCharlotte(UnitedStates);Juergen Kreis, AIXTRONSE(Germany)
OLED-based physiologically-friendly very low-color temperature illumination for night (Invited Paper),Jwo-HueiJou,Shih-MingShen,Ming-ChunTang,Pin-ChuChen,Chun-YuHsieh,Chin-ChiaoLin,NationalTsingHuaUniv.(Taiwan);Szu-HaoChen,Yi-ShanWang,Chien-ChihChen,Ching-ChunWang,IndustrialTechnologyResearchInstitute(Taiwan);Chien-TienChen,NationalTsingHuaUniv.(Taiwan)............................. [8476-44]
White light quality of phosphor converted LEDs from a phosphor materials perspective of view: an evaluation based on combined thermal and optical simulations (Invited Paper),Franz-PeterWenzl,ChristianSommer,JOANNEUMRESEARCHForschungsgesellschaftmbH(Austria);PeterPachler,HansHoschopf,TridonicAtcoOptoelectronicsGmbH(Austria);GregorLanger,AustriaTechnologie&SystemtechnikAG(Austria);PaulFulmek,JohannNicolics,TechnischeUniv.Wien(Austria);PaulHartmann,JOANNEUMRESEARCHForschungsgesellschaftmbH(Austria). . . . . . . . . . . . . . . . . . . . . . . . . [8484-01]
Towards high-efficiency solution processed WOLEDs for lighting applications (Invited Paper),JonathanF.Maunoury,EnricoOrselli,DominiqueBascour,OlivierGaudin,Jean-PierreCatinat,SolvayS.A.(Belgium);NeetuChopra,JingWang,SergeiLi,EliScott,VenkataramananSeshadri,ChristopheGrenier,ChristopherT.Brown,MathewK.Mathai,Plextronics,Inc.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8476-45]
Crack-free GaN deposition on Si substrate with temperature-graded AlN buffer growth and the emission characteristics of overgrown InGaN/GaN quantum wells (Invited Paper),Chih-YenChen,Wen-MingChang,Wei-LunChung,Yen-HungLiu,ChiehHsieh,Che-HaoLiao,Shao-YingTing,Yean-WoeiKiang,Chih-ChungYang,NationalTaiwanUniv.(Taiwan). . . . . . . . . . [8484-02]
Lunch/Exhibition Break.............................. 12:30to2:00pm
SESSION 8 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 2:00 to 3:00 pm
SSLSession Chairs: Jian Li, ArizonaStateUniv.(UnitedStates);Russell J.
Holmes, Univ.ofMinnesota,TwinCities(UnitedStates)
Novel design for high-production-yield and high-efficacy large-area OLED lighting panels (Invited Paper),Chieh-WeiChen,Chen-ChiLin,Yuan-ChenChin,Chung-ChiaChen,Meng-TingLee,Meng-HuanHo,Ting-YiCho,AUOptronicsCorp.(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8476-46]
Large-area high-efficiency flexible PHOLED lighting panels (Invited Paper),HuiqingPang,PrashantMandlik,PeterA.Levermore,RuiqingMa,MichaelG.Hack,JulieJ.Brown,UniversalDisplayCorp.(UnitedStates). . . . . . . [8476-47]
High-efficiency white organic light emitting device using a single emitter (Invited Paper),JianLi,ArizonaStateUniv.(UnitedStates). . . . . . . . . [8476-48]
SESSION 9 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 3:30 to 4:50 pm
CharacterizationSession Chairs: Jian Li, ArizonaStateUniv.(UnitedStates);Russell J.
Holmes, Univ.ofMinnesota,TwinCities(UnitedStates)
In situ measurement of displacement current measurement and ultraviolet photoelectron spectroscopy to examine carrier injection property of organic-electrode interface (Invited Paper),HisaoIshii,TaikiYamada,ChibaUniv.(Japan);YukioOuchi,NagoyaUniv.(Japan);YasuoNakayama,YutakaNoguchi,ChibaUniv.(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8476-49]
Use of delayed electroluminescence as a tool to investigate the emission mechanism of phosphorescent organic light emitting devices,HosseinZamaniSiboni,DandanSong,HanyAziz,Univ.ofWaterloo(Canada) [8476-50]
Modelling of hole transport in a small-molecule organic material assuming carrier heating in a Gaussian density of states,ChristophZimmermann,MaximilianSlawinski,RWTHAachen(Germany);ManuelBösing,DietrichBertram,PhilipsTechnologieGmbH(Germany);PeterLöbl,PhilipsResearch(Germany);MichaelHeuken,AIXTRONSE(Germany);HolgerKalisch,AndreiVescan,RWTHAachen(Germany). . . . . . . . . . . . . . . . . . . . . . . . . . . . [8476-51]
Characterization of charge carrier injection in organic and hybrid organic/inorganic semiconductor devices by capacitance-voltage measurements,MartinWeingarten,MaximilianSlawinski,FelixUrbain,DirkFahle,RWTHAachen(Germany);DietrichBertram,PhilipsTechnologieGmbH(Germany);MichaelHeuken,AIXTRONSE(Germany);HolgerKalisch,AndreiVescan,RWTHAachen(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8476-52]
Quantification of charge carrier density in organic light emitting diodes by time-resolved electroluminescence,CarolineWeichsel,TechnischeUniv.Dresden(Germany);SebastianReineke,TechnischeUniv.Dresden(Germany)andMassachusettsInstituteofTechnology(UnitedStates);MalteC.Gather,KarlLeo,BjörnLüssem,TechnischeUniv.Dresden(Germany). . . . . . . . . . [8476-53]
SESSION 10 . . . . . . . . . . . . . . . . . . . . . . . . Tues. 4:50 to 6:05 pm
Device FabricationSession Chairs: Jian Li, ArizonaStateUniv.(UnitedStates);Russell J.
Holmes, Univ.ofMinnesota,TwinCities(UnitedStates)
Extraction of internal emission characteristics from printed OLEDs (Invited Paper),MarkL.Hildner,JonathanM.Ziebarth,DuPontDisplays(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8476-54]
Highly-efficient organic light emitting diodes based on solution/evaporation hybrid process (Invited Paper),Jung-YuLiao,Teng-ChihChao,Jin-ShengLin,Mei-RurngTseng,IndustrialTechnologyResearchInstitute(Taiwan). [8476-55]
Organic Vapor Phase Deposition (OVPD) for efficient OLED manufacturing: the specific advantages and possibilities of carrier-gas enhanced vapor phase deposition for the manufacturing of organic thin film devices (Invited Paper),JuergenKreis,MarkusSchwambera,DietmarKeiper,MarkusGersdorff,MichaelLong,MichaelHeuken,AIXTRONSE(Germany). . . . . . . . . . . [8476-56]
Vacuum deposition of OLEDs with feature sizes ≤ 20 μm using a contact shadow mask patterned in situ by laser ablation,YoshitakaKajiyama,Univ.ofWaterloo(Canada)andV-TechnologyCo.,Ltd.(Japan);KoichiKajiyama,ShujiKudo,V-TechnologyCo.,Ltd.(Japan);HanyAziz,Univ.ofWaterloo(Canada) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8476-57]
Wednesday 15 AugustOrganic Photonics + Electronics Plenary Session . . . . . . . . . . . . . . . . . . .Wed. 8:15 to 10:00 am
Session Chair:Zakya H. Kafafi, NationalScienceFoundation(USA)
8:15am:Announcement of the Organic Photonics + Electronics Best Student Paper Award Winner
8:30am:Liquid Crystal Lasers: From Concepts to Practical Realisation,HarryJ.Coles,Univ.ofCambridge(UnitedKingdom)
9:00am:The Role of Solution Processing in the Future of OLED TVs, MarieO’Regan,DuPontDisplays(USA)
9:30am:Plastic Solar Cells: Breaking the 10% Commercialization Barrier,YangYang,Univ.ofCalifornia,LosAngeles(USA)
Conference 8476
spie.org/opadvance · TEL:+13606763290 · help@spie.org 91
Posters-Wednesday . . . . . . . . . . . . . . . . . Wed. 5:30 to 7:30 pmConference attendees are invited to attend the poster session on Wednesday evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
The mechanism of charge generation in charge generation units containing HATCN for high-luminance tandem OLED display,SunghunLee,Jeong-HwanLee,Jae-HyunLee,Jang-JooKim,SeoulNationalUniv.(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8476-14]
Host materials for blue phosphorescent OLEDs,DanielWagner,MichaelRothmann,PeterStrohriegl,Univ.Bayreuth(Germany);ChristianLennartz,GerhardG.Wagenblast,BASFSE(Germany) . . . . . . . . . . . . . . . . . . . [8476-58]
Mechanical study of the enhanced electron injection via using a Bphen interlayer at Alq 3/Cs 2CO 3 interface,JiarongLian,ChangxiaoPan,ShuanglongLiu,ShenxunSu,RuiyouLiu,PengjuZeng,ShenzhenUniv.(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8476-59]
Boosting the performance of red PHOLEDs by exciton harvesting,Yi-LuChang,ZhibinWang,MichaelG.Helander,JackyQiu,ZhenghongLu,Univ.ofToronto(Canada). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8476-60]
An organic p-n junction for electrode-independent electron injection layer in organic light emitting diodes,Jeong-HwanLee,JiWhanKim,Sei-YongKim,Seung-JunYoo,Jae-HyunLee,Jang-JooKim,SeoulNationalUniv.(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8476-61]
High-efficiency non-blocking phosphorescent organic light emitting diode with ultrathin emission layer,JackyQiu,MichaelG.Helander,ZhibinWang,Yi-LuChang,ZhenghongLu,Univ.ofToronto(Canada). . . . . . . . . . . [8476-62]
Using the isolation layer between fluorescent and phosphor light emission layer to produce white organic light emission diode with high thermal stability,Fuh-ShyangJuang,Yun-JrLai,HoangTuanVu,Lin-AnnHong,Yu-ShengTsai,NationalFormosaUniv.(Taiwan);Pei-HsunYeh,RaystarOptronicsInc.(Taiwan) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8476-63]
Using an embedded nanocomposite scattering film for increasing out-coupling of white phosphorescent organic light emitting devices,Chih-HaoChang,Chin-YaoShin,Kuo-YanChang,Yu-JhongLo,Shu-JingChang,Tzu-FangChang,YuanZeUniv.(Taiwan);Hsin-HuaChang,VanungUniv.(Taiwan) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8476-64]
Enhancement of white light OLED efficiency by combining both internal and external light extraction structures,Ding-ZhengLin,I-LingKao,Chun-NengKu,Yi-PingChen,IndustrialTechnologyResearchInstitute(Taiwan) . [8476-65]
Light extraction from OLEDS by defective hexagonal-close-packed silica array,WonhoeKoo,WooramYoun,Univ.ofFlorida(UnitedStates);XiaohangLi,NelsonTansu,LehighUniv.(UnitedStates);FrankySo,Univ.ofFlorida(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8476-66]
Sol-gel deposited gallium-doped zinc oxide electrode for polymer light emitting diode applications,DonghyunKim,JaeheungHa,YongtaekHong,SeoulNationalUniv.(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . [8476-67]
High-efficiency green electrophosphorescent organic light emitting diodes with simple device structure,Shun-WeiLiu,MingChiUniv.ofTechnology(Taiwan);Chih-HsienYuan,Chih-ChienLee,NationalTaiwanUniv.ofScienceandTechnology(Taiwan) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8476-68]
Wavelength fine-tuning of photonic crystal laser on a flexible substrate,Min-HsiungShih,AcademiaSinica(Taiwan). . . . . . . . . . . . . . . . . . . . . [8476-69]
Optical configuration of the encapsulation layer with the organic and inorganic multilayer structure for top emitting organic light emitting diodes,YongZhang,GunBea,ChangBumMoon,WooYoungKim,ChulGyuJhun,HoseoUniv.(Korea,Republicof) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8476-70]
Highly efficient solution-processed cadmium-free violet emitting quantum dots light emitting diodes,ChaoyuXiang,SongChen,Univ.ofFlorida(UnitedStates);XiongLiu,XiangxingKong,YunjunWang,MesolightLLC(UnitedStates);FrankySo,Univ.ofFlorida(UnitedStates). . . . . . . . . . . . . . . . . . . . . . [8476-71]
Conference 8476Advanced plasma technology for large scale PECVD processes,JensLandrock,MichaelZeuner,MatthiasNestler,DirkRost,Roth&RauMicroSystemsGmbH(Germany).............................. [8476-72]
In situ lifetime testing of organic light emitting diodes,ColinW.Merkel,MichaelG.Helander,JackyQiu,ZhenghongLu,Univ.ofToronto(Canada) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8476-73]
Reduced excimer formation in polyfluorenes by introducing coil-like poly[penta(ethylene glycol) methyl ether methacrylate] block segments,YongKuKwon,MinGyunSuk,SungIkHeo,JinYoungHan,SeungJuNoh,SunJinJin,SeHyunJang,InhaUniv.(Korea,Republicof). . . . . . . . . . . . . [8476-74]
Transient thermal analysis of white organic light emitting diode for heat-dissipation application,HenglongYang,NationalTaipeiUniv.ofTechnology(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8476-75]
Microwave-assisted synthesis of nanocrystalline TiO 2 for dye-sensitized solar cells,Ta-ChuanKuo,NationalChengKungUniv.(Taiwan). . . . [8476-76]
92 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Conference 8477Tuesday-Thursday 14-16 August 2012 • Proceedings of SPIE Vol. 8477
Organic Photovoltaics XIIIConference Chair:Zakya H. Kafafi, NationalScienceFoundation(UnitedStates)
Conference Co-Chairs:Christoph J. Brabec, Friedrich-Alexander-Univ.Erlangen-Nürnberg(Germany);Paul A. Lane, U.S.NavalResearchLab.(UnitedStates)
Program Committee:Paul L. Burn, TheUniv.ofQueensland(Australia);Katsuhiko Fujita, KyushuUniv.(Japan);René A. J. Janssen, TechnischeUniv.Eindhoven(Netherlands);Bernard Kippelen, GeorgiaInstituteofTechnology(UnitedStates);Barry P. Rand, IMEC(Belgium);Ifor D. W. Samuel, Univ.ofSt.Andrews(UnitedKingdom);Sean E. Shaheen, Univ.ofDenver(UnitedStates);Jiangeng Xue, Univ.ofFlorida(UnitedStates);Yang Yang, Univ.ofCalifornia,LosAngeles(UnitedStates);Teketel Yohannes, AddisAbabaUniv.(Ethiopia)
Monday 13 AugustSolar Energy Plenary Session . . . . . . . . Mon. 1:30 to 5:00 pm
SessionChair: Martha Symko-Davies,NationalRenewableEnergyLab.(USA)
1:30pm:Understanding the Generation of Charge Carriers in Organic Photovoltaic Devices, GarryRumbles,NationalRenewableEnergyLab.(USA)andUniv.ofColoradoatBoulder(USA)
2:00pm:Light Management in Single-Junction III-V Solar Cells, BrendanM.Kayes,AltaDevices,Inc.(USA)
2:30pm:Carbon Nanotubes for Photovoltaics, MichaelJ.Heben,TheUniv.ofToledo(USA)
CoffeeBreak. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3:00to3:30pm
3:30pm:Advanced Solar Cell Technologies for Concentrating Photovoltaics Systems, VijitSabnis,SolarJunction(USA)
4:00pm:High-Rate Processing and Advanced Emitter Structures for CIGS PV Module Manufacturing,BillyJ.Stanbery,HelioVoltCorp.(USA)
4:30pm:On the Way to Accelerated Life Testing, MichaelKöhl,Fraunhofer-InstitutfürSolareEnergiesysteme(Germany)
Tuesday 14 AugustPanel Discussion . . . . . . . . . . . . . Tues. 10:30 am to 12:00 pm
Commercialization of Emerging Photovoltaic Technologies
Moderator:Loucas Tsakalakos,GEGlobalResearch(USA)
Panelists:
Vahan Garboushian, AmonixInc.(USA)
Garry Rumbles, NationalRenewableEnergyLab.(USA)andUniv.ofColoradoatBoulder(USA)
Brendan M. Kayes, AltaDevices,Inc.(USA)
Billy J. Stanbery,HelioVoltCorp.(USA)
Lunch/ExhibitionBreak. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:00to1:30pm
SESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 1:30 to 3:30 pm
Progress towards Stable Organic Solar Cells: Joint Session with Conference 8472
Session Chair: Ifor D. W. Samuel, Univ.ofSt.Andrews(UnitedKingdom)
Electrodes, interface materials, and architectures to enhance the efficiency and lifetime of organic photovoltaic cells ( Keynote Presentation),PaulL.Heremans,AfshinHadipour,EszterVoroshazi,DavidCheyns,BarryP.Rand,IMEC(Belgium). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8477-01]
The role of electron affinity in determining whether fullerenes catalyze photoxidation of polymers or prevent it by scavenging electrons,IsaacT.Sachs-Quintana,EricT.Hoke,StanfordUniv.(UnitedStates);MatthewT.Lloyd,NextEnergyTechnologies,Inc.(UnitedStates);IsaacV.Kauvar,StanfordUniv.(UnitedStates);NikosKopidakis,AlexandreNardes,NationalRenewableEnergyLab.(UnitedStates);MichaelD.McGehee,StanfordUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8472-01]
Stability and degradation of organic photovoltaics fabricated, aged, and characterized by the ISOS 3 inter-laboratory collaboration,DavidM.Tanenbaum,PomonaCollege(UnitedStates);MartinHermenau,TechnischeUniv.Dresden(Germany);EszterVoroshazi,IMEC(Belgium);MatthewT.Lloyd,NationalRenewableEnergyLab.(UnitedStates);YuliaGalagan,NationalTaiwanUniv.(Taiwan);BirgerZimmermann,Fraunhofer-InstitutfürSolareEnergiesysteme(Germany);MarkusHösel,HenrikF.Dam,TechnicalUniv.ofDenmark(Denmark);MikkelJørgensen,SurenGevorgyan,RisøNationalLab.(Denmark);SuleymanKudret,WouterMaes,LaurenceLutsen,DirkVanderzande,Univ.Hasselt(Belgium);UliWürfel,Fraunhofer-InstitutfürSolareEnergiesysteme(Germany);RonnAndriessen,HolstCtr.(Netherlands);RolandRösch,TechnischeUniv.Ilmenau(UnitedStates);HaraldHoppe,TechnischeUniv.Ilmenau(Germany);MonicaLira-Cantu,GerardoTeran-Escobar,CIN2(Spain);AurélieDupuis,Pierre-OlivierBussière,AgnesRivaton,Univ.BlaisePascal(France);GülsahUzunoglu,TÜBITAKNationalMetrologyInstitute(Turkey);DavidGermack,NationalInstituteofStandardsandTechnology(UnitedStates);BirgittaAndreasen,MortenMadsen,KionNorrman,EvaBundgaard,RisøNationalLab.(Denmark);FrederikC.Krebs,TechnicalUniv.ofDenmark(Denmark) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8477-02]
On the stability of a variety of organic photovoltaic devices by the IPCE and in situ IPCE analyses: the ISOS-3 inter-laboratory collaboration,MonicaLira-Cantu,GerardoTeran-Escobar,CIN2(Spain);DavidTanenbaumb,PomonaCollege(UnitedStates);EszterVoroshazidd,IMEC(Belgium);MartinHermenau,TechnischeUniv.Dresden(Germany);KionNorrman,TechnialUniv.ofDenmark(Denmark);MatthewLloyd,NationalRenewableEnergyLab.(UnitedStates);YuliaGalagan,HolstCtr.(Netherlands);BirgerZimmermannh,Fraunhofer-InstitutfürSolareEnergiesysteme(Germany);MarkusHösel,HenrikF.Dam,MikkelJogersen,SurenGevorgyan,RisøNationalLab.(Denmark);LaurenLutsen,DirkVanderzande,Univ.Hasselt(Belgium);UliWürfel,FraunhoferInstituteforSolarEnergySystemsISE(Germany);RonnAndriessen,HOLSTCtr.(Netherlands);RolandRösch,TechnischeUniv.Ilmenau(Georgia);HaraldHoppe,TechnischeUniv.Ilmenau(Germany);AgnèsRivatonn,Univ.BlaisePascal(France);GülsahY.Uzunoglu,TÜBITAKNationalMetrologyInstitute(Turkey);DavidGermack,BrookhavenNationalLab.(UnitedStates);BrigittaAndearsen,MortenV.Madsenb,EvaBundgaard,FrederkC.Krebs,RisøNationalLab.(Denmark) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8472-02]
Investigation of the degradation mechanism of a variety of organic photovoltaic devices by combination of imaging techniques: the ISOS-3 inter-laboratory collaboration,RolandRösch,TechnischeUniv.Ilmenau(Germany);DavidM.Tanenbaum,PomonaCollege(UnitedStates);MikkelJorgensen,RisøNationalLab.(Denmark);MarcoSeeland,MaikBärenklau,TechnischeUniv.Ilmenau(Germany);MartinHermenau,TechnischeUniv.Dresden(Germany);EszterVoroshazi,IMEC(Belgium);MatthewT.Lloyd,NationalRenewableEnergyLab.(UnitedStates);YuliaGalagan,NationalTaiwanUniv.(Taiwan);BirgerZimmermann,Albert-Ludwigs-Univ.Freiburg(Germany);UliWürfel,Fraunhofer-InstitutfürSolareEnergiesysteme(Germany);MarkusHösel,HenrikF.Dam,SurenA.Gevorgyan,RisøNationalLab.(Denmark);SuleymanKudret,WouterMaes,LaurenceLutsen,DirkVanderzande,Univ.Hasselt(Belgium);RonnAndriessen,HolstCtr.(Netherlands);GerardoTeran-Escobar,MonicaLira-Cantu,CIN2(Spain);AgnesRivaton,Univ.BlaisePascal(France);GülsahY.Uzunoglu,TÜBITAKNationalMetrologyInstitute(Turkey);DavidGermack,NationalInstituteofStandardsandTechnology(UnitedStates);BirgittaAndreasen,MortenV.Madsen,KionNorrman,RisøNationalLab.(Denmark);HaraldHoppe,TechnischeUniv.Ilmenau(Germany);FrederikC.Krebs,RisøNationalLab.(Denmark) . . . . . . . . . . . . . . . . . . . . . . . . . . [8472-03]
Efficient organic vacuum deposited tandem solar cells and modules on glass and PET (Invited Paper),ChristianL.Uhrich,RicoMeerheim,ToniMüller,MartinP.Pfeiffer,heliatekGmbH(Germany) . . . . . . . . . . . . . . . . . . . . [8477-03]
spie.org/opadvance · TEL:+13606763290 · help@spie.org 93
SESSION 2 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 4:00 to 6:00 pm
Progress in Solution Processible PolymersSession Chair: Klaus Meerholz, Univ.zuKöln(Germany)
Rational design of new polymers for highly efficient organic solar cells (Invited Paper),LupingYu,TheUniv.ofChicago(UnitedStates). . . . . [8477-04]
Atomic modification on conjugated polymers for efficiency photovoltaic cells,Sai-WingTsang,JamesJ.Deininger,SongChen,KyukwanZong,JesseManders,CephasSmall,JohnR.Reynolds,FrankySo,Univ.ofFlorida(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8477-05]
Donor/acceptor morphology control for efficient and stable photovoltaic cells by using semiconducting diblock copolymers (Invited Paper),KeisukeTajima,ShojiMiyanishi,YueZhang,KazuhitoHashimoto,TheUniv.ofTokyo(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8477-06]
Electronic structure tuning of new fused thieno[3,2-b]thieno bisthiophene based polymers via alkyl chain and Group IV heteroatom modulation,BobC.Schroeder,HugoBronstein,RajaS.Ashraf,ZhenggangHuang,PabitraShakyaTuladhar,ThomasD.Anthopoulos,JamesR.Durrant,IainMcCulloch,ImperialCollegeLondon(UnitedKingdom) . . . . . . . . . . . . . . . . . . . . . [8477-07]
Molecular and polymeric materials for printed organic photovoltaics (Invited Paper),AntonioF.Facchetti,PolyeraCorp.(UnitedStates)andNorthwesternUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8477-08]
Efficient conventional- and inverted-type photovoltaic cells using a planar alternating polythiophene copolymer,WonhoLee,PusanNationalUniv.(Korea,Republicof);HanYoungWoo,PusanNationalUniv(Korea,Republicof) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8477-09]
Wednesday 15 AugustOrganic Photonics + Electronics Plenary Session . . . . . . . . . . . . . . . . . . .Wed. 8:15 to 10:00 am
Session Chair:Zakya H. Kafafi, NationalScienceFoundation(USA)
8:15am:Announcement of the Organic Photonics + Electronics Best Student Paper Award Winner
8:30am:Liquid Crystal Lasers: From Concepts to Practical Realisation,HarryJ.Coles,Univ.ofCambridge(UnitedKingdom)
9:00am:The Role of Solution Processing in the Future of OLED TVs, MarieO’Regan,DuPontDisplays(USA)
9:30am:Plastic Solar Cells: Breaking the 10% Commercialization Barrier,YangYang,Univ.ofCalifornia,LosAngeles(USA)
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . .Wed. 10:30 to 11:55 am
Device Physics and Film MorphologySession Chair: Paul L. Heremans, IMEC(Belgium)
Asymmetric photocurrent generation in polymer/fullerene solar cells (Invited Paper),ChristopherR.McNeill,MonashUniv.(Australia);ThomasBrenner,ZheLi,Univ.ofCambridge(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . [8477-10]
Fullerene crystallisation as a key driver of charge separation in polymer/fullerene bulk heterojunction solar cells,NatalieStingelin-Stutzmann,ImperialCollegeLondon(UnitedKingdom) . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8477-11]
Spatial mapping of photocurrents in organic solar cells comprising wedge-shaped absorber layers for an efficient material screening,AlexanderColsmann,FelixNickel,MichaelF.G.Klein,ChristianSprau,UliLemmer,KarlsruherInstitutfürTechnologie(Germany). . . . . . . . . . . . . . . . . . . . [8477-12]
Characterization of charge transport via in situ potentiometry in bulk heterojunction organic photovoltaic materials,EricDanielson,ChrisLombardo,AnanthDodabalapur,TheUniv.ofTexasatAustin(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8477-13]
Imaging organic solar cell morphology with organic light emitting diode-organic solar cell devices,GraemeM.Williams,HanyAziz,Univ.ofWaterloo(Canada) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8477-14]
Lunch/Exhibition Break........................... 11:55amto1:30pm
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 1:30 to 3:20 pm
High-Efficiency and Large-Area Organic Solar CellsSession Chair: Nikos Kopidakis, NationalRenewableEnergyLab.
(UnitedStates)
Realization of high efficiency inverted polymer photovoltaic cells for roll-to-roll application (Invited Paper),FrankySo,Univ.ofFlorida(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8477-15]
Exploring various structures and materials for lamination of air stable OPV devices,BrianA.Bailey,Univ.ofDenver(UnitedStates);NikosKopidakis,NationalRenewableEnergyLab.(UnitedStates);SeanE.Shaheen,Univ.ofDenver(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8477-16]
Low temperature solution processed metal oxide buffer layers fulfilling large area production requirements,TobiasStubhan,IvanLitzov,NingLi,HaiqiaoWang,JohannesKrantz,FlorianMachui,GebhardJ.Matt,Friedrich-Alexander-Univ.Erlangen-Nürnberg(Germany);ChristophJ.Brabec,Friedrich-Alexander-Univ.Erlangen-Nürnberg(Germany)andZAEBayern,Erlangen(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8477-17]
Fabrication of single and multi-junction organic solar cells by means of electrospray deposition (Invited Paper),ChristophPatron,KlausMeerholz,Univ.zuKöln(Germany). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8477-18]
Spray deposited PTB7:PC71BM organic polymer solar cells for efficient power generation,ShizuyasuOchiai,PalanisamyKumar,KannappanSanthakumar,AichiInstituteofTechnology(Japan);Paik-KyunShin,InhaUniv.(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8477-19]
High-speed inkjet printing for organic photovoltaic devices,MathieuSenghor,SolennBerson,MatthieuManceau,RémiDeBettignies,InstitutNationaldel’EnergieSolaire(France);LaurenceDassas,StéphanePoughon,DisaSolar(France);ChrystelleDossou-Yovo,RémiNoguéra,CERADROP(France). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8477-20]
SESSION 5 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 3:45 to 5:30 pm
Charge Transfer Dynamics in Organic Semiconductors: Joint Session with Conference 8459
Session Chair: Garry Rumbles, NationalRenewableEnergyLab.(UnitedStates)
Ultrafast dynamics of photogeneration and mobility of excitons and charges in conjugated polymers and covalent organic frameworks (Invited Paper),LaurensSiebbeles,TechnischeUniv.Delft(Netherlands) . . . . [8477-21]
Influence of molecular weight tuning on the photophysical properties of conjugated polymer: polymer blends,PaulWestacott,SarahFearn,MohammedAl-Hashimi,MartinJ.Heeney,DavidS.McPhail,NatalieStingelin-Stutzmann,ImperialCollegeLondon(UnitedKingdom). . . . . . . . . . . . [8459-27]
Charge generation dynamics in conjugated polymer blends with carbon nanotubes and fullerenes (Invited Paper),ChawKeongYong,SamStranks,ChristianT.Weisspfennig,MichaelB.Johnston,RobinJ.Nicholas,Univ.ofOxford(UnitedKingdom);E.BuchacaDomingo,NatalieStingelin-Stutzmann,ImperialCollegeLondon(UnitedKingdom);LauraM.Herz,Univ.ofOxford(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8477-22]
Probing the vertical molecular conformation and composition in polymer-fullerene photovoltaic devices (Invited Paper),DavidG.Lidzey,TheUniv.ofSheffield(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8459-28]
Charge generation and recombination dynamics in nanofiber P3HT:PCBM solar cells,TzeChienSum,MichaelKurniawan,TeddySalim,KongFaiTai,ChengHonA.Huan,YengMingLam,NanyangTechnologicalUniv.(Singapore) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8477-23]
Posters-Wednesday . . . . . . . . . . . . . . . . . Wed. 5:30 to 7:30 pmConference attendees are invited to attend the poster session on Wednesday evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
Organic solar cells based on organic small molecules and graphene transparent electrode,YongshengChen,NankaiUniv.(China). . . . . [8477-42]
Organic photovoltaic cells with core/shell quantum dots embedded in poly(methyl methacrylate),Ki-ChangKwon,YensilPark,KyoungSoonChoi,Chung-AngUniv.(Korea,Republicof);HeesunYang,HongikUniv.(Korea,Republicof);SooYoungKim,Chung-AngUniv.(Korea,Republicof). [8477-43]
Conference 8477
94 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Investigation of the influence of the power loss on the power conversion efficiency of large-area monolithic OPV modules using computer simulation,Hong-KunLyu,DaeguGyeongbukInstituteofScience&Technology(Korea,Republicof);Kang-PilKim,DaeguGyeongbukInstituteofScience&Technology(Korea,Republicof)andKyungpookNationalUniv,(Korea,Republicof);Jang-KyooShin,KyungpookNationalUniv.(Korea,Republicof);SunghoWoo,DaeguGyeongbukInstituteofScience&Technology(Korea,Republicof) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8477-44]
Evaluation of characteristics on the bulk heterojunction solar cells prepared by PCDTBT: PC71BM composite thin film,MasakazuIto,PalanisamyKumar,KannappanSanthakumar,AichiInstituteofTechnology(Japan);Paik-KyunShin,InhaUniv.(Korea,Republicof);ShizuyasuOchiai,AichiInstituteofTechnology(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8477-45]
Evaluation of the characteristics of the organic thin film solar cell fabricated by poly[4,8-bis(2-ethylhexyloxy)-benzo[1,2-b:4,5-b’]dithiophene-2,6-diyl-alt-(4-octanoyl-5-fluoro-thieno[3,4-b]thiophene-2-carboxylate)-2,6-diyl] (PBDTTT-CF)/ [6,6]-phenyl-C71-butyric acid methyl ester (PCBM),TatsushiKomura,PalanisamyKumar,KannappanSanthakumar,AichiInstituteofTechnology(Japan);Paik-KyunShin,InhaUniv.(Korea,Republicof);ShizuyasuOchiai,AichiInstituteofTechnology(Japan) . . . . . . . . . . . . . . . . . . . . [8477-46]
Introduction reduced graphene oxide as a hole transport layers by using electrophoretic deposition,SeonukPark,LaehoKim,JihunHwang,ChanEonPark,PohangUniv.ofScienceandTechnology(Korea,Republicof) . [8477-47]
GISAXS studies of initial growth mode and nanostructure of bulk heterojunction layers in planar type metal pthanlocyanine molecules,HyoJungKim,JiWhanKim,SeoulNationalUniv.(Korea,Republicof);HyunHwiLee,PohangUniv.ofScienceandTechnology(Korea,Republicof);ByeonduLee,ArgonneNationalLab.(UnitedStates);Jang-JooKim,SeoulNationalUniv.(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8477-48]
PEDOT:PSS-free Au nanocluster treated graphene as transparent anode for organic solar cells,DiZhang,WallaceC.Choy,TheUniv.ofHongKong(HongKong,China);HongweiZhu,TsinghuaUniv.(China) . . . . . . . . . . . . . . [8477-49]
Efficient bulk heterojunction photovoltaic device based on mixed subphthalocyanine:C70 structure,Shun-WeiLiu,MingChiUniv.ofTechnology(Taiwan);Wei-ChengSu,Chih-ChienLee,NationalTaiwanUniv.ofScienceandTechnology(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8477-50]
The roles of poly(ethylene oxide) electrode buffers in efficient polymer photovoltaics,Jun-YuanJeng,Tzung-FangGuo,NationalChengKungUniv.(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8477-51]
Organic solvent wetting properties of UV and plasma treated ZnO nanorods-printed electronics approach,RafalSliz,Univ.ofOulu(Finland);YujiSuzuki,Univ.CollegeLondon(UnitedKingdom);ArokiaNathan,Univ.ofCambridge(UnitedKingdom);RistoMyllylä,Univ.ofOulu(Finland);GhassanE.Jabbour,KingAbdullahUniv.ofScienceandTechnology(SaudiArabia). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8477-52]
Synthesis and characterization of triphenylamine containing polymers with donor-acceptor interaction leading to lowered optical gaps for photovoltaic applications,KatharinaNeumann,MukundanThelakkat,Univ.Bayreuth(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8477-53]
Correlating crystallinity and photophysics for donor polymers of interest for organic photovoltaic devices,YingW.Soon,SafaShoaee,IainMcCulloch,JamesR.Durrant,ImperialCollegeLondon(UnitedKingdom) . . . . . . [8477-54]
A simple and inexpensive encapsulation route for high-throughput characterization of organic photovoltaic devices,MaximNikiforov,SethB.Darling,ArgonneNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . . . [8477-55]
PEDOT:PSS-free polymer solar cells: surface modification by oxygen plasma,WanJaeDong,KihyonHong,GwanHoJung,JuyoungHam,HakKiYu,Jong-LamLee,PohangUniv.ofScienceandTechnology(Korea,Republicof) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8477-56]
Intermediate layers for tandem structure of bulk heterojunction photovoltaic cells,KatsuhikoFujita,AkitoKawanami,KyushuUniv.(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8477-57]
Enhanced sensitivity to near-infrared with high fill factor in small molecular organic solar cells,Hyun-SubShim,Jang-JooKim,HyoJungKim,JiWhanKim,Sei-YongKim,Won-IkJeong,Tae-MinKim,SeoulNationalUniv.(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8477-58]
Origin of gap states in BCP cathode of organic photovoltaics,GwanHoJung,WanJaeDong,JuyoungHam,Jong-LamLee,PohangUniv.ofScienceandTechnology(Korea,Republicof) . . . . . . . . . . . . . . . . . . . . . . . . . . [8477-59]
Thermal and substrate surface energy effects on nanostructure and surface morphology in the ultrathin copper phthalocyanine film,HyunHwiLee,PohangUniv.ofScienceandTechnology(Korea,Republicof). . . . . . [8477-60]
Synthesis and photovoltaic properties of donor-acceptor copolymers based on benzotriazole derivatives,Sung-MinPark,HannamUniv.(Korea,Republicof);NamSeobBaek,ElectronicsandTelecommunicationsResearchInstitute(Korea,Republicof);Kwang-SupLee,Tae-DongKim,HannamUniv.(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8477-61]
Improved efficiency of polymer solar cells by using potassium borohydride as an electron injection layer,YoungjunKo,HyunkooLee,YongwonKwon,ChangheeLee,SeoulNationalUniv.(Korea,Republicof) . . . . . . . . . . [8477-62]
Inverted structure organic polymer solar cell based on Nb205 as electron transport layer,PrajwalAdhikary,SouthDakotaStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8477-63]
Novel low bandgap benzothiadiazole based polymers for photovoltaic application,SwaminathanVenkatesan,QiliangChen,PurnaMaharjan,QiquanQiao,SouthDakotaStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . [8477-64]
Smart transparent electrode for flexible PEDOT:PSS-free organic photovoltaics,JuyoungHam,SungjunKim,PohangUniv.ofScienceandTechnology(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8477-65]
Ultrafast multi-phasic electron injection in efficient non-aggregated hyperbranched zinc phthalocyanine sensitized solar cells,YongLi,SouthDakotaStateUniv.(UnitedStates)andUniv.ofMissouri-KansasCity(UnitedStates);XingzhongYan,SouthDakotaStateUniv.(UnitedStates);ZhonghuaPeng,Univ.ofMissouri-KansasCity(UnitedStates) . . . . . . . . . . . . . . [8477-66]
Thursday 16 AugustSESSION 6 . . . . . . . . . . . . . . . . . . . . . . . Thurs. 8:30 to 10:00 am
Charge Separation and RecombinationSession Chair: Laura M. Herz, Univ.ofOxford(UnitedKingdom)
The photophysics of acceptors in organic photovoltaics: molecular control of the electronic and charge transport properties (Invited Paper),NikosKopidakis,NationalRenewableEnergyLab.(UnitedStates). . . . . . . . [8477-24]
A predictive theory of charge separation and recombination in organic photovoltaics interfaces (Invited Paper),AlessandroTroisi,Univ.ofWarwick(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8477-25]
Photocurrent generation in complementary acceptor-donor pairs in organic solar cells (Invited Paper),PaulMeredith,PaulL.Burn,AjayK.Pandey,AlmantasPivrikas,MarappanVelusamy,KwanH.Lee,YuanFang,TheUniv.ofQueensland(Australia);AlexNardes,NikosKopidakis,NationalRenewableEnergyLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8477-26]
In situ Raman study of ordered molecular aggregates during freeze-dry fabrication of bulk heterojunction solar cells,Yu-BingLan,Pin-HaoSher,Chao-HanCheng,InstituteofAtomicandMolecularSciences(Taiwan);Ping-TsungHuang,Fu-JenCatholicUniv.(Taiwan);Juen-KaiWang,InstituteofAtomicandMolecularSciences(Taiwan). . . . . . . . . . . . . . . . . . . . . . . [8477-27]
SESSION 7 . . . . . . . . . . . . . . . . . . . . . . Thurs. 10:30 to 11:55 am
Interfaces in Organic Solar CellsSession Chair: Laurens Siebbeles, TechnischeUniv.Delft(Netherlands)
Interfacial modification for photovoltaic applications (Invited Paper),SethR.Marder,StephenBarlow,Jean-LucBredas,AnthonyGiordano,SongGuo,AndreasHaldi,PeterJ.Hotchkiss,Sang-BokKim,BernardKippelen,HongLi,SwagatMohapatra,SergioA.Paniagua,PavelB.Paramonov,WilliamJ.Potscavage,Jr.,AshaSharma,O’NeilSmith,GeorgiaInstituteofTechnology(UnitedStates);NealR.Armstrong,JudithL.Jenkins,Hsiao-ChuLin,AnomaMudalige,SaehanPark,JeanneE.Pemberton,ErinL.Ratcliff,S.ScottSaavedra,LingziSang,MatthewC.Schalnat,AnneM.Simon,TheUniv.ofArizona(UnitedStates);AntoineL.Kahn,YabingQi,WeiZhao,PrincetonUniv.(UnitedStates);DavidS.Ginger,MatthewGliboff,KristinaM.Knesting,BradleyA.MacLeod,GeraldT.Seidler,Univ.ofWashington(UnitedStates). . [8477-28]
Maximize photovoltage output of organic solar cells by tuning the energy level offset between donor and acceptor with ferroelectric dipole layers,JinsongHuang,BinYang,YongboYuan,PankajSharma,ShashiPoddar,RafalKorlacki,StephenDucharme,AlexeiGruverman,RaviSaraf,Univ.ofNebraska-Lincoln(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8477-29]
Characterization of transparent NiO/ZnO interface for tandem OPV applications,XerxesK.Steirer,KentoOu,ErinL.Ratcliff,PaulA.Lee,NealR.Armstrong,TheUniv.ofArizona(UnitedStates). . . . . . . . . . . . . . . . . . [8477-30]
The application of highly doped single-layer graphene as the electrodes of organic solar cells,FengYan,ZhikeLiu,TheHongKongPolytechnicUniv.(HongKong,China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8477-31]
Conference 8477
spie.org/opadvance · TEL:+13606763290 · help@spie.org 95
Metal-induced PCBM diffusion and its effects on electronic structures in bulk-heterojunction solar cells,Wei-HsuanTseng,NationalTaiwanUniv.(Taiwan);Mei-HsinChen,NationalDongHwaUniv.(Taiwan);Jeng-YuWang,Chun-TseTseng,HungLo,Chih-IWu,NationalTaiwanUniv.(Taiwan)[8477-32]
Lunch/Exhibition Break........................... 11:55amto1:30pm
SESSION 8 . . . . . . . . . . . . . . . . . . . . . . . . Thurs. 1:30 to 2:50 pm
Improved Harvesting of Solar LightSession Chair: Seth R. Marder, GeorgiaInstituteofTechnology(United
States)
Photochemical upconversion for enhanced light harvesting (Invited Paper),YuenYapCheng,BurkhardFueckel,TimF.Schulze,TonyH.Khoury,RowanW.MacQueen,AndrewDanos,MuradJ.Y.Tayebjee,RaphaelG.C.R.Clady,TheUniv.ofSydney(Australia);NicholasJ.Ekins-Daukes,ImperialCollegeLondon(UnitedKingdom);BerndStannowski,Helmholtz-ZentrumBerlinfürMaterialienundEnergieGmbH(Germany);MaxwellJ.Crossley,TheUniv.ofSydney(Australia);KlausLips,Helmholtz-ZentrumBerlinfürMaterialienundEnergieGmbH(Germany);TimothyW.Schmidt,TheUniv.ofSydney(Australia)[8477-33]
Near IR sensitization of polymer/fullerene solar cells,TayebehAmeri,JieMin,NingLi,FlorianMachui,ChristophJ.Brabec,Friedrich-Alexander-Univ.Erlangen-Nürnberg(Germany);MichaelForster,KristinaSchottler,DanielDolfen,SybilleAllard,UllrichScherf,BergischeUniv.Wuppertal(Germany). . [8477-34]
Intensifying sunlight without tracking the sun: recent advances in luminescent solar concentration (Invited Paper),NoelC.Giebink,ThePennsylvaniaStateUniv.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . [8477-35]
Optical properties enhancement in low-bandgap organic solar cells with embedded PEDOT:PSS gratings,XiaolongZhu,TheUniv.ofHongKong(HongKong,China);ChuihuiDuan,SouthChinaUniv.ofTechnology(China);WallaceC.Choy,FengxianXie,ChuanDaoWang,TheUniv.ofHongKong(HongKong,China);FeiHuang,YongCao,SouthChinaUniv.ofTechnology(China)[8477-36]
SESSION 9 . . . . . . . . . . . . . . . . . . . . . . . . Thurs. 3:20 to 4:45 pm
Hybrid Devices and Plasmonic NanostructuresSession Chair: Paul A. Lane, U.S.NavalResearchLab.(UnitedStates)
Hybrid photovoltaic devices based on chalcogenide aerogels (Invited Paper),JilianN.deFreitas,Univ.EstadualdeCampinas(Brazil);LasanthaKorala,StephanieL.Brock,WayneStateUniv.(UnitedStates);AnaF.Nogueira,Univ.EstadualdeCampinas(Brazil)................................ [8477-37]
Dye adsorption feature on titania surface and role of dye aggregation inhibitor monitored by quartz crystal microbalance (QCM),ShuziHayase,RyouheiHirota,YuheiOgomi,ShyamPandey,KyushuInstituteofTechnology(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8477-38]
Mixing plasmonic Au nanoparticles into all polymer layers for improving the efficiency of organic solar cells,WallaceC.Choy,ChuanDaoWang,DixonD.S.Fung,WeiE.I.Sha,FengxianXie,TheUniv.ofHongKong(HongKong,China) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8477-39]
Theoretical studies of effects of 2D plasmonic grating on electrical properties of organic solar cells,WeiE.I.Sha,WallaceC.Choy,WengChoChew,TheUniv.ofHongKong(HongKong,China) . . . . . . . . . . . . . . [8477-40]
Plasmonic materials for enhanced organic photovoltaics,ChristopherE.Tabor,AirForceResearchLab.(UnitedStates);Chun-WanYen,NationalAcademyofSciences(UnitedStates);MichaelF.Durstock,AirForceResearchLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8477-41]
Conference 8477
96 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Conference 8478Monday-Wednesday 13-15 August 2012 • Proceedings of SPIE Vol. 8478
Organic Field-Effect Transistors XIConference Chairs:Zhenan Bao, StanfordUniv.(UnitedStates);Iain McCulloch, ImperialCollegeLondon(UnitedKingdom)
Monday 13 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . .Mon. 8:30 to 10:25 am
Materials ISession Chair: Iain McCulloch, ImperialCollegeLondon(United
Kingdom)
Larger acenes for organic thin-film transistors (Invited Paper),JohnE.Anthony,Univ.ofKentucky(UnitedStates) . . . . . . . . . . . . . . . . . . . . . [8478-01]
Conjugated polymer semiconductors: insights towards enhanced ordering, charge transport, and macroscale mobility (Invited Paper),ElsaReichmanis,AvishekAiyar,MinSangPark,JungOkPark,MohanSrinivasarao,GeorgiaInstituteofTechnology(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . [8478-02]
A series of diketopyrrolopyrrole-based low-band gap polymers for OTFTs and OPVs,Hye-MinKim,DeepakChandran,Sin-TaeKim,HannamUniv.(Korea,Republicof);NamSeobBaek,ElectronicsandTelecommunicationsResearchInstitute(Korea,Republicof);Kwang-SupLee,Tae-DongKim,HannamUniv.(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8478-03]
Design and synthesis of π-conjugated molecules and their applications in organic field-effect transistors (Invited Paper),YunqiLiu,InstituteofChemistry(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8478-04]
Ring fusion effects in conjugated polymers for FETs (Invited Paper),MartinJ.Heeney,ImperialCollegeLondon(UnitedKingdom) . . . . . . . . . . . . . . [8478-05]
SESSION 2 . . . . . . . . . . . . . . . . . . . . Mon. 10:55 am to 12:25 pm
Materials IISession Chair: Zhenan Bao, StanfordUniv.(UnitedStates)
Recent advances in OTFT technology (Invited Paper),MikeBanach,PlasticLogicLtd.(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8478-06]
Development of OTFT device stack for integration of organic semiconductors into flexible displays (Invited Paper),TomasG.Backlund,PiotrWierzchowiec,LiWeiTan,IrinaAfonina,StephenBain,RashmiBhintade,PaulBrookes,GilesR.Lloyd,StevenTierney,MarkJames,MerckChemicalsLtd.(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8478-07]
Organic transistors at BASF SE: from materials to devices (Invited Paper),ThomasR.Weitz,BASFSE(Germany). . . . . . . . . . . . . . . . . . . . . . . . . [8478-08]
High-mobility ambipolar polymer transistors: properties and function,AukeJiskKronemeijer,EnricoGili,Univ.ofCambridge(UnitedKingdom);MunazzaShahid,ImperialCollege(UnitedKingdom);JonathanRivnay,AlbertoSalleo,StanfordUniv.(UnitedStates);MartinJ.Heeney,ImperialCollegeLondon(UnitedKingdom);HenningSirringhaus,Univ.ofCambridge(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8478-09]
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:25to1:50pm
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 1:50 to 3:35 pm
Morphology ISession Chair: Aram Amassian, KingAbdullahUniv.ofScienceand
Technology(SaudiArabia)
Guiding crystallization around bends and corners: probing intra- and interspherulite charge transport in solution-processed organic semiconductors (Invited Paper),LynnLoo,PrincetonUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8478-10]
Large-area solution-grown single-crystals of organic semiconductors for transistors and complementary inverters (Invited Paper),HanyingLi,ZhejiangUniv.(China);BenjaminTee,ZhenanBao,StanfordUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8478-11]
Solution-phase growth of organic single-crystal arrays,OsamuGoto,SonyCorp.(Japan)andHokkaidoUniv.(Japan);ShigetakaTomiya,YosukeMurakami,AkiraShinozaki,AkiraToda,SonyCorp.(Japan);JiroKasahara,HokkaidoUniv.(Japan);DaisukeHobara,SonyCorp.(Japan) . . . . . . . . . . . . . . . . . . . [8478-12]
Will we ever achieve the growth of large polythiophene single crystals? (Invited Paper),AlejandroL.Briseno,Univ.ofMassachusettsAmherst(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8478-13]
New pentacene derivative transistors by controlled crystallization from solution,NatalieStingelin-Stutzmann,ImperialCollegeLondon(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8478-14]
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 4:05 to 5:50 pm
Devices ISession Chair: Unyong Jeong, YonseiUniv.(Korea,Republicof)
Large-area, ultraflexible integrated circuits using high-definition, screen-printed organic transistors (Invited Paper),TsuyoshiSekitani,TheUniv.ofTokyo(Japan) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8478-15]
Printed TFT and circuits based on organic semiconductor on flexible substrate (Invited Paper),SungHoonKim,MinHeeChoi,JinJang,KyungHeeUniv.(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8478-16]
Organic gate dielectrics for advancing high-performance organic field-effect transistors and circuits (Invited Paper),ChanEonPark,PohangUniv.ofScienceandTechnology(Korea,Republicof) . . . . . . . . . . . . . . . . . . . [8478-17]
Organic complementary analog circuits on plastic foils for sensing applications,MathieuGuerin,EmmanuelBergeret,EvangelineBènevent,PhilippePannier,InstitutMateriauxNanoelectroniquedeProvence(France);RomainCoppard,AnisDaami,Commissariatàl’ÉnergieAtomique(France). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8478-18]
N-type self-assembled monolayer field-effect transistors,AndreasRingk,Univ.Bayreuth(Germany);XiaoranLi,EdsgerC.P.Smits,HolstCtr.(Netherlands);FatemehGholamrezaie,DagoM.deLeeuw,PhilipsResearchNederlandB.V.(Netherlands);RolandResel,TechnischeUniv.Graz(Austria);PeterStrohriegl,Univ.Bayreuth(Germany) . . . . . . . . . . . . . . . . . . . . . [8478-19]
Tuesday 14 AugustSESSION 5 . . . . . . . . . . . . . . . . . . . . . . . . Tues. 8:30 to 10:05 am
Materials and Devices ISession Chair: Chan Eon Park, PohangUniv.ofScienceand
Technology(Korea,Republicof)
Polymer-based stretchable electrodes, dielectrics, and active layers for stretchable devices (Invited Paper),UnyongJeong,MinkwanShin,SungwonLee,YonseiUniv.(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . [8478-20]
Low-temperature processing of high-mobility ZnO thin-film transistors on flexible substrates (Invited Paper),MartynA.McLachlan,ImperialCollegeLondon(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8478-21]
Transient analysis of electrolyte-gated organic field-effect transistors,DeyuTu,LinköpingUniv.(Sweden). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8478-22]
Extendable self-assembly of π-conjugated polymers,HoichangYang,MiJang,InhaUniv.(Korea,Republicof) . . . . . . . . . . . . . . . . . . . . . . . . . . [8478-23]
Synthesis, characterization, and morphology of liquid crystal homo and alternating (co)polymers based on π-conjugated backbone,FabriceMathevet,IbtissamTahar-Djebbar,DanliZeng,EmmanuelleLacaze,Univ.PierreetMarieCurie(France);BenoitHeinrich,BertrandDonnio,DanielGuillon,InstitutdePhysiqueetChimiedesMatériauxdeStrasbourg(France);DavidKreher,André-JeanAttias,Univ.PierreetMarieCurie(France). . . . . . . . . . . . [8478-24]
spie.org/opadvance · TEL:+13606763290 · help@spie.org 97
SESSION 6 . . . . . . . . . . . . . . . . . . . . Tues. 10:35 am to 12:10 pm
Morphology IISession Chair: Stefan C. Mannsfeld, SLACNationalAcceleratorLab.
(UnitedStates)
Solution-processing of organic semiconductors (Invited Paper),AramAmassian,KingAbdullahUniv.ofScienceandTechnology(SaudiArabia). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8478-25]
Molecular ordering in semiconducting polymers for thin-film transistors (Invited Paper),MichaelL.Chabinyc,JustinCochran,Univ.ofCalifornia,SantaBarbara(UnitedStates);BrianA.Collins,HaraldAde,NorthCarolinaStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8478-26]
Unraveling the role of crystallites and aggregates for charge transport in P3HT thin films,DucT.Duong,AlbertoSalleo,StanfordUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8478-27]
Mapping of domain orientation and molecular order in polycrystalline semiconducting polymer films with soft x-ray microscopy,ChristopherR.McNeill,MonashUniv.(Australia);TorbenSchuettfort,Univ.ofCambridge(UnitedKingdom);BenjaminWatts,PaulScherrerInstitut(Switzerland)[8478-28]
Effects of interfaces on microstructure and charge transport in high-performance polymer semiconductors,ScottA.Himmelberger,JonathanRivnay,StanfordUniv.(UnitedStates);LeslieH.Jimison,EcoleNationaleSupérieuredesMinesdeSaintEtienne(France);DucT.Duong,StanfordUniv.(UnitedStates);MichaelF.Toney,SLACNationalAcceleratorLab.(UnitedStates);AlbertoSalleo,StanfordUniv.(UnitedStates). . . . . . . . . . . . . [8478-29]
Lunch/Exhibition Break.............................. 12:10to1:35pm
SESSION 7 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 1:35 to 3:00 pm
Morphology and Devices IISession Chair: Hanying Li, ZhejiangUniv.(China)
Operational stability of high-performance organic transistors (Invited Paper),VitalyPodzorov,Rutgers,TheStateUniv.ofNewJersey(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8478-30]
Revealing the molecular packing in high-performance organic semiconductor thin films with synchrotron x-ray scattering,StefanC.Mannsfeld,SLACNationalAcceleratorLab.(UnitedStates) . . . . . . . . [8478-31]
Fluorescence quenching microscopy for the study of exciton quenching in organic field-effect transistors,WouterW.A.Koopman,StefanoToffanin,MarcoNatali,IstitutoperloStudiodeiMaterialiNanostrutturati(Italy);MicheleMuccini,IstitutoperloStudiodeiMaterialiNanostrutturati(Italy)andE.T.C.s.r.l.(Italy) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8478-32]
Spectroscopic signatures of ambipolar injection in narrow gap donor-acceptor polymer transistors,OmarKhatib,Univ.ofCalifornia,SanDiego(UnitedStates);JonathanD.Yuen,Univ.ofCalifornia,SantaBarbara(UnitedStates);JimWilson,Univ.ofCalifornia,SanDiego(UnitedStates);RajeevKumar,NanoTerra,Inc.(UnitedStates);FredWudl,Univ.ofCalifornia,SantaBarbara(UnitedStates);MassimilianoDiVentra,Univ.ofCalifornia,SanDiego(UnitedStates);AlanJ.Heeger,Univ.ofCalifornia,SantaBarbara(UnitedStates);DimitriN.Basov,Univ.ofCalifornia,SanDiego(UnitedStates) . . . . . . . . . . . [8478-33]
Correlation of microstructure and charge transport in high-performance ambipolar organic semiconductor,YoungMinPark,JonathanRivnay,AlbertoSalleo,StanfordUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . [8478-34]
SESSION 8 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 3:30 to 5:25 pm
Devices IISession Chair: Alejandro L. Briseno, Univ.ofMassachusettsAmherst
(UnitedStates)
Charge transport in donor acceptor polymer field-effect transistors (Invited Paper),AnanthDodabalapur,TheUniv.ofTexasatAustin(UnitedStates);PrashantSonar,A*STARInstituteofMaterialsResearchandEngineering(Singapore);Tae-JunHa,TheUniv.ofTexasatAustin(UnitedStates) [8478-35]
Organic doping: new approaches for enhancing the performance of organic transistors,BjörnLüssem,AxelFischer,HansKleemann,MaxL.Tietze,KarlLeo,TechnischeUniv.Dresden(Germany). . . . . . . . . . . . . . . . . . . . . . [8478-36]
Spectral, optical, and transport properties of slightly doped organic semiconductors,CarmineAntonioPerroni,Univ.FedericoII(Italy)andCNR-SPIN(Italy). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8478-37]
Molecular doping processes in organic semiconductors: an experimental and numerical study,MaxL.Tietze,LorenzoBurtone,BjörnLüssem,MoritzK.Riede,KarlLeo,TechnischeUniv.Dresden(Germany) . . . . . . . . . . . . [8478-38]
Material properties and field-effect transistor characteristics of hybrid organic/graphene active layers,Tae-JunHa,AnanthDodabalapur,TheUniv.ofTexasatAustin(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8478-39]
Controlled synthesis of nanomaterials for plastic electronics,SivaKrishnadasan,ImperialCollegeLondon(UnitedKingdom) . . . . . . . . . [8478-40]
The application of a high-k polymer dielectric in low-voltage organic thin-film transistors,FengYan,TheHongKongPolytechnicUniv.(HongKong,China) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8478-41]
Wednesday 15 AugustOrganic Photonics + Electronics Plenary Session . . . . . . . . . . . . . . . . . . .Wed. 8:15 to 10:00 am
Session Chair:Zakya H. Kafafi, NationalScienceFoundation(USA)
8:15am:Announcement of the Organic Photonics + Electronics Best Student Paper Award Winner
8:30am:Liquid Crystal Lasers: From Concepts to Practical Realisation,HarryJ.Coles,Univ.ofCambridge(UnitedKingdom)
9:00am:The Role of Solution Processing in the Future of OLED TVs, MarieO’Regan,DuPontDisplays(USA)
9:30am:Plastic Solar Cells: Breaking the 10% Commercialization Barrier,YangYang,Univ.ofCalifornia,LosAngeles(USA)
Posters-Wednesday . . . . . . . . . . . . . . . . . Wed. 5:30 to 7:30 pmConference attendees are invited to attend the poster session on Wednesday evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
Organic transistor memory performance improvement with the LiF blocking layer,WangSumei,ShangdongUniv.(China). . . . . . . . . . . . . . . . . . . [8478-42]
Damage-free hybrid encapsulation of organic field-effect transistors,MiJang,InhaUniv.(Korea,Republicof);SeHyunKim,ChanEonPark,PohangUniv.ofScienceandTechnology(Korea,Republicof);HoichangYang,InhaUniv.(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8478-43]
Subsidence of organic semiconducting layers into soft dielectrics,MiJang,HoichangYang,InhaUniv.(Korea,Republicof). . . . . . . . . . . . . . . . . . [8478-44]
Nonvolatile memory thin-film transistors using organic ferroelectric gate insulator,Soon-WonJung,BockSoonNa,MinseokKim,YongSukYang,In-KyuYou,JaeBonKoo,ElectronicsandTelecommunicationsResearchInstitute(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8478-45]
Conference 8478
98 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Conference 8479Wednesday-Thursday 15-16 August 2012 • Proceedings of SPIE Vol. 8479
Organic Semiconductors in Sensors and Bioelectronics VConference Chair:Ruth Shinar, IowaStateUniv.(UnitedStates)
Conference Co-Chair:Ioannis Kymissis, ColumbiaUniv.(UnitedStates)
Program Committee:Magnus Berggren, LinköpingUniv.(Sweden);Sumit Chaudhary, IowaStateUniv.(UnitedStates);Fabio Cicoira, EcolePolytechniquedeMontréal(Canada);Emil J. W. List, TechnischeUniv.Graz(Austria);Róisín M. Owens, EcoleNationaleSupérieuredesMinesdeSaint-Étienne(France);Franky So, Univ.ofFlorida(UnitedStates);Luisa Torsi, Univ.degliStudidiBari(Italy)
Wednesday 15 AugustOrganic Photonics + Electronics Plenary Session . . . . . . . . . . . . . . . . . . .Wed. 8:15 to 10:00 am
Session Chair:Zakya H. Kafafi, NationalScienceFoundation(USA)
8:15am:Announcement of the Organic Photonics + Electronics Best Student Paper Award Winner
8:30am:Liquid Crystal Lasers: From Concepts to Practical Realisation,HarryJ.Coles,Univ.ofCambridge(UnitedKingdom)
9:00am:The Role of Solution Processing in the Future of OLED TVs, MarieO’Regan,DuPontDisplays(USA)
9:30am:Plastic Solar Cells: Breaking the 10% Commercialization Barrier,YangYang,Univ.ofCalifornia,LosAngeles(USA)
SESSION 1 . . . . . . . . . . . . . . . . . . . . Wed. 10:30 am to 12:00 pm
Organic Semiconductors in Sensors and Biotechnology ISession Chair: Ioannis Kymissis, ColumbiaUniv.(UnitedStates)
Large-area, flexible energy harvesting systems using organic integrated circuits (Invited Paper),TsuyoshiSekitani,TheUniv.ofTokyo(Japan)[8479-01]
Large-area printed ferroelectric sensors: technology, performance, and potential (Invited Paper),BarbaraStadlober,JOANNEUMRESEARCHForschungsgesellschaftmbH(Austria);MartinZirkl,JOANNEUMRESEARCHForschungsgesellschaftm.b.H(Austria);GregorScheipl,AnurakSawatdee,JOANNEUMRESEARCHForschungsgesellschaftm.b.H.,(Austria) . . [8479-02]
Biologically-inspired materials for renewable energy (Invited Paper),DavidOrdinario,LongPhan,AnthonyBurke,AlonGorodetsky,Univ.ofCalifornia,Irvine(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8479-03]
High throughput pH and ion sensing via CMOS FGFET arrays,AlokPrabhu,Univ.delaMéditerranée(France);ShyuanYang,ColumbiaUniv.(UnitedStates);ArifurRahman,PolytechnicUniv.(UnitedStates);IoannisKymissis,ColumbiaUniv.(UnitedStates);KalleLevon,PolytechnicInstituteofNewYorkUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8479-04]
Lunch/Exhibition Break.............................. 12:00to1:30pm
SESSION 2 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 1:30 to 3:00 pm
Organic Semiconductors in Sensors and Biotechnology IISession Chair: Róisín M. Owens, EcoleNationaleSupérieuredesMines
deSaint-Étienne(France)
Design and optimization of chemical sensing probes and their integration with microcavity OLEDs (Invited Paper),RuiLiu,EeshitaManna,JosephShinar,AmesLab.(UnitedStates);RuthShinar,IowaStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8479-05]
Integrated sensors for point-of-care detection (Invited Paper),JohnC.deMello,ImperialCollegeLondon(UnitedKingdom). . . . . . . . . . . . . . . . [8479-06]
Organic optoelectronic devices for sensing of tissue oxygenation and explosives (Invited Paper),AshuK.Bansal,YueWang,MarioGiardini,EricBowman,GrahamA.Turnbull,IforD.W.Samuel,Univ.ofSt.Andrews(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8479-07]
OLED-based sensor arrays for relative humidity and oxygen,WeipanCui,IowaStateUniv.(UnitedStates);RuiLiu,JosephShinar,AmesLab.(UnitedStates);RuthShinar,IowaStateUniv.(UnitedStates). . . . . . . . . . . . . [8479-08]
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 3:30 to 5:00 pm
Organic Semiconductors in Sensors and Biotechnology IIISession Chair: Emil J. W. List, TechnischeUniv.Graz(Austria)
Infrared sensitive organic light emitting diode (Invited Paper),DoYoungKim,Tzung-HanLai,JaeWoongLee,JesseManders,JihoRyu,DongWooSong,FrankySo,Univ.ofFlorida(UnitedStates). . . . . . . . . . . . . . . . . . . . . . [8479-09]
Solid state dendrimer sensors (Invited Paper),PaulBurn,PaulShaw,YanGeng,PaulMeredith,TheUniv.ofQueensland(Australia). . . . . . . . . . [8479-10]
A nanoarray of polycyclic aromatic hydrocarbons for accurate and predictive detection in real-world conditions (Invited Paper),HossamHaick,Technion-IsraelInstituteofTechnology(Israel). . . . . . . . . . . . . . . . . . . [8479-11]
Polymer opto-chemical-electronic based module as a detection system for volatile analytes on a foil substrate,IndranilR.Bose,AnnaOhlander,MathiasStich,GerhardKlink,GerhardMohr,Fraunhofer-EinrichtungfürModulareFestkörper-TechnologienEMFT(Germany);KarlheinzBock,Fraunhofer-EinrichtungfürModulareFestkörper-TechnologienEMFT(Germany)andTechnischeUniv.Berlin(Germany). . . . . . . . . . . . . . . . . . . . . . . . . . . . [8479-12]
Posters-Wednesday . . . . . . . . . . . . . . . . . Wed. 5:30 to 7:30 pmConference attendees are invited to attend the poster session on Wednesday evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
OLED-based bacteria monitors,RuiLiu,EeshitaManna,AmesLab.(UnitedStates);YuankunCai,IowaStateUniv.(UnitedStates);FadzaiFungura,JosephShinar,AmesLab.(UnitedStates);RuthShinar,IowaStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8479-30]
Identifying the magnetoconductance responses by both illumination and induced charge transfer complex states in pentacene-based photodiodes,Wei-ShunHuang,Tzung-FangGuo,NationalChengKungUniv.(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8479-31]
Active matrix PVDF array for thermal imaging and acoustic signal processing applications,Yu-JenHsu,IoannisKymissis,ColumbiaUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8479-32]
Multiplexed electrode system for cyclic voltammetry experiments with DNA monolayers,ZeynepBasaran,IoannisKymissis,ColumbiaUniv.(UnitedStates);MarisaC.Buzzeo,JanetLee,BarnardCollege(UnitedStates). . . . . . [8479-33]
spie.org/opadvance · TEL:+13606763290 · help@spie.org 99
Thursday 16 AugustSESSION 4 . . . . . . . . . . . . . . . . . . . . . . . Thurs. 8:15 to 10:00 am
Organic Semiconductors in Sensors and Biotechnology IVSession Chair: Ruth Shinar, IowaStateUniv.(UnitedStates)
High-detectivity green selective organic photodetectors for image sensor applications,Dong-SeokLeem,Kwang-HeeLee,Kyung-BaePark,Seon-JeongLim,YongWanJin,SangyoonLee,Kyu-SikKim,SamsungAdvancedInstituteofTechnology(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8479-13]
Polymer-based artificial retinal prosthesis (Invited Paper),MariaRosaAntognazza,DiegoGhezzi,EricaLanzarini,MarcoDalMaschio,FabioBenfenati,IstitutoItalianodiTecnologia(Italy);GuglielmoLanzani,PolitecnicodiMilano(Italy) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8479-14]
Charge-generation in broadband organic photodetectors based on donor-acceptor binary and ternary blends,AjayK.Pandey,TheUniv.ofQueensland(Australia). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8479-15]
Fast and sensitive polymer photodiodes for biosensing applications (Invited Paper),SebastianValouch,SiegfriedKettlitz,ChristianWiese,NicoChrist,AlexanderColsmann,UliLemmer,KarlsruherInstitutfürTechnologie(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8479-16]
Opto-chemical sensors based on integrated ring-shaped organic photodiodes: progress and applications (Invited Paper),TorstenMayr,TobiasAbel,BirgitUngerböck,TechnischeUniv.Graz(Austria);MartinSagmeister,BernhardLamprecht,JOANNEUMRESEARCHForschungsgesellschaftmbH(Austria). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8479-17]
SESSION 5 . . . . . . . . . . . . . . . . . . . Thurs. 10:30 am to 12:00 pm
Organic Semiconductors in Sensors and Biotechnology VSession Chair: Barbara Stadlober, JOANNEUMRESEARCH
ForschungsgesellschaftmbH(Austria)
Sensing mechanism in receptor-modified organic field-effect transistor based vapor sensors (Invited Paper),DavianneDuarte,AnanthDodabalapur,BradleyJ.Holliday,TheUniv.ofTexasatAustin(UnitedStates). . . . . [8479-18]
On the applicability of organic field-effect transistors and organic diode structures for ion-detecting sensor elements (Invited Paper),EmilJ.W.List,TechnischeUniv.Graz(Austria)andNTCWeizGmbH(Austria). . . . . . [8479-19]
Highly conformable conducting polymer-based devices for in vivo recordings,DionKhodagholyAraghy,ThomasDoublet,MosheGurfinkel,EcoleNationaleSupérieuredesMinesdeSaint-Étienne(France);PasclaeQuilichini,Univ.delaMéditerranée(France);MicheleSessolo,EcoleNationaleSupérieuredesMinesdeSaintEtienne(France);EsmaIsmailova,SebastianSanaur,EcoleNationaleSupérieuredesMinesdeSaint-Étienne(France);ChristopheBernard,Univ.delaMéditerranée(France);GeorgeG.Malliaras,EcoleNationaleSupérieuredesMinesdeSaint-Étienne(France) . . . . . . . . . . . . . . . . . [8479-20]
A hybrid ionic-electronic conductor for bioelectronics (Invited Paper),PaulMeredith,AlbertusB.Mostert,IanR.Gentle,KristenTandy,EbinazarNamdas,BenJ.Powell,TheUniv.ofQueensland(Australia) . . . . . . . . . . . . . . . [8479-21]
Lunch/Exhibition Break.............................. 12:00to1:30pm
SESSION 6 . . . . . . . . . . . . . . . . . . . . . . . . Thurs. 1:30 to 3:00 pm
Organic Semiconductors in Sensors and Biotechnology VISession Chair: Paul Burn, TheUniv.ofQueensland(Australia)
Biosensors with organic electronic transduction (Invited Paper),GillesHorowitz,EcolePolytechnique(France). . . . . . . . . . . . . . . . . . . . . . . . [8479-22]
Enzyme-modified electrolyte-gated organic field-effect transistors,FelixButh,AndreasDonner,MartinStutzmann,JoseA.Garrido,WalterSchottkyInstitut(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8479-23]
The application of the organic electrochemical transistor for biodiagnostics: integration with cells and enzymes (Invited Paper),RóisínM.Owens,EcoleNationaleSupérieuredesMinesdeSaint-Étienne(France). . . . . . . . . [8479-24]
Unconventional electrolytes for organic electrochemical transistors (Invited Paper),FabioCicoira,EcolePolytechniquedeMontréal(Canada) . . . [8479-25]
SESSION 7 . . . . . . . . . . . . . . . . . . . . . . . . Thurs. 3:30 to 5:00 pm
Organic Semiconductors in Sensors and Biotechnology VIISession Chair: Joseph Shinar, AmesLab.(UnitedStates)
Development of multisensing plastic microelectrodes for neural recordings,EsmaIsmailova,ThomasDoublet,DionKhodagholy,EcoleNationaleSupérieuredesMinesdeSaint-Étienne(France);PasclaeQuilichini,Univ.delaMéditerranée(France);PierreLeleux,SebastianSanaur,EcoleNationaleSupérieuredesMinesdeSaint-Étienne(France);ChristopheBernard,Univ.delaMéditerranée(France);GeorgeG.Malliaras,EcoleNationaleSupérieuredesMinesdeSaint-Étienne(France). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8479-26]
Development of an electrochemical sensor for parallel screening of microRNA levels (Invited Paper),MarisaC.Buzzeo,EileenSmith,BarnardCollege(UnitedStates);ZeynepBasaran,ColumbiaUniv.(UnitedStates);JanetLee,BarnardCollege(UnitedStates);NanetteJarenwattananon,Univ.ofCalifornia,LosAngeles(UnitedStates);IoannisKymissis,ColumbiaUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8479-27]
Biosensors based on organic electrochemical transistors (Invited Paper),FengYan,TheHongKongPolytechnicUniv.(HongKong,China). . . . [8479-28]
Biosensors based on solution-processable materials (Invited Paper),GiuseppeScarpa,TechnischeUniv.München(Germany). . . . . . . . . . [8479-29]
Conference 8479
100 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Special Program 8480 The Nature of Light: Light in Nature IV (Liang). . . . . . . . . 103
8481 Optics Education and Outreach II (Gregory) . . . . . . . . . . . 104
NEW8482 Photonic Innovations and Solutions for Complex
Environments and Systems (PISCES)(Lakhtakia/Todd) .106
8483 Tribute to William Wolfe (Turner) . . . . . . . . . . . . . . . . . . . . . 107
Illumination Engineering Program Chair:Ian T. Ferguson,TheUniv.ofNorthCarolinaatCharlotte(USA)
8484 Twelfth International Conference on Solid State Lighting and Fourth International Conference on White LEDs and Solid State Lighting(Kane/Wetzel/Huang/Ferguson)............................. 108
8485 Nonimaging Optics: Efficient Design for Illumination and Solar Concentration IX(Winston/Gordon) . . . . 111
Optical Design and Systems EngineeringProgram Chairs: José Sasián, CollegeofOpticalSciences,TheUniv.ofArizona(USA)andR. John Koshel, PhotonEngineeringLLC(USA)andCollegeofOpticalSciences,TheUniv.ofArizona(USA)
8486 Current Developments in Lens Design and Optical Engineering XIII(Johnson/Mahajan/Thibault) . . . . . . . . . 113
8487 Novel Optical Systems Design and Optimization XV(Gregory/Davis). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 116
NEW 8488 Zoom Lenses IV(Betensky/Yamanashi) . . . . . . . . . . . . . . . 119
8489 Polymer Optics and Molded Glass Optics: Design, Fabrication, and Materials III(Krevor/Beich/Schaub/Bäumer) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 121
8490 Laser Beam Shaping XIII(Forbes/Lizotte) . . . . . . . . . . . . . 123
8491 Optical System Alignment, Tolerancing, and Verification VI(Sasián/Youngworth). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 124
8492 Optical System Contamination: Effects, Measurements, and Control 2012(Straka/Carosso/Egges) . . . . . . . . . . . 126
8485 Nonimaging Optics: Efficient Design for Illumination and Solar Concentration IX(Winston/Gordon) . . . . 111
Watch for this icon next to conferences and courses discussing innovative ways to help our planet.
GREEN PHOTONICS
SPIE Optics + Photonics is a leading conference on green photonics technologies such as energy, sustainability, conservation, and environmental monitoring.
Optical Engineering+ ApplicationsSPIEOptics+Photonics
Thepremierconferenceforthelatestdevelopmentsinopticaldesignandengineering,photonicdevices,aswellasspaceopticalsystems,x-ray/EUVoptics,remotesensing,informationprocessing,solidstatelighting,andmore.
- Optical Engineering- Lens Design- Metrology- Photonic Devices, and Current
Applications
spie.org/opadvance · TEL:+13606763290 · help@spie.org 101
Advanced Metrology Program Chair: Katherine Creath,Optineering(USA)andCollegeofOpticalSciences,TheUniv.ofArizona(USA)
8493 Interferometry XVI: Techniques and Analysis (Schmit/Creath/Towers). . . . . . . . . . . . . . . . . . . . . . . . . . . . . 127
8494 Interferometry XVI: Applications(Furlong/Gorecki/Novak)130
8495 Reflection, Scattering, and Diffraction from Surfaces III(Hanssen). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 132
8466 Instrumentation, Metrology, and Standards for Nanomanufacturing, Optics, and Semiconductors VI(Postek) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .64
8501 Advances in Metrology for X-Ray and EUV Optics IV (Assoufid/Takacs/Asundi). . . . . . . . . . . . . . . . . . . . . . . . . . . . 147
Photonic Devices and Applications8496 Terahertz Emitters, Receivers, and Applications III
(Razeghi/Baranov/Everitt/Zavada/Manzur) . . . . . . . . . . . . . . 134
8497 Photonic Fiber and Crystal Devices: Advances in Materials and Innovations in Device Applications VI(Yin/Guo). . . . 136
8484 Twelfth International Conference on Solid State Lighting and Fourth International Conference on White LEDs and Solid State Lighting(Kane/Wetzel/Huang/Ferguson). . . . 108
8512 Infrared Sensors, Devices, and Applications II(LeVan/Sood/Wijewarnasuriya/D’Souza) . . . . . . . . . . . . . . . . . . . . . 172
Image and Signal Processing Program Chair:Khan M. Iftekharuddin,OldDominionUniv.(USA)
8498 Optics and Photonics for Information Processing VI (Awwal/Iftekharuddin) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 139
8499 Applications of Digital Image Processing XXXV(Tescher)141
8500 Image Reconstruction from Incomplete Data VII(Bones/Fiddy/Millane) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 144
X-Ray, Gamma-Ray, and Particle Technologies Program Chair:Carolyn A. MacDonald,Univ.atAlbany(USA)
8501 Advances in Metrology for X-Ray and EUV Optics IV(Assoufid/Takacs/Asundi). . . . . . . . . . . . . . . . . . . . . . . . . . . 146
8502 Advances in X-Ray/EUV Optics and Components VII(Goto/Morawe/Khounsary) . . . . . . . . . . . . . . . . . . . . . . . . . . 148
8503 Adaptive X-Ray Optics II(Khounsary/O’Dell/Bifano). . . . . 150
NEW8504 X-Ray Free-Electron Lasers: Beam Diagnostics, Beamline
Instrumentation, and Applications(Hau-Riege/Moeller/Yabashi) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 152
NEW8505 Target Diagnostics Physics and Engineering for Inertial
Confinement Fusion(Bell/Grim). . . . . . . . . . . . . . . . . . . . . 154
8506 Developments in X-Ray Tomography VIII(Stock). . . . . . 156
8507 Hard X-Ray, Gamma-Ray, and Neutron Detector Physics XIV (James/Burger/Franks/Fiederle). . . . . . . . . . . . . . . . . . . 159
8508 Medical Applications of Radiation Detectors II(Barber/Roehrig) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 162
8509 Penetrating Radiation Systems and Applications XIII (Grim/Barber). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 164
Remote Sensing Program Chair: Allen H.-L. Huang,Univ.ofWisconsin-Madison(USA)
8510 Earth Observing Systems XVII(Butler/Xiong/Gu). . . . . . . 166
8511 Infrared Remote Sensing and Instrumentation XX(Strojnik/PaezPadilla) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 169
8512 Infrared Sensors, Devices, and Applications II(LeVan/Sood/Wijewarnasuriya/D’Souza). . . . . . . . . . . . . . . 172
8513 Remote Sensing and Modeling of Ecosystems for Sustainability IX (Gao/Jackson). . . . . . . . . . . . . . . . . 174
8514 Satellite Data Compression, Communications, and Processing VIII(Huang/Plaza/Thiebaut). . . . . . . . . . . . . . . 176
8515 Imaging Spectrometry XVII(Shen/Lewis) . . . . . . . . . . . . . 178
8516 Remote Sensing System Engineering IV (Ardanuy/Puschell) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 180
Atmospheric and Space Optical Systems Program Chairs: Stephen M. Hammel,SpaceandNavalWarfareSystemsCommand(USA)andAlexander M. J. van Eijk, TNODefence,SecurityandSafety(Netherlands)
8517 Laser Communication and Propagation through the Atmosphere and Oceans(vanEijk/Davis/Hammel/Majumdar). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 181
8518 Quantum Communications and Quantum Imaging X (Meyers/Shih/Deacon) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 183
8519 Nanophotonics and Macrophotonics for Space Environments VI(Taylor/Cardimona). . . . . . . . . . . . . . . . . . 185
8520 Unconventional Imaging and Wavefront Sensing VIII (Dolne/Karr/Gamiz). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 187
8521 Instruments, Methods, and Missions for Astrobiology XV (Hoover/Levin/Rozanov/Davies) . . . . . . . . . . . . . . . . . . . . . . 189
102 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Executive Organizing Committee Katherine Creath, Optineering(USA)andCollegeof
OpticalSciences,TheUniv.ofArizona(USA)Ian T. Ferguson,TheUniv.ofNorthCarolinaat
Charlotte(USA)Stephen M. Hammel, SpaceandNavalWarfare
SystemsCommand(USA)Allen H.-L. Huang,Univ.ofWisconsin-Madison(USA)Khan M. Iftekharuddin, TheUniv.ofMemphis(USA)R. John Koshel, PhotonEngineeringLLC(USA)and
CollegeofOpticalSciences,TheUniv.ofArizona(USA)
Carolyn A. MacDonald, Univ.atAlbany(USA)José Sasián, CollegeofOpticalSciences,TheUniv.of
Arizona(USA)Alexander M. J. van Eijk, TNODefence,Securityand
Safety(Netherlands)
Technical Organizing CommitteePhilip E. Ardanuy, RaytheonIntelligence&Information
Systems(USA)Lahsen Assoufid, ArgonneNationalLab.(USA)Anand K. Asundi, NanyangTechnologicalUniv.
(Singapore)Abdul A. S. Awwal, LawrenceLivermoreNationalLab.
(USA)Alexei N. Baranov,Univ.Montpellier2(France)H. Bradford Barber, CollegeofOpticalSciences,The
Univ.ofArizona(USA)Stefan M. Bäumer,PhilipsLightingB.V.(Netherlands)William S. Beich,G-SPlasticOptics(USA)Perry Bell, LawrenceLivermoreNationalLab.(USA)Ellis I. Betensky, Consultant(Canada)Thomas G. Bifano,BostonUniv.(USA)Philip J. Bones, Univ.ofCanterbury(NewZealand)Arnold Burger, FiskUniv.(USA)James J. Butler,NASAGoddardSpaceFlightCtr.
(USA)David A. Cardimona, AirForceResearchLab.(USA)Nancy Carosso,NASAGoddardSpaceFlightCtr.
(USA)Katherine Creath, Optineering(USA)andCollegeof
OpticalSciences,TheUniv.ofArizona(USA)Paul C. W. Davies,ArizonaStateUniv.(USA)Christopher C. Davis, Univ.ofMaryland,CollegePark
(USA)Arthur J. Davis, ReflexiteEnergySolutions(USA)Keith S. Deacon,U.S.ArmyResearchLab.(USA)Jean J. Dolne,TheBoeingCo.(USA)Arvind I. D’Souza, DRSSensors&TargetingSystems,
Inc.(USA)Joanne Egges, BallAerospace&TechnologiesCorp.
(USA)Henry O. Everitt, U.S.ArmyAviationandMissile
ResearchDevelopmentandEngineeringCtr.(USA)Ian T. Ferguson,TheUniv.ofNorthCarolinaat
Charlotte(USA)
Michael A. Fiddy,TheUniv.ofNorthCarolinaatCharlotte(USA)
Michael Fiederle, Albert-Ludwigs-Univ.Freiburg(Germany)
Andrew Forbes, CSIRNationalLaserCtr.(SouthAfrica)andUniv.ofKwaZulu-Natal(SouthAfrica)
Larry A. Franks,Consultant(USA)Cosme Furlong, WorcesterPolytechnicInstitute
(USA)Victor L. Gamiz, AirForceResearchLab.(USA)Wei Gao, ColoradoStateUniv.(USA)Jeffrey M. Gordon, Ben-GurionUniv.oftheNegev
(Israel)Christophe Gorecki, FEMTO-ST(France)Shunji Goto,JapanSynchrotronRadiationResearch
Institute(Japan)G. Groot Gregory,Synopsys,Inc.(USA)Gary P. Grim,LosAlamosNationalLab.(USA)Xingfa Gu, InstituteofRemoteSensingApplications
(China)Ruyan Guo, TheUniv.ofTexasatSanAntonio(USA)Stephen M. Hammel, SpaceandNavalWarfare
SystemsCommand(USA)Leonard M. Hanssen, NationalInstituteofStandards
andTechnology(USA)Stefan P. Hau-Riege, LawrenceLivermoreNational
Lab.(USA)Richard B. Hoover, NASAMarshallSpaceFlightCtr.
(USA)Bormin Huang,Univ.ofWisconsin-Madison(USA)Jian-Jang Huang,NationalTaiwanUniv.(Taiwan)Khan M. Iftekharuddin, OldDominionUniv.(USA)Thomas J. Jackson, U.S.Dept.ofAgriculture(USA)Ralph B. James, BrookhavenNationalLab.(USA)R. Barry Johnson, AlabamaA&MUniv.(USA)and
Consultant(USA)Matthew H. Kane, TheUniv.ofOklahoma(USA)Thomas J. Karr,RaytheonSpace&AirborneSystems
(USA)Ali M. Khounsary, ArgonneNationalLab.(USA)David H. Krevor, TactusTechnology,Inc.(USA)Akhlesh Lakhtakia, ThePennsylvaniaStateUniv.
(USA)Paul D. LeVan, AirForceResearchLab.(USA)Gilbert V. Levin, ArizonaStateUniv.(USA)Paul E. Lewis, NationalGeospatial-Intelligence
Agency(USA)Rongguang Liang, CollegeofOpticalSciences,The
Univ.ofArizona(USA)Todd E. Lizotte,HitachiViaMechanics(USA),Inc.
(USA)H. Angus Macleod, ThinFilmCenter,Inc.(USA)Virendra N. Mahajan, TheAerospaceCorp.(USA)Arun K. Majumdar, NavalAirWarfareCtr.Weapons
Div.(USA)Tariq Manzur, NavalUnderseaWarfareCtr.(USA)Ronald E. Meyers, U.S.ArmyResearchLab.(USA)Rick P. Millane, Univ.ofCanterbury(NewZealand)
Stefan P. Moeller,SLACNationalAcceleratorLab.(USA)Christian Morawe, EuropeanSynchrotronRadiation
Facility(France)Erik L. Novak,BrukerAXS,Inc.(USA)Steve L. O’Dell, NASAMarshallSpaceFlightCtr.(USA)Gonzalo Paez Padilla,Ctr.deInvestigacionesen
Óptica,A.C.(Mexico)Antonio J. Plaza, Univ.deExtremadura(Spain)Jeffery J. Puschell, RaytheonSpace&Airborne
Systems(USA)Manijeh Razeghi, NorthwesternUniv.(USA)Hans Roehrig, ArizonaHealthSciencesCtr.,TheUniv.
ofArizona(USA)Alexei Yu. Rozanov,PaleontologicalInstitute(Russian
Federation)José Sasián,CollegeofOpticalSciences,TheUniv.of
Arizona(USA)Michael P. Schaub, RaytheonMissileSystems(USA)Joanna Schmit, BrukerNanoSurfacesDivision(USA)Sylvia S. Shen,TheAerospaceCorp.(USA)Yanhua Shih, Univ.ofMaryland,BaltimoreCounty(USA)Ashok K. Sood, MagnoliaOpticalTechnologies,Inc.
(USA)Stuart R. Stock,NorthwesternUniv.(USA)Sharon A. Straka,NASAGoddardSpaceFlightCtr.
(USA)Marija Strojnik, Ctr.deInvestigacionesenÓptica,A.C.
(Mexico)Peter Z. Takacs,BrookhavenNationalLab.(USA)Edward W. Taylor, InternationalPhotonicsConsultants,
Inc.(USA)Andrew G. Tescher, AGTAssociates(USA)Simon Thibault, ImmerVision(Canada)andUniv.Laval
(Canada)Carole Thiebaut,Ctr.Nationald’ÉtudesSpatiales
(France)Judith A. Todd, ThePennsylvaniaStateUniv.(USA)Catherine E. Towers, Univ.ofLeeds(UnitedKingdom)Mary G. Turner, BreaultResearchOrganization,Inc.
(USA)Alexander M. J. van Eijk, TNODefence,Securityand
Safety(Netherlands)Christian Wetzel,RensselaerPolytechnicInstitute(USA)Priyalal S. Wijewarnasuriya, U.S.ArmyResearchLab.
(USA)Roland Winston,Univ.ofCalifornia,Merced(USA)Xiaoxiong Xiong, NASAGoddardSpaceFlightCtr.
(USA)Makina Yabashi, RIKEN(Japan)Takanori Yamanashi, PanavisionInternationalLLC
(USA)Shizhuo Yin, ThePennsylvaniaStateUniv.(USA)Richard N. Youngworth, RiyoLLC(USA)John M. Zavada, NationalScienceFoundation(USA)Contents
Optical Engineering+ ApplicationsSPIEOptics+Photonics
spie.org/opadvance · TEL:+13606763290 · help@spie.org 103
Conference 8480Monday 13 August 2012 • Proceedings of SPIE Vol. 8480
The Nature of Light: Light in Nature IVConference Chair:Rongguang Liang, CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates)
Program Committee:Katherine Creath, Optineering(UnitedStates)andCollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates);Joseph A. Shaw, MontanaStateUniv.(UnitedStates);Mitsuo Takeda, TheUniv.ofElectro-Communications(Japan);Jean-Pol Vigneron, FacultesUniv.NotreDamedelaPaix(Belgium);Wei Wang, Heriot-WattUniv.(UnitedKingdom);Qiwen Zhan, Univ.ofDayton(UnitedStates)
Monday 13 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . .Mon. 8:30 to 10:10 am
Color in NatureSession Chair: Joseph A. Shaw, MontanaStateUniv.(UnitedStates)
Structurally coloured fibers in nature (Invited Paper),PriscillaSimonis,FacultesUniv.NotreDamedelaPaix(Belgium);JeanPolVigneron,FacultesUniv.NotreDamedelaPaix(UnitedStates)..................... [8480-01]
Additive photonic colors in the Brazilian diamond weevil: Entimus imperialis,SébastienR.Mouchet,Jean-PolVigneron,Jean-FrançoisColomer,CédricVandenbem,OlivierDeparis,FacultesUniv.NotreDamedelaPaix(Belgium). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8480-02]
Structural colouration in the Hymenoptera: ‘early’ studies of a neglected group,VictoriaL.Welch,MichaëlSarrazin,PriscillaSimonis,Jean-PolVigneron,FacultesUniv.NotreDamedelaPaix(Belgium). . . . . . . . . . . . . . . . . . [8480-03]
Aperiodic multilayer designs in the structural colors of natural systems (Invited Paper),ShinyaYoshioka,OsakaUniv.(Japan). . . . . . . . . . . . . [8480-04]
SESSION 2 . . . . . . . . . . . . . . . . . . . . Mon. 10:30 am to 12:10 pm
Nature of LightSession Chair: Jean Pol Vigneron, FacultesUniv.NotreDamedela
Paix(Belgium)
Accurate expressions for gravitational light deflection: implications for anisotropy of curved space,SinaKhorasani,GeorgiaInstituteofTechnology(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8480-05]
Single photons with orbital angular momentum,MichaelMazilu,Univ.ofSt.Andrews(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8480-06]
A new theory for electromagnetic radiation based on classical electrostatics contradicting Maxwell’s electromagnetism,JanOlofJonson,StockholmUniv.(Sweden) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8480-07]
Observation of spatial polarization structure near unfolding point of an optical vortex beam using a birefringent Mach-Zehnder interferometer,MaruthiM.Brundavanam,YokoMiyamoto,TheUniv.ofElectro-Communications(Japan);RakeshK.Singh,IndianInstituteofSpaceScienceandTechnology(India);DineshN.Naik,MitsuoTakeda,Ken’ichiNakagawa,TheUniv.ofElectro-Communications(Japan). . . . . . . . . . . . . . . . . . . . . . . [8480-08]
Transversal energy currents in optical fields: measurement of the Poynting vector components,KaterynaS.Kharytonova,IgorI.Mokhun,JuliaY.Viktorovskaya,YuriyK.Galushko,YuriyFedkovychChernivtsiNationalUniv.(Ukraine) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8480-09]
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:10to1:10pm
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 1:10 to 2:00 pm
Optics in ArtSession Chair: Katherine Creath, CollegeofOpticalSciences,The
Univ.ofArizona(UnitedStates)andOptineering(UnitedStates)
The science of optics: recent revelations about the history of art (Invited Paper),CharlesFalco,TheUniv.ofArizona(UnitedStates). . . . . . . . . [8480-10]
Towards an optical non-destructive analysis of paintings: Role of pigment size and layer roughness, application to Malachite,RaphaelleJarrige,ChristineAndraud,JacquesLafait,Univ.PierreetMarieCurie(France);MyriamEveno,MichelMenu,Ctr.deRechercheetdeRestaurationdesMuséesdeFrance(France);NunoDiniz,GlaizerGroup(France). . . . . . . . . . . . . . [8480-11]
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 2:00 to 3:30 pm
Light in NatureSession Chair: Katherine Creath, CollegeofOpticalSciences,The
Univ.ofArizona(UnitedStates)andOptineering(UnitedStates)
Crepuscular rays (Invited Paper),StanleyD.Gedzelman,CityCollegeofNewYork(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8480-12]
CauStereo: range from light in nature (Invited Paper),YohaySwirski,YoavSchechner,BenHerzberg,Technion-IsraelInstituteofTechnology(Israel);ShahriarNegahdaripour,Univ.ofMiami(UnitedStates) . . . . . . . . . . . [8480-13]
Recent rainbow revelations (Invited Paper),RobertGreenler,Univ.ofWisconsin-Milwaukee(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . [8480-14]
SESSION 5 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 4:00 to 5:30 pm
Bio-Inspired Optics and Optics in NatureSession Chair: Rongguang Liang, CollegeofOpticalSciences,The
Univ.ofArizona(UnitedStates)
Biological and bio-inspired photonic systems (Invited Paper),MathiasKolle,JoannaAizenberg,HarvardUniv.(UnitedStates). . . . . . . . . . . . . . . . . [8480-15]
How to improve light extraction: what fireflies suggest,AnnickBay,FacultesUniv.NotreDamedelaPaix(Belgium);JeanPolVigneron,Univ.ofNamur(Belgium). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8480-16]
Optical reflectance and transmittance of photonic polycrystalline structures from living organisms,Jean-PolVigneron,AnnickBay,Jean-FrançoisColomer,EloiseVanHooijdonk,PriscillaSimonis,Univ.ofNamur(Belgium) . . . [8480-17]
Role of multi-scale structure in the optical properties of Morpho butterfly wings,CorentinMonmeyran,ChristineAndraud,SergeBerthier,JacquesLafait,Univ.PierreetMarieCurie(France) . . . . . . . . . . . . . . . . . . . . . . . . . . . [8480-18]
Posters-Monday . . . . . . . . . . . . . . . . . . . . Mon. 5:30 to 7:30 pmConference attendees are invited to attend the poster session on Monday
evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
About luminiferous world ether,PetroO.Demianenko,YuriF.Zinkovsky,LeonidP.Dyuzhaev,NationalTechnicalUniv.ofUkraine(Ukraine). . . [8480-19]
104 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Conference 8481Sunday-Monday 12-13 August 2012 • Proceedings of SPIE Vol. 8481
Optics Education and Outreach IIConference Chair:G. Groot Gregory, Synopsys,Inc.(UnitedStates)
Program Committee:Anna Consortini, Univ.degliStudidiFirenze(Italy);Barbara A. Darnell, ScinTech(UnitedStates);Judith Donnelly, ThreeRiversCommunityCollege(UnitedStates);Robert Fischer, UFAL(Brazil);Ryan M. Hannahoe, MontanaStateUniv.(UnitedStates);Nancy J. Magnani, EASTCONN(UnitedStates);Brian Monacelli, theOpticalSciencesCompany(tOSC)(UnitedStates)andIrvineValleyCollege(UnitedStates);Joseph J. Niemela, TheAbdusSalamInternationalCtr.forTheoreticalPhysics(Italy);Kathleen B. Robinson, SPIE(UnitedStates);José Sasián, CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates);Donn Michael Silberman, PI(PhysikInstrumente)L.P.(UnitedStates);Alexander R. Small, CaliforniaStatePolytechnicUniv.,Pomona(UnitedStates);Cristina Solano, Ctr.deInvestigacionesenÓptica,A.C.(Mexico);Maria Josefa Yzuel, Univ.AutònomadeBarcelona(Spain)
Sunday 12 AugustIntroduction . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 8:30 to 8:50 am
Session Chair: Cristina Solano Sosa, Ctr.deInvestigacionesenÓptica,A.C.(Mexico)
On the role of professional associations in optics and photonics education,MarcNantel,NiagaraCollegeCanada(Canada);KathleenRobinson,SPIE(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8481-01]
SESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 8:50 to 10:10 am
Training ProgramsSession Chair: Cristina Solano Sosa, Ctr.deInvestigacionesenÓptica,
A.C.(Mexico)
New teaching methods in use at UC Irvine’s Optical Engineering and Instrument Design programs,DonnM.Silberman,PI(PhysikInstrumente)L.P.(UnitedStates)andOpticsInstituteofSouthernCalifornia(UnitedStates)andUniversityofCalifornia,Irvine(UnitedStates);T.ScottRowe,RoweTechnicalDesign(UnitedStates)andUniversityofCalifornia,Irvine(UnitedStates);DavidDimas,Univ.ofCalifornia,Irvine(UnitedStates);JoshuaJo,SyprosoftEngineering(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8481-02]
Preparing technicians for photonics industries and organizations,DanielM.Hull,OP-TECNationalCtr.forOpticsandPhotonicsEducation(UnitedStates);JohnSouders,OP-TECNationalCtr.forOpticsandPhotonicsEducation(UnitedStates)andUniversityofCentralFlorida(UnitedStates) . . . . . . . . . . . [8481-03]
Fibre-based optical sensing in interdisciplinary school lab,RogerioFernandesSouza,IFAL(Brazil);EduardoJorgedaSilvaFonseca,JandirMiguelHickmann,RobertFischer,Univ.FederaldeAlagoas(Brazil). . . . . . . . [8481-04]
Industry-based projects in photonics technician education,JudithDonnelly,ThreeRiversCommunityCollege(UnitedStates);NicholasMassa,SpringfieldTechnicalCommunityCollege(UnitedStates);FlemmingTinker,ApertureOpticalSciencesInc.(UnitedStates);GiovanniTomasi,RSLFiberSystems(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8481-05]
SESSION 2 . . . . . . . . . . . . . . . . . . . . . Sun. 10:40 am to 12:10 pm
Accreditation and CertificationSession Chair: Alexander R. Small, CaliforniaStatePolytechnicUniv.,
Pomona(UnitedStates)
ABET accreditation and optics and photonics engineering: An association whose time has come (Invited Paper),BarryL.Shoop,U.S.MilitaryAcademy(UnitedStates);KathleenB.Robinson,SPIE(UnitedStates). . . . . . . . [8481-06]
Meeting evolving technology education challenges in photonics and optics,WilliamR.Woodward,UrasNav(UnitedStates). . . . . . . . . . . . . . . . . . [8481-07]
Benefits of engineering accreditation in optics and photonics,ScottW.Teare,NewMexicoInstituteofMiningandTechnology(UnitedStates)[8481-08]
ABET’s international activities: global quality assurance (Presentation Only),MichaelK.J.Milligan,ABET(UnitedStates). . . . . . . . . . . . . . . . . . . . . [8481-09]
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:10to1:30pm
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 1:30 to 3:10 pm
Program DevelopmentSession Chair: Judith Donnelly, ThreeRiversCommunityCollege
(UnitedStates)
Research-centric project-based learning of optomechanical design,KeithKasunic,MarcusBagnell,JeffD’Archangel,AlexanderW.Dillard,KyleM.Douglass,M.S.Mills,DanOtt,VictoriyaRelina,BenjaminWebb,CREOL,TheCollegeofOpticsandPhotonics,Univ.ofCentralFlorida(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8481-10]
Modules to enhance smart lighting education,RobertM.Bunch,CharlesJoenathan,Rose-HulmanInstituteofTechnology(UnitedStates);KennethA.Connor,RensselaerPolytechnicInstitute(UnitedStates);MohamedChouikha,HowardUniv.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8481-11]
The development of a light and color teaching kit for astronomy,RobertT.Sparks,NationalOpticalAstronomyObservatory(UnitedStates);ConstanceE.Walker,StephenM.Pompea,NationalOpticalAstronomyObsevatory(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8481-12]
Teaching Fraunhofer diffraction via experimental and simulated images in the laboratory,AlbaPeinado,Univ.AutònomadeBarcelona(Spain);JosepVidal,CELLS-ALBA(Spain)andUniversitatAutònomadeBarcelona(Spain);JuanCarlosEscalera,AngelLizana,JuanCampos,MaríaJ.Yzuel,Univ.AutònomadeBarcelona(Spain). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8481-13]
The development of an innovative ecophotonics/illumination engineering education program for grades 3-12,ConstanceE.Walker,StephenM.Pompea,RobertT.Sparks,NationalOpticalAstronomyObservatory(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8481-14]
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 3:40 to 5:40 pm
K12 EducationSession Chair: Donn Michael Silberman, PI(PhysikInstrumente)L.P.
(UnitedStates)
Optics education through the Arizona Galileoscope program,StephenM.Pompea,RobertSparks,ConstanceWalker,NationalOpticalAstronomyObservatory(UnitedStates);ErinDokter,TheUniv.ofArizona(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8481-15]
Turning Eyes to the Big Sky Project: learning optics in middle-school,MaryJ.Leonard,RyanM.Hannahoe,GustavE.Nollmeyer,MontanaStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8481-16]
Changing the way photonics is taught at school,NinaCords,Univ.ofKiel(Germany);RobertFischer,Univ.FederaldeAlagoas(Brazil);ManfredEuler,Univ.ofKiel(Germany). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8481-17]
Lessons learned from student outreach: introducing optics to fifth graders,NancyJ.Magnani,Eastconn(UnitedStates);MatthewDonnelly,GregoryMahan,TiffanyRossi,ThreeRiversCommunityCollege(UnitedStates) . . . . . [8481-18]
spie.org/opadvance · TEL:+13606763290 · help@spie.org 105
Teenagers science club,AntonioCampos,CristinaSolano,Ctr.deInvestigacionesenÓptica,A.C.(Mexico). . . . . . . . . . . . . . . . . . . . . . . [8481-19]
Better teaching through keeping quiet: peer instruction in the physics classroom,JamesM.Fraser,Queen’sUniv.(Canada). . . . . . . . . . . . [8481-20]
Symposium-Wide Plenary Session . . . . . . . . . . . . . . . . . . . . Sun. 6:00 to 7:25 pm6:00pm: Introduction and Opening Remarks
6:05pm: The Exciting Science of Light with Metamaterials, VladimirM.Shalaev,PurdueUniv.(USA)
6:45pm:Future of Optics and Photonics, BahaaE.A.Saleh,CREOL,TheCollegeofOpitcsandPhotonicsattheUniv.ofCentralFlorida(USA)
Monday 13 AugustSESSION 5 . . . . . . . . . . . . . . . . . . . . . . . . .Mon. 8:00 to 10:10 am
Educational Outreach ISession Chair: Ryan M. Hannahoe, MontanaStateUniv.(UnitedStates)
The optics of Jan van Eyck and Ibn al-Haytham (Invited Paper),CharlesM.Falco,TheUniv.ofArizona(UnitedStates). . . . . . . . . . . . . . . . . . . . . . [8481-21]
The Rochester OSA Optics Suitcase: 13 years of middle school outreach,CristinaCanavesi,TheresaM.Donlon,StephenD.Jacobs,Univ.ofRochester(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8481-22]
Careers in optics project: building around existing resources,Anne-SophiePoulin-Girard,GabrielleThériault,Univ.Laval(Canada);VéroniqueZambon,Ctr.d’optique,photoniqueetlaser(Canada). . . . . . . . . . . . . . . . . . . . . . . . [8481-23]
Outreach facilities within a research center,VéroniqueZambon,GabrielleThériault,Ctr.d’optique,photoniqueetlaser(Canada);Anne-SophiePoulin-Girard,Univ.Laval(Canada). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8481-24]
Science workshops in isolated communities in the state of Guanajuato, Mexico,CristinaSolano,AntonioCampos,EleonorLeon,Ctr.deInvestigacionesenÓptica,A.C.(Mexico). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8481-25]
Family Optics Day: an optics outreach event for the general public,KatherineCalabro,BostonUniv.(UnitedStates) . . . . . . . . . . . . . . . . . [8481-26]
SESSION 6 . . . . . . . . . . . . . . . . . . . . Mon. 10:40 am to 12:00 pm
Educational Outreach IISession Chair: Robert Fischer, UFAL(Brazil)
Southern California’s optics outreach programs grow in several areas: mentoring student chapters, using the web, the local science center, and community college,DonnM.Silberman,PI(PhysikInstrumente)L.P.(UnitedStates);BrianMonacelli,theOpticalSciencesCompany(tOSC)(UnitedStates);RobertCartland,FemtoMetrix(UnitedStates);AlexSmall,CaliforniaStatePolytechnicUniv.,Pomona(UnitedStates);T.ScottRowe,RoweTechnicalDesign(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8481-27]
Holography demonstrations and workshops for science and engineering outreach,WestonThomas,KevinKruse,ChristopherMiddlebrook,MichiganTechnologicalUniv.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . [8481-28]
Multispectral imaging system on tethered balloons for optical remote sensing education and outreach,JosephA.Shaw,PaulW.Nugent,NathanKaufman,NathanJ.Pust,DevinMikes,CassieKnierim,NathanFaulconer,RandyM.Larimer,AngelaDesJardins,MontanaStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8481-29]
History of optics: a modern teaching tool,DanielVazquez,AgustinGonzalez-Cano,NataliaDiaz-Herrera,NuriaLlombart,JavierAlda,Univ.ComplutensedeMadrid(Spain). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8481-30]
Posters-Monday . . . . . . . . . . . . . . . . . . . . Mon. 5:30 to 7:30 pmConference attendees are invited to attend the poster session on Monday
evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
Looking at light through a pinhole,NancyJ.Magnani,Eastconn(UnitedStates);MatthewDonnelly,ThreeRiversCommunityCollege(UnitedStates);KarenNeville,Eastconn(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . [8481-31]
Teaching conic properties using optics: outreach activity,GibrahamA.Graciano-Armenta,ClaudiaI.García-Gil,Ctr.deInvestigaciónCientíficaydeEducaciónSuperiordeEnsenada(Mexico) . . . . . . . . . . . . . . . . . . . . . [8481-32]
Optical design teaching by computing graphic methods,DanielVazquez,JavierMuñoz,AntonioAlvarez-Fernandez-Balbuena,Univ.ComplutensedeMadrid(Spain);AngelGarcia-Botella,Univ.PolitécnicadeMadrid(Spain);PaolaBellloni,HochschuleFurtwangenUniv.(Germany);JavierAlda,Univ.ComplutensedeMadrid(Spain). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8481-33]
Development of low cost optical fiber kit to promote fiber-optics at the school level,AmitGarg,PratikChakravarty,DevenderDhawan,ShahAlam,RajKeshri,ParveenJha,ReenaSharma,VishalDhingra,AcharyaNarendraDevCollege(India). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8481-34]
Design, construction, and implementation of a ground-based solar spectrograph for the National Student Solar Spectrograph Competition,CourtneyPeck,EthanKeeler,DrewMoen,ChrisZimny,KevinS.Repasky,MontanaStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . [8481-35]
National Student Solar Spectrograph Competition overview,RandalM.Larimer,AngelaC.DesJardins,MontanaSpaceGrantConsortium(UnitedStates);JosephA.Shaw,CharlesC.Kankelborg,MontanaStateUniv.(UnitedStates);ChristopherPalmer,RichardsonGratings™,aNewportCorp.Brand(UnitedStates);LarrySpringer,MontanaStateUniv.(UnitedStates);JoeyKey,MontanaSpaceGrantConsortium(UnitedStates);W.BerkKnighton,KevinS.Repasky,NathanJ.Pust,MontanaStateUniv.(UnitedStates);MitchellK.Hobish,ScientialConsultingLLC(UnitedStates);EdmondW.Wilson,Jr.,HardingUniv.(UnitedStates);CarrieFitzgerald,RyanFitzgerald,MontgomeryCollege(UnitedStates);ThomasTrickel,SalishKootenaiCollege(UnitedStates);ClydeJensen,SkyeDorsett,MountHoodCommunityCollege(UnitedStates);MattAnderson,SanDiegoStateUniv.(UnitedStates);JimBoger,FlatheadValleyCommunityCollege(UnitedStates);NateMcCrady,JayleneNaylor,TheUniv.ofMontana(UnitedStates);LaurieBattle,MontanaTech(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8481-36]
Conference 8481
106 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Conference 8482 · NEWSunday 12 August 2012 • Proceedings of SPIE Vol. 8482
Photonic Innovations and Solutions for Complex Environments and Systems (PISCES)Conference Chairs:Akhlesh Lakhtakia, ThePennsylvaniaStateUniv.(UnitedStates);Judith A. Todd, ThePennsylvaniaStateUniv.(UnitedStates)
Sunday 12 AugustWelcome and Opening Remarks . . . . . . . . Sun. 8:00 to 8:05 am
Akhlesh Lakhtakia, ThePennsylvaniaStateUniv.(UnitedStates); Judith A. Todd, ThePennsylvaniaStateUniv.(UnitedStates)
SESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 8:05 to 10:15 am
Session 1Session Chairs: Akhlesh Lakhtakia, ThePennsylvaniaStateUniv.
(UnitedStates);Judith A. Todd, ThePennsylvaniaStateUniv.(UnitedStates)
Science and technology’s role in a world of increasing challenges,MathewJ.Burrows,Counselor,NationalIntelligenceCouncil(UnitedStates) . [8482-01]
Coupling the academic research enterprise to the innovation economy,MJSoileau,Univ.ofCentralFloridaOfficeofResearch&Commercialization(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8482-02]
Photonics and plasmonics applied to solar cells,StephenJ.Fonash,WookJunNam,SolarityLLC(UnitedStates)andThePennsylvaniaStateUniv.(UnitedStates);LimingJi,VasundaraVaradan,Univ.ofArkansas(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8482-03]
Innovative paths for providing green energy for sustainable global economic growth,RajendraSingh,ClemsonUniv.(UnitedStates). . [8482-04]
SESSION 2 . . . . . . . . . . . . . . . . . . . . . Sun. 10:35 am to 12:40 pm
Session 2Session Chairs: Akhlesh Lakhtakia, ThePennsylvaniaStateUniv.
(UnitedStates);Judith A. Todd, ThePennsylvaniaStateUniv.(UnitedStates)
Agile optics concepts and materials,NelsonV.Tabiryan,BEAMEngineeringforAdvancedMeasurementsCo.(UnitedStates);TimothyJ.Bunning,AirForceResearchLab.(UnitedStates);BrianR.Kimball,U.S.ArmyNatickSoldierResearch,DevelopmentandEngineeringCtr.(UnitedStates). . . . . . . [8482-05]
Innovation at the US Naval Research Laboratory,CraigA.Hoffman,U.S.NavalResearchLab.(UnitedStates)........................... [8482-06]
Innovation inspired by nature: capabilities, potentials, and challenges,YosephBar-Cohen,JetPropulsionLab.(UnitedStates)andCaliforniaInstituteofTechnology(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8482-07]
Optical polarization: plenty of room for surprise,DavidB.Chenault,PolarisSensorTechnologies,Inc.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . [8482-08]
The global problem of blindness and visual dysfunction,VasudevanLakshminarayan,Univ.ofWaterloo(Canada). . . . . . . . . . . . . . . . . . . . [8482-09]
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:40to1:40pm
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 1:40 to 2:55 pm
Session 3Session Chairs: Akhlesh Lakhtakia, ThePennsylvaniaStateUniv.
(UnitedStates);Judith A. Todd, ThePennsylvaniaStateUniv.(UnitedStates)
Superior data for superior information: multidiscriminate ladar,PaulF.McManamon,Univ.ofDayton(UnitedStates)andExcitingTechnologyLLC(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8482-10]
Surface plasmon resonances in the detection of small amounts of material,H.AngusMacleod,ThinFilmCenter,Inc.(UnitedStates). . . . . . . . . . [8482-11]
Liquid crystals for non-display optical,OlegD.Lavrentovich,KentStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8482-12]
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 3:20 to 4:45 pm
Session 4Session Chairs: Akhlesh Lakhtakia, ThePennsylvaniaStateUniv.
(UnitedStates);Judith A. Todd, ThePennsylvaniaStateUniv.(UnitedStates)
Intellectural property protection for electro-optics: does it hinder or promote technical innovation?,PaulDavis,GoodwinProcterLLP(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8482-13]
Optical diagnostics for modern machinery,JamesD.Trolinger,ThomasP.Jenkins,BaukeHeeg,MetroLaser,Inc.(UnitedStates). . . . . . . . . . . . [8482-14]
Title to be determined,AleksandrSimonian,NationalScienceFoundation(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8482-15]
Panel Discussion . . . . . . . . . . . . . . . . Sun. 4:45 to 5:45 pm
Vision 2025 Moderators:
Akhlesh Lakhtakia,ThePennsylvaniaStateUniv.(UnitedStates)
Judith A. Todd, ThePennsylvaniaStateUniv.(UnitedStates)
Panelists:
Mathew J. Burrows, CounselortotheNationalIntelligenceCouncil(UnitedStates)
Paul Davis, GoodwinProcterLLP(UnitedStates)
Paul F. McManamon, Univ.ofDayton(UnitedStates)andExcitingTechnologyLLC(UnitedStates)
MJ Soileau,Univ.ofCentralFloridaOfficeofResearch&Commercialization(UnitedStates)
James D. Trolinger, MetroLaser,Inc.(UnitedStates)
Astheentireworldmovesonatrajectoryforaknowledge-basedglobaleconomy,technoscientificinnovationmustbepromotedforsolvingtheproblemsoftodayandforestallingthoseoftomorrow.Thepanelmemberswillrespondtoquestionsfromtheaudienceonuniversity-industry-governmentpartnerships,legalframeworks,andsocietalincentivestopromotephotonicsinnovation.EnhancementofK-16photonicseducationtofostercriticalthinkingandexperientiallearninginplaceofrotelearningwillalsobeontheagenda.
Symposium-Wide Plenary Session . . . . . . . . . . . . . . . . . . . . Sun. 6:00 to 7:25 pm6:00pm: Introduction and Opening Remarks
6:05pm: The Exciting Science of Light with Metamaterials, VladimirM.Shalaev,PurdueUniv.(USA)
6:45pm:Future of Optics and Photonics, BahaaE.A.Saleh,CREOL,TheCollegeofOpitcsandPhotonicsattheUniv.ofCentralFlorida(USA)
spie.org/opadvance · TEL:+13606763290 · help@spie.org 107
Conference 8483Wednesday 15 August 2012 • Proceedings of SPIE Vol. 8483
Tribute to William WolfeConference Chair:Mary G. Turner, BreaultResearchOrganization,Inc.(UnitedStates)
Sunday 12 AugustSymposium-Wide Plenary Session . . . . . . . . . . . . . . . . . . . . Sun. 6:00 to 7:25 pm6:00pm: Introduction and Opening Remarks
6:05pm: The Exciting Science of Light with Metamaterials, VladimirM.Shalaev,PurdueUniv.(USA)
6:45pm:Future of Optics and Photonics, BahaaE.A.Saleh,CREOL,TheCollegeofOpitcsandPhotonicsattheUniv.ofCentralFlorida(USA)
Wednesday 15 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . .Wed. 8:00 to 10:00 am
Session 1Session Chair: Mary G. Turner, BreaultResearchOrganization,Inc.
(UnitedStates)
A history of slide rules for blackbody radiation computations (Invited Paper),R.BarryJohnson,AlabamaA&MUniv.(UnitedStates);SeanM.Stewart,ThePetroleumInstitute(UnitedArabEmirates). . . . . . . . . . . . . . . . . . . . . . [8483-01]
Common radiometry mistakes (Invited Paper),PaulR.Spyak,RaytheonMissileSystems(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8483-02]
Scattered vignettes of repeated radiant exposure (Invited Paper),LawrenceD.Brooks,SuperiorTechnicalResources(UnitedStates). . . . . . . . . . [8483-03]
Radiometry rocks (Invited Paper),JamesE.Harvey,CREOL,TheCollegeofOpticsandPhotonics,Univ.ofCentralFlorida(UnitedStates) . . . . . . [8483-04]
SESSION 2 . . . . . . . . . . . . . . . . . . . . Wed. 10:30 am to 12:00 pm
Session 2Session Chair: Mary G. Turner, BreaultResearchOrganization,Inc.
(UnitedStates)
Optics outreach from 8-12 microns: Wolfe-inspired (Invited Paper),MichaelJ.Nofziger,CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8483-05]
Mentored by Mr. Infrared (Invited Paper),EustaceL.Dereniak,CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates) . . . . . . . . . . . . [8483-06]
Infrared problem analysis from the infrared target design to the temperature sensing in the neuropathic limb (Invited Paper),MarijaStrojnik,Ctr.deInvestigacionesenÓptica,A.C.(Mexico). . . . . . . . . . . . . . . . . [8483-07]
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:00to1:30pm
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 1:30 to 2:40 pm
Session 3Session Chair: Mary G. Turner, BreaultResearchOrganization,Inc.
(UnitedStates)
Feasibility design of a night-driving system for luxury automobiles as metaphor (Invited Paper),MichaelR.Descour,SandiaNationalLabs.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8483-08]
I am a product of your making, hopefully not your worst nightmare,RobertP.Breault,BreaultResearchOrganization,Inc.(UnitedStates)andArizonaOpticsCluster(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8483-09]
William L. Wolfe, 1989 President of SPIE, encourages scientists from Eastern Europe,JoannaSchmit,BrukerNanoSurfacesDivision(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8483-10]
108 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Conference 8484Tuesday-Thursday 14-16 August 2012 • Proceedings of SPIE Vol. 8484
Twelfth International Conference on Solid State Lighting and Fourth International Conference on White LEDs and Solid State LightingConference Chairs:Matthew H. Kane, MassachusettsMaritimeAcademy(UnitedStates);Christian Wetzel, RensselaerPolytechnicInstitute(UnitedStates);Jian-Jang Huang, NationalTaiwanUniv.(Taiwan);Ian T. Ferguson, TheUniv.ofNorthCarolinaatCharlotte(UnitedStates)
Program Committee:Srinath K. Aanegola, GEGlobalResearch(India);Ian E. Ashdown, byHeartConsultantsLtd.(Canada);Lianghui Chen, InstituteofSemiconductors(China);Wood Hi Cheng,NationalSunYat-SenUniv.(Taiwan);John W. Curran, LEDTransformations,LLC(UnitedStates);Nikolaus Dietz, GeorgiaStateUniv.(UnitedStates);Samuel Graham, GeorgiaInstituteofTechnology(UnitedStates);Volker K. Härle, OSRAMOptoSemiconductorsGmbH(Germany);Christoph Hoelen, PhilipsLightingB.V.(Netherlands);Jianzhong Jiao, OSRAMOptoSemiconductorsInc.(UnitedStates);Asif M. Khan, Univ.ofSouthCarolina(UnitedStates);Michael R. Krames, Soraa,Inc.(UnitedStates);Yung Sheng Liu, NationalTsingHuaUniv.(Taiwan);Eun-Hyun Park, KyungHeeUniv.(Korea,Republicof);Seong-Ju Park, GwangjuInstituteofScienceandTechnology(Korea,Republicof);Jeff Quinlan, AcuityBrandsLighting,Inc.(UnitedStates);Robert V. Steele, StrategiesUnlimited(UnitedStates);Chih-Chung Yang, NationalTaiwanUniv.(Taiwan);Yiting Zhu, RensselaerPolytechnicInstitute(UnitedStates)
Monday 13 AugustPosters-Monday . . . . . . . . . . . . . . . . . . . . Mon. 5:30 to 7:30 pm
Conference attendees are invited to attend the poster session on Monday evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
Fluorescent SiC with pseudo-periodic moth-eye structures,YiyuOu,ImranAijaz,HaiyanOu,TechnicalUniv.ofDenmark(Denmark)........... [8484-43]
Surface-structure film by glass mold with down-size sintering method,Yi-ChienLo,Xuan-HaoLi,Jung-LinTsai,Ching-CherngSun,Ching-YiChen,Chong-JhihJiang,NationalCentralUniv.(Taiwan). . . . . . . . . . . . . . . . [8484-44]
Enhanced optical power of InGaN/GaN near-ultraviolet light emitting diodes by surface plasmon in silver nanoparticles,Sang-HyunHong,Chu-YoungCho,SangJunLee,SangYoupYim,Seong-JuPark,GwangjuInstituteofScienceandTechnology(Korea,Republicof) . . . . . . . . . . . . . . . . . . . [8484-45]
Improved light output power of GaN-based green light emitting diodes by periodic sub-wavelength structure,Jung-HoonSong,Han-MinLee,YoungChulLee,Yu-ShinPark,GwangjuInstituteofScienceandTechnology(Korea,Republicof);Hyung-DukKo,SamsungDigitalCity(Korea,Republicof);Sung-TaeKim,SamsungElectro-Mechanics(Korea,Republicof);Gun-YoungJung,Seong-JuPark,GwangjuInstituteofScienceandTechnology(Korea,Republicof) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8484-46]
Evaluation of electrical and thermal coupling in solid state lighting systems,Han-KueiFu,Chien-PingWang,Hsin-ChienChiang,Tzung-TeChen,ChiuLingChen,Pei-TingChou,IndustrialTechnologyResearchInstitute(Taiwan)[8484-47]
LED package with side-emitting enhancement silicone lens achieved by hydrophobic material coating and dispensing,ChienLinChangChien,Yu-CheHuang,ChungMinChang,NationalTsingHuaUniv.(Taiwan);SyueFongHu,ChangWenSun,AdvancedOptoelectronicTechnology,Inc.(Taiwan);Ming-ChuenYip,WeileunFang,NationalTsingHuaUniv.(Taiwan). . . . . . . [8484-48]
Optical trapping using a superluminescent diode,DennisTierney,SteveRiechman,SeanGravelle,MathewFletcher,HeidrunSchmitzer,XavierUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8484-49]
Effects of strains and defects on the internal quantum efficiency of InGaN/GaN nanorod light emitting diodes,Li-ChuanHuang,Chun-HsiangChang,Liang-YiChen,Jin-YiChen,JianJangHuang,NationalTaiwanUniv.(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8484-50]
Automated hardware-software system for LED’s verification and certification,AleksandrN.Chertov,ElenaV.Gorbunova,MariyaG.Serikova,VladimirS.Peretyagin,AnatolyD.Vakulenko,NationalResearchUniv.ofInformationTechnologies,MechanicsandOptics(RussianFederation)[8484-51]
Graphene on Ag films for reflectively conductive layer ohmic contacts to p-type GaN in GaN-based light emitting diodes,Lung-ChienChen,Ching-HoTien,Min-HsuehChiang,NationalTaipeiUniv.ofTechnology(Taiwan)[8484-52]
Using artificial neural networks approach for the color enhancement of high-power LEDs,Hsi-ChaoChen,Guo-YangWu,Peng-YingChen,Mei-JyunLai,Kuo-TingHuang,NationalYunlinUniv.ofScienceandTechnology(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8484-53]
High-yield thin GaN LED using metal bonding and laser lift-off technology,Ray-HuaHorng,Re-ChingLin,Wei-ChengKao,Dong-SingWuu,Ching-HoChen,NationalChungHsingUniv.(Taiwan). . . . . . . . . . . . . . . . . . . . . [8484-54]
Effect of the nucleation layer thickness on the physical properties of epitaxial InN layers,SampathGamage,MataraK.I.Senevirathna,RamazanAtalay,GeorgiaStateUniv.(UnitedStates);MaxBuegler,GeorgiaStateUniv.(UnitedStates)andTechnischeUniv.Berlin(Germany);AguPerera,GeorgiaStateUniv.(UnitedStates);AxelHoffman,TechnischeUniv.Berlin(Germany);AndrewMelton,IanT.Ferguson,TheUniv.ofNorthCarolinaatCharlotte(UnitedStates);NikolausDietz,GeorgiaStateUniv.(UnitedStates) . . . . . . . . [8484-55]
Strontium aluminate doped with Pr for application to white LEDs,YoshihisaIkeda,KouheiMasada,YuukiKubo,HidekiMotomura,MasafumiJinno,EhimeUniv.(Japan);KunihideTachibana,OsakaElectro-CommunicationUniv.(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8484-56]
Illumination Technical Event . . . . . . . . Mon. 8:00 to 10:00 pm
Chair: Jake Jacobsen,Synopsys,Inc.(USA)
Interestinfree-formopticshasbeenincreasinginrecentyears.Withadvancesincomputationalmethods,theuseofsuchsurfaceshasbecomepracticalforawiderangeofapplicationswhereprecisetailoringtheilluminationpatterniscritical.Atthisyear’stechnicaleventwewilldiscussissuessurroundingthespecificationanduseoffree-formopticsforilluminationsystems.
Thefollowingspeakershaveagreedtotalkattheeventandparticipateinapaneldiscussionafterwards:
Dr. William Cassarly, Synopsys,Inc.(USA)
Prof. Pablo Benítez,Univ.PolitécnicadeMadrid(Spain)andLightPrescriptionsInnovatorsLLC(USA)
Prof. Harald Ries, OpticsandEnergyConceptsAG(Germany)
Attheendoftheplannedevent,timepermitting,anymemberoftheaudiencemaypresentinformationwithinthebroadfieldofillumination.Lightrefreshmentswillbeserved.
Light refreshments sponsored by:
The Optical Solutions Group at
Tuesday 14 AugustOLEDs and Solid State Lighting Plenary Session . . . . . . . . . . . . . . . . . . Tues. 8:30 to 10:00 am
Session Chairs: Franky So, Univ.ofFlorida(UnitedStates);Matthew H. Kane, MassachusettsMaritimeAcademy(UnitedStates)
Development of charge generation layers for multiphoton emission OLED,JunjiKido,HisahiroSasabe,Yong-JinPu,YamagataUniv.(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8476-101]
LED development with nanostructures and nanophotonics,Chih-ChungYang,NationalTaiwanUniv.(Taiwan) . . . . . . . . . . . . . . . . . . . . . . [8484-102]
spie.org/opadvance · TEL:+13606763290 · help@spie.org 109
SESSION 1 . . . . . . . . . . . . . . . . . . . . Tues. 10:30 am to 12:30 pm
Solid State Lighting and OLEDs: Joint Session with Conference 8476
Session Chairs: Ian T. Ferguson, TheUniv.ofNorthCarolinaatCharlotte(UnitedStates);Juergen Kreis, AIXTRONSE(Germany)
OLED-based physiologically-friendly very low-color temperature illumination for night (Invited Paper),Jwo-HueiJou,Shih-MingShen,Ming-ChunTang,Pin-ChuChen,Chun-YuHsieh,Chin-ChiaoLin,NationalTsingHuaUniv.(Taiwan);Szu-HaoChen,Yi-ShanWang,Chien-ChihChen,Ching-ChunWang,IndustrialTechnologyResearchInstitute(Taiwan);Chien-TienChen,NationalTsingHuaUniv.(Taiwan)............................. [8476-44]
White light quality of phosphor converted LEDs from a phosphor materials perspective of view: an evaluation based on combined thermal and optical simulations (Invited Paper),Franz-PeterWenzl,ChristianSommer,JOANNEUMRESEARCHForschungsgesellschaftmbH(Austria);PeterPachler,HansHoschopf,TridonicAtcoOptoelectronicsGmbH(Austria);GregorLanger,AustriaTechnologie&SystemtechnikAG(Austria);PaulFulmek,JohannNicolics,TechnischeUniv.Wien(Austria);PaulHartmann,JOANNEUMRESEARCHForschungsgesellschaftmbH(Austria). . . . . . . . . . . . . . . . . . . . . . . . . [8484-01]
Towards high-efficiency solution processed WOLEDs for lighting applications (Invited Paper),JonathanF.Maunoury,EnricoOrselli,DominiqueBascour,OlivierGaudin,Jean-PierreCatinat,SolvayS.A.(Belgium);NeetuChopra,JingWang,SergeiLi,EliScott,VenkataramananSeshadri,ChristopheGrenier,ChristopherT.Brown,MathewK.Mathai,Plextronics,Inc.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8476-45]
Crack-free GaN deposition on Si substrate with temperature-graded AlN buffer growth and the emission characteristics of overgrown InGaN/GaN quantum wells (Invited Paper),Chih-YenChen,Wen-MingChang,Wei-LunChung,Yen-HungLiu,ChiehHsieh,Che-HaoLiao,Shao-YingTing,Yean-WoeiKiang,Chih-ChungYang,NationalTaiwanUniv.(Taiwan). . . . . . . . . . [8484-02]
Lunch/Exhibition Break.............................. 12:30to2:00pm
SESSION 2 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 2:00 to 3:40 pm
LED Design ISession Chair: J. Kumar, AnnaUniv.Chennai(India)
Recent progress of phosphor-free single-chip white LEDs,XiaGuo,BaoLuGuan,ZhiPingSu,BeijingUniv.ofTechnology(China). . . . . . . . . . . . [8484-03]
Process development of GaN light emitting diodes with imbedded contacts,Ray-HuaHorng,NationalChungHsingUniv.(Taiwan);YuWeiKuo,NationalChengKungUniv.(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8484-04]
Electrical properties of Ti/Al ohmic contacts to molecular beam epitaxy-grown N-face n-type GaN for vertical-structure LEDs,Joon-WooJeon,Tae-YeonSeong,KoreaUniv.(Korea,Republicof);GonNamkoong,OldDominionUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8484-05]
Enhanced optical output power of InGaN/GaN light emitting diodes by bandgap-engineering of electron blocking layer,SangJunLee,Chu-YoungCho,Sang-HyunHong,GwangjuInstituteofScienceandTechnology(Korea,Republicof);Sang-HeonHan,SukhoYoon,Sung-TaeKim,SamsungLEDCo.Ltd.(Korea,Republicof);Seong-JuPark,GwangjuInstituteofScienceandTechnology(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8484-06]
High-temperature (400°C) glass based phosphor-converted white light emitting diodes for solid state lighting,WoodHiCheng,NationalSunYat-SenUniv.(Taiwan);ChunChinTsai,FarEastUniv.(Taiwan). . . . . . . . . . . . [8484-07]
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 4:00 to 5:20 pm
Thermal Management and Lifetime IssuesSession Chair: Seong-Ju Park, GwangjuInstituteofScienceand
Technology(Korea,Republicof)
Uncertainty analysis in lifetime measurement for white light emitting diodes,HaipingShen,XiaoliZhou,WanluWanlu,MuqingLiu,FudanUniv.(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8484-08]
Determining thermal resistance in LEDs through an induced transient heating method,ShwetaNatarajan,YishakHabtemichael,SamuelGraham,GeorgiaInstituteofTechnology(UnitedStates). . . . . . . . . . . . . . . . . . [8484-09]
Heat spreading improvement on thin-GaN light emitting diodes by using diamond-like carbon passivation layer,Yen-ShuoLiu,Cheng-YiLiu,NationalCentralUniv.(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8484-10]
A quantitative dimming method for LED based on PWM,JiyongWang,ZhejiangUniv.(China);TongshengMou,ZhejiangUniv.(China)andSENSINGInstrumentsCo.,Ltd.(China);JianpingWang,SENSINGInstrumentsCo.,Ltd.(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8484-11]
Wednesday 15 AugustSESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . .Wed. 8:30 to 10:30 am
Novel Buffer Layers and SubstratesSession Chair: Wang Nang Wang, Univ.ofBath(UnitedKingdom)
Study of lighting emitting pattern and light extraction efficiency on GaN LEDs on PSS substrates,Hong-yuLin,Cheng-yiLiu,NationalCentralUniv.(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8484-12]
Effect of PSS pattern morphology on light extraction efficiency,Xu-FengLi,Cheng-YiLiu,NationalCentralUniv.(Taiwan) . . . . . . . . . . . . . . . . . . . [8484-13]
Lift-off of epitaxial layer upon high-temperature regrowth of porous n-GaN,Jin-HoKang,MohamedE.AbdRabou,SooHeeKim,ChonnamNationalUniv.(Korea,Republicof);Sang-WanRyu,ChonnamNationalUniv(Korea,Republicof) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8484-14]
Effect of SiNx interlayer on structural and electrical properties of nonpolar a-plane (11-20) gallium nitride,JiHoonKim,JungHoPark,KoreaUniv.(Korea,Republicof);KwangHyeonBaik,YongGonSeo,Sung-MinHwang,KoreaElectronicsTechnologyInstitute(Korea,Republicof) . . . . . . . . . . . . . [8484-15]
High-efficiency blue light emitting diode with air voids embedded in lateral epitaxially overgrown GaN using a metal mask,Chu-YoungCho,KwangJaeLee,Sang-HyunHong,Sang-JunLee,Jae-JoonKim,Seong-JuPark,GwangjuInstituteofScienceandTechnology(Korea,Republicof) . . . . . . . . . . [8484-16]
Wafer-level photoelectrochemical liftoff of patterned sapphire substrate for fabricating vertical light emitting diode,ChiehHsieh,Horng-ShyangChen,Chih-YenChen,Che-HaoLiao,Chun-HanLin,Cheng-HungLin,Shao-YingTing,Yu-FengYao,Hao-TsungChen,Yean-WoeiKiang,Chih-ChungYang,NationalTaiwanUniv.(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8484-17]
SESSION 5 . . . . . . . . . . . . . . . . . . . . Wed. 11:00 am to 12:30 pm
Nanostructured LEDsSession Chair: Chih-Chung Yang, NationalTaiwanUniv.(Taiwan)
Localized surface plasmon coupled light emitting diode with metal nanoparticles on its surface,Dong-MingYeh,Yu-LungJung,Che-WeiHuang,Hung-YuTseng,Chih-YenChen,Che-HaoLiao,ChiehHsieh,Horng-ShyangChen,Yean-WoeiKiang,Chih-ChungYang,NationalTaiwanUniv.(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8484-18]
Advances in etched nanorod LED arrays,WangN.Wang,Univ.ofBath(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8484-19]
Regularly-patterned InGaN/GaN nanorod light emitting diode arrays with c-plane disk-like and m-plane core-shell quantum wells,Che-HaoLiao,Horng-ShyangChen,Dong-MingYeh,Wen-MingChang,Yu-FengYao,Chih-YenChen,Shao-YingTing,Hao-TsungChen,Chia-YingSu,ChiehHsieh,Yean-WoeiKiang,Chih-ChungYang,NationalTaiwanUniv.(Taiwan) . . . . . [8484-20]
Mode interactions in a GaN-based light emitting diode with surface photonic crystals and nanoholes (Invited Paper),Han-TsaiTzong,Yu-FengYin,Yen-ChenLin,Szu-ChiehWang,Yun-WeiCheng,Jian-JangHuang,NationalTaiwanUniv.(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8484-21]
Lunch/Exhibition Break.............................. 12:30to2:00pm
SESSION 6 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 2:00 to 3:20 pm
Phosphors and Color ManagementSession Chair: Yiting Zhu, RensselaerPolytechnicInstitute
(UnitedStates)
The impact of the silicone encapsulation layers on the white light quality of phosphor converted LEDs,ChristianSommer,PaulHartmann,JOANNEUMRESEARCHForschungsgesellschaftmbH(Austria);PeterPachler,TridonicJennersdorfGmbH(Austria);HansHoschopf,TridonicAtcoOptoelectronicsGmbH(Austria);GregorLanger,AustriaTechnologie&SystemtechnikAG(Austria);PaulFulmek,JohannNicolics,TechnischeUniv.Wien(Austria);Franz-PeterWenzl,JOANNEUMRESEARCHForschungsgesellschaftmbH(Austria). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8484-22]
Effect of different colored background lighting on LED glare perception,KathrynSweaterHickcox,NadarajahNarendran,JohnD.Bullough,JeanPaulFreyssinier,RensselaerPolytechnicInstitute(UnitedStates). . . . . . . . [8484-23]
Comparative study on the phosphor converted white LEDs performance based on phosphor characterization,Yu-ShinLu,LextarElectronicsCorp.(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8484-24]
How to assess color uniformity in LED lighting,IvanMoreno,LuzMariaGarcia,AlejandraBugarin,Univ.AutónomadeZacatecas(Mexico) . . [8484-25]
Conference 8484
110 spie.org/opadvance · TEL:+13606763290 · help@spie.org
SESSION 7 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 3:50 to 5:20 pm
LED Design IISession Chair: Wood Hi Cheng, NationalSunYat-SenUniv.(Taiwan)
On light emission based on nitrides (Invited Paper),J.Kumar,KrishnanBaskar,AnnaUniv.Chennai(India). . . . . . . . . . . . . . . . . . . . . . . . . . . . [8484-26]
Low-voltage CdZnO/ZnO multiple quantum-well light emitting diode with p-type GaN,Horng-ShyangChen,Shao-YingTing,Yu-FengYao,Hao-TsungChen,Wen-MingChang,Che-HaoLiao,Chih-YenChen,ChiehHsieh,Yean-WoeiKiang,Chih-ChungYang,NationalTaiwanUniv.(Taiwan) . . . . . [8484-27]
Study of low-frequency dielectric behavior of electroluminescent devices for efficiency improvement in high-frequency applications,KanikaBansal,ShouvikDatta,IndianInstituteofScienceEducation&ResearchPune(India). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8484-28]
Multiple wavelength LED on monolithic QW structure,AbdullahJ.Zakariya,PatrickLiKamWa,CREOL,TheCollegeofOpticsandPhotonics,Univ.ofCentralFlorida(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8484-29]
Thursday 16 AugustSESSION 8 . . . . . . . . . . . . . . . . . . . . . . . Thurs. 8:40 to 10:30 am
LED MaterialsSession Chair: Andrew G. Melton, TheUniv.ofNorthCarolinaat
Charlotte(UnitedStates)
Growth and characterization of indium-rich InGaN epilayers grown by high-pressure CVD (Invited Paper),NikolausDietz,RamazanAtalay,SampathGamage,KasuniNanayakkara,RasangaSamaraweera,MataraK.I.Senevirathna,AguU.Perera,GeorgiaStateUniv.(UnitedStates);AndrewG.Melton,IanT.Ferguson,TheUniv.ofNorthCarolinaatCharlotte(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8484-30]
High-thermal stability of indium-rich InGaN films (33 and 60%) grown by pulsed laser deposition,Tzu-YuWang,Kun-ChingShen,Sin-LiangOu,Dong-SingWuu,Ray-HuaHorng,NationalChungHsingUniv.(Taiwan). . . . [8484-31]
Fabrication of p-ZnO thin films by ZrN codoping,GowrishankarSubramaniam,BalakrishnanLakshmiNarayanan,GopalakrishnanNammalvar,NationalInstituteofTechnology,Tiruchirappalli(India) . . . . . . . . . . . . [8484-32]
Effect of V/III molar ratio and reactor pressure on the optical properties InN,MaxBuegler,TechnischeUniv.Berlin(Germany);SampathGamage,MataraK.I.Senevirathna,RamazanAtalay,GeorgiaStateUniv.(UnitedStates);RonnyKirste,TechnischeUniv.Berlin(Germany);LiqinSu,AndrewG.Melton,TheUniv.ofNorthCarolinaatCharlotte(UnitedStates);JamesTweedie,RamonCollazo,NorthCarolinaStateUniv.(UnitedStates);IanFerguson,TheUniv.ofNorthCarolinaatCharlotte(UnitedStates);ZlatkoSitar,NorthCarolinaStateUniv.(UnitedStates);AxelHoffmann,TechnischeUniv.Berlin(Germany);NikolausDietz,GeorgiaStateUniv.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . [8484-33]
Nuclear science and optical studies of InAlGaP materials grown on GaAs by metalorganic chemical vapor deposition,LinLi,PekingUniv.(China);YiZheHuang,NationalTaiwanUniv(Taiwan);Shu-DeYao,PekingUniv.(China);ZheChuanFeng,NationalTaiwanUniv.(Taiwan);IanT.Ferguson,TheUniv.ofNorthCarolinaatCharlotte(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . [8484-34]
SESSION 9 . . . . . . . . . . . . . . . . . . . Thurs. 11:00 am to 12:20 pm
Optical Design and StudiesSession Chair: Nikolaus Dietz, GeorgiaStateUniv.(UnitedStates)
A numerical study on the surface plasmon coupling with radiating dipoles in the quantum wells of a light emitting diode,YangKuo,Yean-WoeiKiang,Chih-ChungYang,NationalTaiwanUniv.(Taiwan)................ [8484-35]
Optics for efficient focusing of LED light,IvanMoreno,MaricruzRamirez-Sierra,DiegoEsparza,Univ.AutónomadeZacatecas(Mexico). . . . . . [8484-36]
Reduction in power consumption with the implementation of LED,SouravSarkar,WestBengalUniv.ofTechnology(India);AmitavaSengupta,PhilipsElectronicsIndiaPvt.Ltd.(India). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8484-37]
Time-resolved and temperature-varied photoluminescence studies of InGaN/GaN multiple quantum well structures,LeiLiu,PekingUniv(China);J.H.Yang,NationalTaiwanUniv.(Taiwan);XiaodongHu,PekingUniv.(China);J.J.Huang,ZheChuanFeng,NationalTaiwanUniv.(Taiwan) . . . . . . . . [8484-38]
Lunch/Exhibition Break.............................. 12:20to2:00pm
SESSION 10 . . . . . . . . . . . . . . . . . . . . . . . Thurs. 2:00 to 3:00 pm
ApplicationsSession Chair: Jian-Jang Huang, NationalTaiwanUniv.(Taiwan)
Design of optical lens for LED road lighting,Chi-FengLin,Yu-BinFang,NationalCtr.forHigh-performanceComputing(Taiwan);Tao-HsingChen,NationalKaohsiungUniv.ofAppliedSciences(Taiwan). . . . . . . . . . . . [8484-40]
Transparent image generator by using vertically-aligned (VA) polymer-stabilized liquid crystal (PSLC),MuHaoWang,NationalTaiwanUniv.(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8484-41]
Measurements of UGR of LED light by a DSLR colorimeter,Shau-WeiHsu,Cheng-HsienChen,Yuh-DerJiaan,IndustrialTechnologyResearchInstitute(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8484-42]
Conference 8484
spie.org/opadvance · TEL:+13606763290 · help@spie.org 111
Conference 8485Sunday-Monday 12-13 August 2012 • Proceedings of SPIE Vol. 8485
Nonimaging Optics: Efficient Design for Illumination and Solar Concentration IXConference Chairs:Roland Winston, Univ.ofCalifornia,Merced(UnitedStates);Jeffrey M. Gordon, Ben-GurionUniv.oftheNegev(Israel)
Program Committee:Pablo Benítez, Univ.PolitécnicadeMadrid(Spain)andLightPrescriptionsInnovatorsLLC(Spain);William J. Cassarly, Synopsys,Inc.(UnitedStates);Daniel Feuermann, Ben-GurionUniv.oftheNegev(Israel);Ralf Leutz, ConcentratorOpticsGmbH(Germany);Juan Carlos Miñano, Univ.PolitécnicadeMadrid(Spain)andLightPrescriptionsInnovatorsLLC(Spain);Narkis Shatz, SAIC(UnitedStates)
Sunday 12 AugustOpening Comments . . . . . . . . . . . . . . . . . . Sun. 8:30 to 8:35 am
Roland Winston,Univ.ofCalifornia,Mercedand Jeffrey M. Gordon, Ben-GurionUniv.oftheNegev(Israel)
SESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 8:35 to 9:15 am
Thermodynamic Basis of Nonimaging OpticsSession Chair: Jeffrey Gordon, Ben-GurionUniv.oftheNegev(Israel)
Thermodynamic basis of nonimaging optics (Invited Paper),RolandWinston,Univ.ofCalifornia,Merced(UnitedStates). . . . . . . . . . . . . . . . . . . . . . [8485-01]
SESSION 2 . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 9:15 to 10:15 am
Nonimaging Optics for Concentrator PhotovoltaicsSession Chair: Narkis Shatz, SAIC(UnitedStates)
Optical design of the dome-shaped Fresnel-Köhler concentrator,PabloZamora,PabloBenitez,Univ.PolitécnicadeMadrid(Spain);LiYang,ZhejiangUniv.(China);JuanCarlosMiñano,Univ.PolitécnicadeMadrid(Spain);KenjiAraki,DaidoSteelCo.,Ltd.(Japan) . . . . . . . . . . . . . . . . . . . . . . . . . . . [8485-02]
Practical implementation of a planar micro-optic solar concentrator,KatherineA.Baker,Univ.ofCalifornia,SanDiego(UnitedStates);JasonH.Karp,GEGlobalResearch(UnitedStates)andUniv.ofCalifornia,SanDiego(UnitedStates);JustinM.Hallas,PacificIntegratedEnergy,Inc.(UnitedStates)andUniv.ofCalifornia,SanDiego(UnitedStates);JosephE.Ford,Univ.ofCalifornia,SanDiego(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8485-03]
Beam-steering array optics designs with the SMS method,WangLin,Univ.PolitécnicadeMadrid(Spain);PabloBenitez,JuanCarlosMiñano,Univ.PolitécnicadeMadrid(Spain)andLightPrescriptionsInnovators,LLC(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8485-04]
SESSION 3 . . . . . . . . . . . . . . . . . . . . . Sun. 10:40 am to 12:00 pm
Gradient-Index OpticsSession Chair: Ralf Leutz, ConcentratorOpticsGmbH(Germany)
Nanolayered polymer diffusive spectral filters,JohnC.Bortz,NarkisShatz,SAIC(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8485-05]
Planar single-element gradient-index solar lenses for concentrator photovoltaics,PanagiotisKotsidas,VijayModi,ColumbiaUniv.(UnitedStates);JeffreyGordon,Ben-GurionUniv.oftheNegev(Israel). . . . . . . . . . . . [8485-06]
Design of spherical symmetric gradient index lenses (Invited Paper),JuanCarlosMiñano,PabloBenitez,JuanC.González,DejanGrabovickic,Univ.PolitécnicadeMadrid(Spain). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8485-07]
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:00to1:30pm
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 1:30 to 3:30 pm
Novel Applications and Fundamental LimitsSession Chair: Juan Carlos Miñano, LightPrescriptionsInnovatorsLLC
(Spain)andUniv.PolitécnicadeMadrid(Spain)
On the challenge of flux concentration at grazing incidence for neutrons and x-rays (Invited Paper),BorisKhaykovich,DavidE.Moncton,GiacomoResta,MassachusettsInstituteofTechnology(UnitedStates);MikhailV.Gubarev,NASAMarshallSpaceFlightCtr.(UnitedStates);NataliaOstroumov,DanielFeuermann,JeffreyGordon,Ben-GurionUniv.oftheNegev(Israel) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8485-08]
First-ever direct measurement of the spatial coherence of sunlight,HeylalMashaal,AlexGoldstein,DanielFeuermann,JeffreyGordon,Ben-GurionUniv.oftheNegev(Israel). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8485-09]
Thermal analysis of a CW solar-pumped laser for magnesium energy cycle,BehgolBagheri,TheUniv.ofTokyo(Japan);ShigeakiUchida,TokyoInstituteofTechnology(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8485-10]
Improvement of luminescent solar concentrators using vertically aligned dyes,MelissaN.Ricketts,RolandWinston,LunJiang,LindaS.Hirst,AndreaL.Rodarte,Univ.ofCalifornia,Merced(UnitedStates) . . . . . . . . . . . . . . [8485-11]
Solar receiver with integrated optics,LunJiang,RolandWinston,Univ.ofCalifornia,Merced(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8485-12]
SESSION 5 . . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 4:00 to 5:40 pm
Nonimaging Optimization ProceduresSession Chair: Pablo Benítez, LightPrescriptionsInnovatorsLLC
(Spain)andUniv.PolitécnicadeMadrid(Spain)
Implementation of the linear programming algorithm for freeform reflector design,CristinaCanavesi,Univ.ofRochester(UnitedStates);WilliamJ.Cassarly,Synopsys,Inc.(UnitedStates);JannickP.Rolland,Univ.ofRochester(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8485-13]
Optimization of LED-based non-imaging optics with orthogonal polynomial shapes,PeterBrick,OSRAMOptoSemiconductorsGmbH(Germany);ChristopherWiesmann,OSRAMAG(Germany). . . . . . . . . . . . . . . . . . [8485-14]
Free-form glass reflectors for non-trivial illumination applications with extended sources,ThomasHessling,UlfGeyer,AnsgarHellwig,MarcC.Hübner,AuerLightingGmbH(Germany) . . . . . . . . . . . . . . . . . . . . . . . [8485-15]
Irradiance tailoring with two-sided, Fresnel-type freeform optics,AdrienBruneton,RWTHAachen(Germany);AxelBäuerle,RWTHAachen(Germany)andFraunhofer-InstitutfürLasertechnik(Germany);MartinTraub,RolfWester,Fraunhofer-InstitutfürLasertechnik(Germany);PeterLoosen,RWTHAachen(Germany)andFraunhofer-InstitutfürLasertechnik(Germany). . . . . . [8485-16]
Reverse radiance: a fast, accurate method for determining illuminance,KennethE.Moore,RonaldF.Rykowski,RadiantZemax,LLC(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8485-17]
Symposium-Wide Plenary Session . . . . . . . . . . . . . . . . . . . . Sun. 6:00 to 7:25 pm6:00pm: Introduction and Opening Remarks
6:05pm: The Exciting Science of Light with Metamaterials, VladimirM.Shalaev,PurdueUniv.(USA)
6:45pm:Future of Optics and Photonics, BahaaE.A.Saleh,CREOL,TheCollegeofOpitcsandPhotonicsattheUniv.ofCentralFlorida(USA)
Monday 13 AugustSESSION 6 . . . . . . . . . . . . . . . . . . . . . . . . .Mon. 8:40 to 10:00 am
DaylightingSession Chair: Daniel Feuermann, Ben-GurionUniv.oftheNegev
(Israel)
Using multimode interference in visible spectrum transmission,Kuan-YuChen,NationalTaiwanUniv.ofScienceandTechnology(Taiwan) . . . [8485-18]
Sollektor: progress in fiber optic daylighting,HansPoisel,KlausHofbeck,Univ.ofAppliedSciencesNürnberg(Germany);AlexanderKist,BavarianOpticsGmbH(Germany);SebastianSchuetz,BavarianOpticsGmbH(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8485-19]
112 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Encapsulated microstructures for daylighting and seasonal thermal control,AndréKostro,MarioGeiger,RemyTeuscher,MarinaGonzalezLazo,Jean-LouisScartezzini,YvesLeterrier,AndreasM.Schüler,EcolePolytechniqueFédéraledeLausanne(Switzerland) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8485-20]
A new device for dynamic luminance mapping and glare risk assessment in buildings,ApiparnBorisuit,MirjamMünch,JéromeKämpf,Jean-LouisScartezzini,EcolePolytechniqueFédéraledeLausanne(Switzerland) [8485-21]
SESSION 7 . . . . . . . . . . . . . . . . . . . . Mon. 10:30 am to 12:10 pm
Illumination OpticsSession Chair: William J. Cassarly, Synopsys,Inc.(UnitedStates)
Design and qualification of an adjustable-area, LED-driven calibration source for imaging applications,BrianC.Cox,StuartA.Baker,KristinaK.Brown,DanielK.Frayer,MatthewA.Martin,JasonA.Young,NationalSecurityTechnologies,LLC(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . [8485-22]
Fiber optic illumination by laser activated remote phosphor,UlrichHartwig,OSRAMAG(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8485-23]
High-efficiency modular light source for monochromators, fiber optics, and solar simulators,ArkadyFeldman,YunLi,EdManke,GreggPaolini,Oriel®Instruments,aNewportCorp.Brand(UnitedStates). . . . . . . . . . . . . . [8485-24]
Optical design using luminance in ray data sets,JuliusA.Muschaweck,OSRAMAG(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8485-25]
Primary optics for efficient high-brightness LED color mixing,AleksandraCvetkovic,RubénMohedano,OliverDross,MaikelHernandez,LightPrescriptionsInnovators,LLC(UnitedStates);PabloBenítez,Univ.PolitécnicadeMadrid(Spain)andLightPrescriptionsInnovators,LLC(UnitedStates);JuanCarlosMiñano,Univ.PolitécnicadeMadrid(Spain);JuanF.Vilaplana,JulioChaves,LightPrescriptionsInnovators,LLC(UnitedStates). . . . . . . . [8485-26]
Closing Comments . . . . . . . . . . . . . . . . Mon. 12:10 to 12:15 pm
Roland Winston, Univ.ofCalifornia,Mercedand Jeffrey M. Gordon, Ben-GurionUniv.oftheNegev(Israel)
LunchBreak . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:15to1:30pm
Solar Energy Plenary Session . . . . . . . . Mon. 1:30 to 5:00 pm
SessionChair: Martha Symko-Davies,NationalRenewableEnergyLab.(USA)
1:30pm:Understanding the Generation of Charge Carriers in Organic Photovoltaic Devices, GarryRumbles,NationalRenewableEnergyLab.(USA)andUniv.ofColoradoatBoulder(USA)
2:00pm:Light Management in Single-Junction III-V Solar Cells, BrendanM.Kayes,AltaDevices,Inc.(USA)
2:30pm:Carbon Nanotubes for Photovoltaics, MichaelJ.Heben,TheUniv.ofToledo(USA)
CoffeeBreak . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3:00to3:30pm
3:30pm:Advanced Solar Cell Technologies for Concentrating Photovoltaics Systems, VijitSabnis,SolarJunction(USA)
4:00pm:High-Rate Processing and Advanced Emitter Structures for CIGS PV Module Manufacturing,BillyJ.Stanbery,HelioVoltCorp.(USA)
4:30pm:On the Way to Accelerated Life Testing, MichaelKöhl,Fraunhofer-InstitutfürSolareEnergiesysteme(Germany)
Posters-Monday . . . . . . . . . . . . . . . . . . . . Mon. 5:30 to 7:30 pmConference attendees are invited to attend the poster session on Monday
evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
LED array arrangement for high-uniform illumination distribution,ZhoupingSu,JiangnanUniv.(China) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8485-27]
Optical design and molding analysis for a Fresnel lens of a solar concentrator system,Cheng-HsienWu,Hung-JuanJan,NationalKaohsiungUniv.ofAppliedSciences(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . [8485-28]
Optical design of wavelength selective CPVT system with 3D/2D hybrid concentration,NawwarAhamad,NoboruYamada,NagaokaUniv.ofTechnology(Japan);TakashiKawaguchi,ToshihikoMaemura,HirotakaOhashi,MitsuiEngineering&ShipbuildingCo.,Ltd.(Japan). . . . . . . . . . . . . . . [8485-29]
High-performance illumination module of RGB LEDs picoprojector with dual double side micro lens array,Chun-ChiehChen,InstrumentTechnologyResearchCtr.(Taiwan);Hsin-ChiehWu,Moint-LearnWu,NationalCentralUniv.(Taiwan);Yuan-ChiehCheng,InstrumentTechnologyResearchCtr.(Taiwan)andNationalTsingHuaUniv.(Taiwan);Wei-YaoHsu,InstrumentTechnologyResearchCtr.(Taiwan) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8485-30]
Illumination characterization of glass and metal secondary concentrator elements in a solar concentration system,BlakeM.Coughenour,BrianWheelwright,CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates);J.RogerP.Angel,TheUniv.ofArizona(UnitedStates). . . . . . . . . . . . [8485-31]
Optical modeling of a solar concentrator for a simultaneous photovoltaic, thermal, and lighting system using spectral beam techniques,PerlaM.VieraGonzalez,GuillermoE.SanchezGuerrero,VictoriaNavarroFranco,GustavoA.CardenasOrtiz,AndresCastrillonEscobar,DanielE.CeballosHerrera,RomeoSelvasAguilar,Univ.AutónomadeNuevoLeón(Mexico) . . . . . . . . . . [8485-32]
Off-axis non-uniformity mitigation techniques for nonimaging concentrators,BrianM.Wheelwright,BlakeM.Coughenour,CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates);J.RogerP.Angel,TheUniv.ofArizona(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8485-33]
Optical characteristic of the light guide plate with microstructures engraved by laser,Tun-ChienTeng,NationalTaiwanNormalUniv.(Taiwan). . . [8485-34]
Design of a lightly-domed Fresnel lens for solar concentration avoiding undercut through a wavy outer surface,HansPhilippAnnen,RalfLeutz,ConcentratorOpticsGmbH(Germany). . . . . . . . . . . . . . . . . . . . . . . . . [8485-35]
Integral illumination lens design of LED-based picoprojector,ShuangZhao,WuhanNationalLab.forOptoelectronics(China);KaiWang,GuangdongRealFaithOptoCo.,Ltd.(China);FeiChen,ShengLiu,WuhanNationalLab.forOptoelectronics(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8485-36]
Illumination Technical Event . . . . . . . . Mon. 8:00 to 10:00 pm
Chair: Jake Jacobsen,Synopsys,Inc.(USA)
Interestinfree-formopticshasbeenincreasinginrecentyears.Withadvancesincomputationalmethods,theuseofsuchsurfaceshasbecomepracticalforawiderangeofapplicationswhereprecisetailoringtheilluminationpatterniscritical.Atthisyear’stechnicaleventwewilldiscussissuessurroundingthespecificationanduseoffree-formopticsforilluminationsystems.
Thefollowingspeakershaveagreedtotalkattheeventandparticipateinapaneldiscussionafterwards:
Dr. William Cassarly, Synopsys,Inc.(USA)
Prof. Pablo Benítez,Univ.PolitécnicadeMadrid(Spain)andLightPrescriptionsInnovatorsLLC(USA)
Prof. Harald Ries, OpticsandEnergyConceptsAG(Germany)
Attheendoftheplannedevent,timepermitting,anymemberoftheaudiencemaypresentinformationwithinthebroadfieldofillumination.Lightrefreshmentswillbeserved.
Light refreshments sponsored by:
The Optical Solutions Group at
Tuesday 14 AugustPanel Discussion . . . . . . . . . . . . . Tues. 10:30 am to 12:00 pm
Commercialization of Emerging Photovoltaic Technologies
Moderator:Loucas Tsakalakos,GEGlobalResearch(USA)
Panelists:
Vahan Garboushian, AmonixInc.(USA)
Garry Rumbles, NationalRenewableEnergyLab.(USA)andUniv.ofColoradoatBoulder(USA)
Brendan M. Kayes, AltaDevices,Inc.(USA)
Billy J. Stanbery,HelioVoltCorp.(USA)
Conference 8485
spie.org/opadvance · TEL:+13606763290 · help@spie.org 113
Conference 8486Monday-Wednesday 13-15 August 2012 • Proceedings of SPIE Vol. 8486
Current Developments in Lens Design and Optical Engineering XIIIConference Chairs:R. Barry Johnson, AlabamaA&MUniv.(UnitedStates)andConsultant(UnitedStates);Virendra N. Mahajan, TheAerospaceCorp.(UnitedStates);Simon Thibault, ImmerVision(Canada)andUniv.Laval(Canada)
Program Committee:Julie Bentley, Univ.ofRochester(UnitedStates);Florian Bociort, TechnischeUniv.Delft(Netherlands);Robert M. Bunch, Rose-HulmanInstituteofTechnology(UnitedStates);Pierre H. Chavel, Lab.CharlesFabry(France);Chung-Tse Chu, TheAerospaceCorp.(UnitedStates);Apostolos Deslis, JENOPTIKOpticalSystems,Inc.(UnitedStates);José Antonio Díaz, Univ.deGranada(Spain);Charles M. Falco, TheUniv.ofArizona(UnitedStates);Alexander V. Goncharov, NationalUniv.ofIreland,Galway(Ireland);James E. Harvey, CREOL,TheCollegeofOpticsandPhotonics,Univ.ofCentralFlorida(UnitedStates);Lakshminarayan Hazra, TheOpticalSocietyofIndia(India)andUniv.ofCalcutta(India);Irina L. Livshits, NationalResearchUniv.ofInformationTechnologies,MechanicsandOptics(RussianFederation);H. Angus Macleod, ThinFilmCenter,Inc.(UnitedStates);Mike Mandina, OptimaxSystems,Inc.(UnitedStates);Pantazis Mouroulis, JetPropulsionLab.(UnitedStates);Ching-Cherng Sun, NationalCentralUniv.(Taiwan);Yuzuru Takashima, CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates);Sergio Vázquez-Montiel, InstitutoNacionaldeAstrofísica,ÓpticayElectrónica(Mexico);Yongtian Wang, BeijingInstituteofTechnology(China);Andrew P. Wood, QioptiqLtd.(UnitedKingdom);Maria Josefa Yzuel, Univ.AutònomadeBarcelona(Spain)
Monday 13 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . .Mon. 8:30 to 10:30 am
Optical Design and AnalysisSession Chair: Virendra N. Mahajan, TheAerospaceCorp.(United
States)
Modeling centroid distortion in the LORRI telescope,RyanT.McMichael,JohnsHopkinsUniv.(UnitedStates);JulieL.Bentley,Univ.ofRochester(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8486-01]
On-orbit thermal distortion and optical performance evaluation of FORMOSAT-5 remote sensing instrument,ChenChing-Wei,NationalSpaceOrganization(Taiwan);ChenChia-Ray,NationalSpaceOrganization(NSPO)(Taiwan);Cheng-EnHo,Mei-YiYang,NationalSpaceOrganization(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8486-02]
Thermal optical path difference analysis of off-axis lens ray trace footprint at Cassegrain telescope correct lens assembly,Ming-YingHsu,InstrumentTechnologyResearchCtr.(Taiwan) . . . . . . . . . . . . . . . . . . . . . . . . . . . [8486-03]
Design and analysis of JMAPS instrument thermal control system,TriemT.Hoang,TTHResearch,Inc.(UnitedStates);KennethM.Weldy,RobertW.Baldauff,U.S.NavalResearchLab.(UnitedStates);DonaldE.Wilson,Praxis,Inc.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8486-04]
Eliminating Dewar Narcissus artifacts induced by moving optics in infrared staring focal plane sensors,PhilipM.McCulloch,CraigOlson,TimGoodman,L-3WESCAMSonomaOperations(UnitedStates) . . . . . . . . . . . . . . . [8486-05]
Stray light analysis in optical systems including binary optical elements,XiaotongLi,ZhaofengCen,ZhejiangUniv.(China). . . . . . . . . . . . . . . . [8486-06]
SESSION 2 . . . . . . . . . . . . . . . . . . . . Mon. 11:00 am to 12:10 pm
Lens Design and Optimization ISession Chair: R. Barry Johnson, AlabamaA&MUniv.(UnitedStates)
Design and fabrication of imaging optical systems with freeform surfaces (Invited Paper),XinZhang,ChangchunInstituteofOptics,FineMechanicsandPhysics(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8486-07]
Design and production of a lightweight compact Three Mirrors Anastigmat (TMA) optical system based on electroformed free-form, off-axis, toroidal mirrors for small satellites and UAVs,IvanFerrario,MediaLarioTechnologies(Italy) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8486-08]
Analytic free-form lens design for imaging applications with high aspect ratio,FabianDuerr,VrijeUniv.Brussel(Belgium);PabloBenítez,JuanCarlosMiñano,Univ.PolitécnicadeMadrid(Spain)andLPI(UnitedStates);YouriMeuret,HugoThienpont,VrijeUniv.Brussel(Belgium) . . . . . . . . . . . . [8486-09]
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:10to1:40pm
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 1:40 to 3:00 pm
Lens Design and Optimization IISession Chair: Simon Thibault, Univ.Laval(Canada)
Novel global optimization algorithms: binary construction and the saddle-point method,DonaldC.Dilworth,OpticalSystemsDesign,Inc.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8486-10]
Automated generation of optical designs with the Saddle Point Construction algorithm,PascalvanGrol,TNO(Netherlands)andDelftUniversityofTechnology(Netherlands);FlorianBociort,TechnischeUniv.Delft(Netherlands). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8486-11]
Design and implementation of multi-layer and multi-bit micro holographic optical data storage employing blue lasers,YuzuruTakashima,CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates) . . . . . . . . . . . . [8486-12]
Digital optical microscope as a sampled imaging system: mathematical description, camera selection, and focusing,VolodymyrN.Borovytsky,NationalTechnicalUniv.ofUkraine(Ukraine). . . . . . . . . . . . . . . . . . . . [8486-13]
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 3:30 to 5:10 pm
Lens Design and Optimization IIISession Chair: Pantazis Mouroulis, JetPropulsionLab.(UnitedStates)
Graphically selecting optical components and housing material for color correction and passive athermalization,ScottW.Sparrold,KatieSchwertz,EdmundOptics,Inc.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . [8486-14]
Reflaxicon objectives for imaging,GeorgNadorff,FrankDeWittIV,CVIMellesGriot(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8486-15]
Design and fabrication of the UV imaging Solc filter for the NASA IRIS mission,ThomasE.Berger,JasonMudge,BuckHolmes,LockheedMartinSpaceSystemsCo.(UnitedStates);PaulSearcy,MeadowlarkOptics,Inc.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8486-16]
Spectropolarimetry for Earth observations: optical system design,OanavanderTogt,KeesModdemeijer,AdVerlaan,TNO(Netherlands). . . . . . . [8486-17]
Using micro-projectors to realize large screen Head-Up Display,Ching-PaoWeng,Guo-DungSu,NationalTaiwanUniv.(Taiwan). . . . . . . . . . . . . [8486-18]
Posters-Monday . . . . . . . . . . . . . . . . . . . . Mon. 5:30 to 7:30 pmConference attendees are invited to attend the poster session on Monday
evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
Design and development of bi-directional viewer,Zong-RuYu,Cheng-FangHo,InstrumentTechnologyResearchCtr.(Taiwan);AnnieLiu,ColumbiaUniv.(UnitedStates)andInstrumentTechnologyResearchCenter,(TAIWANTECHTREK2011Intern)(Taiwan);Tai-WenLee,Wen-LungLin,Wei-YaoHsu,InstrumentTechnologyResearchCtr.(Taiwan) . . . . . . . . . . . . . . . . . . [8486-40]
114 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Static structure and wavefront error analysis of the primary mirror of an experimental telescope,Po-HsuanHuang,Shenq-TsongChang,InstrumentTechnologyResearchCtr.(Taiwan) . . . . . . . . . . . . . . . . . . . . . . . . . . . [8486-41]
Fabrication of 160-mm convex hyperbolic mirror for remote sensing instrument,Ching-HsiangKuo,Zong-RuYu,Cheng-FangHo,Wei-YaoHsu,Fong-ZhiChen,InstrumentTechnologyResearchCtr.(Taiwan) . . . . . [8486-42]
Super-resolution microscopy employing propagation-invariant laser beams,MichaelSoskind,WestWindsor-PlainsboroHighSchoolSouth(UnitedStates);RoseSoskind,Rutgers,TheStateUniv.ofNewJersey(UnitedStates);YakovSoskind,DHPCTechnologies(UnitedStates) . . . . . . . . . . . . . . . . . . . [8486-43]
Method for determining individual element misalignments in optical systems,EstherOteo,Univ.PolitècnicadeCatalunya(Spain);JoséAntonioDíaz,Univ.deGranada(Spain);JosepArasa,Univ.PolitècnicadeCatalunya(Spain). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8486-44]
High-precision semi-spherical meter of two degrees of freedom,MargaritaTecpoyotl-Torres,JoseGerardoVera-Dimas,SaulE.Martinez-Fabian,J.JesúsEscobedo-Alatorre,Univ.AutónomadelEstadodeMorelos(Mexico);OscarG.Ibarra-manzano,Univ.deGuanajuato(Mexico). . . . . . . . . . . . . . . . . . [8486-45]
Basic optical properties of the photoelastic modulator part III: thermal properties,LindaM.Hirschy,BaolingWang,JacobWolf,BobLakanen,HindsInstruments,Inc.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8486-46]
Design of large aperture four group elements mid-wave infrared zoom lens,YiqunJi,WeiminShen,SoochowUniv.(China). . . . . . . . . . . . . . . . . . [8486-47]
Control measurement system for railway track position,AntonPantyushin,NationalResearchUniv.ofInformationTechnologies,MechanicsandOptics(RussianFederation). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8486-48]
Spatial distribution of the retroreflected light,AndreyG.Anisimov,ValeryV.Korotaev,NationalResearchUniv.ofInformationTechnologies,MechanicsandOptics(RussianFederation) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8486-49]
Electrostatic focusing system with high-volume demagnification,ArtushA.Abgaryan,EliLevi,AISC,Inc.(UnitedStates). . . . . . . . . . . . . . . . . . . . [8486-50]
Angle-independent color filters based on subwavelength silicon gratings,LiangHong,ChenyingYang,WeidongShen,HuiYe,XuLiu,ZhejiangUniv.(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8486-51]
Investigation of the optical and structural properties of WO 3 thin films with different sputtering power supplies,Hsi-ChaoChen,NationalYunlinUniv.ofScienceandTechnology(Taiwan);Der-JunJan,InstituteofNuclearEnergyResearch(Taiwan);Chien-HanChen,Kuo-TingHuang,Jia-MinChen,NationalYunlinUniv.ofScienceandTechnology(Taiwan) . . . . . . . . . . . . . . . . [8486-52]
Influence of laser photothermal strains on inelastic characteristics of SiO 2 + Si,AnatoliyP.Onanko,NationalTarasShevchenkoUniv.ofKyiv(Ukraine) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8486-53]
Illumination Technical Event . . . . . . . . Mon. 8:00 to 10:00 pm
Chair: Jake Jacobsen,Synopsys,Inc.(USA)
Interestinfree-formopticshasbeenincreasinginrecentyears.Withadvancesincomputationalmethods,theuseofsuchsurfaceshasbecomepracticalforawiderangeofapplicationswhereprecisetailoringtheilluminationpatterniscritical.Atthisyear’stechnicaleventwewilldiscussissuessurroundingthespecificationanduseoffree-formopticsforilluminationsystems.
Thefollowingspeakershaveagreedtotalkattheeventandparticipateinapaneldiscussionafterwards:
Dr. William Cassarly, Synopsys,Inc.(USA)
Prof. Pablo Benítez,Univ.PolitécnicadeMadrid(Spain)andLightPrescriptionsInnovatorsLLC(USA)
Prof. Harald Ries, OpticsandEnergyConceptsAG(Germany)
Attheendoftheplannedevent,timepermitting,anymemberoftheaudiencemaypresentinformationwithinthebroadfieldofillumination.Lightrefreshmentswillbeserved.
Light refreshments sponsored by:
The Optical Solutions Group at
Tuesday 14 AugustSESSION 5 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 8:30 to 9:50 am
Current Development in Fabrication ISession Chair: Mike Mandina, OptimaxSystems,Inc.(UnitedStates)
Application of Visible Quality (VQ) bare aluminum polishing processes to production optics: performance, economies, and benefits,KeithCarrigan,AnkitPatel,JayDaniel,MikeRiso,ShaynaKhatri,L-3CommunicationsTinsleyLabs.Inc.(UnitedStates);ChrisDuston,L-3CommunicationsSSG-Tinsley(UnitedStates);J.B.Barentine,L-3Brashear(UnitedStates);TonyHull,L-3CommunicationsTinsleyLabs.Inc.(UnitedStates). . . . . . . . . . . . . . . [8486-19]
Fly-cutting and testing of freeform optics with sub-μm shape deviations,RalfSteinkopf,AndreasGebhardt,StefanRisse,Fraunhofer-InstitutfürAngewandteOptikundFeinmechanik(Germany). . . . . . . . . . . . . . . . . [8486-20]
Parameters investigation of air-driving fluid jet polishing,Zong-RuYu,Wei-YaoHsu,InstrumentTechnologyResearchCtr.(Taiwan);LocHuuPham,NationalTaiwanUniv.ofScienceandTechnology(Taiwan);Cheng-FangHo,Ching-HsiangKuo,InstrumentTechnologyResearchCtr.(Taiwan);Fang-JungShiou,NationalTaiwanUniv.ofScienceandTechnology(Taiwan). . . [8486-21]
Game-changing approaches to affordable advanced lightweight mirrors III: a smaller case analyzed for extreme ZERODUR® lightweighting and relief from the classical polishing parameter constraint,TonyHull,AndrewR.Clarkson,GeorgeJ.Gardopee,L-3IntegratedOpticalSystems(UnitedStates);RalfJedamzik,SCHOTTAG(Germany);AntoineLeys,SCHOTTNorthAmerica,Inc.(UnitedStates);JohnW.Pepi,FrançoisPiché,L-3IntegratedOpticalSystems(UnitedStates);MartinSchäfer,VolkerSeibert,SCHOTTNorthAmerica,Inc.(UnitedStates);ThomasWesterhoff,SCHOTTAG(Germany);RaymondM.Bell,Jr.,LockheedMartinSpaceSystemsCo.(UnitedStates);SteveKendrick,BallAerospace&TechnologiesCorp.(UnitedStates);AllenLee,L-3IntegratedOpticalSystems(UnitedStates). . . . . . . . . . . . . . . . . . [8486-22]
SESSION 6 . . . . . . . . . . . . . . . . . . . . . . . Tues. 10:20 to 11:40 am
Current Development in Fabrication IISession Chair: Apostolos Deslis, JENOPTIKOpticalSystems,Inc.
(UnitedStates)
Hybrid polishing of fused silica glass with bound-abrasive polishers in conjunction with vibration,YaguoLi,AkitaPrefecturalUniv.(Japan) [8486-23]
Ultrastable mirrors made from diamond reinforced SiC composites for high precision and power applications,MehmetA.Akbas,DanielMastrobattisto,BillVance,PeterJurgaitis,MichaelAghajanian,MCubedTechnologies,Inc.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8486-24]
light weight silicon mirrors for space instrumentation,VincentT.Bly,PeterC.Hill,JohnG.Hagopian,CarlR.Strojny,TimothyM.Miller,NASAGoddardSpaceFlightCtr.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8486-25]
Study on measurement of 160-mm convex hyperbolic mirror for Cassegrain reflecting system,Cheng-FangHo,Zong-RuYu,Ching-HsiangKuo,Wei-YaoHsu,InstrumentTechnologyResearchCtr.(Taiwan). . . . . . . . . . . . . . [8486-26]
Lunch/Exhibition Break........................... 11:40amto1:00pm
SESSION 7 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 1:00 to 2:30 pm
Solid State LightingSession Chair: Ching-Cherng Sun, NationalCentralUniv.(Taiwan)
Smart LED-based lighting system by a lens design technique (Invited Paper),Chung-HaoTien,NationalChiaoTungUniv.(Taiwan). . . . . . . . . . . . . [8486-27]
Solid state light source for wavelength multiplex 3D,JunejeiHuang,DeltaElectronics,Inc.(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8486-28]
Color mixing collimating lamp based on RGB LEDs,Yi-ChienLo,IvanMoreno,Bo-ChunChiu,Ching-CherngSun,Jhih-YouCai,Yu-YuChang,NationalCentralUniv.(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8486-29]
Planar light source by using side-emitting of GaN die with top and bottom reflector,Chi-ShouWu,Cheng-ChienChen,Ming-SiouTsai,NationalCentralUniv.(Taiwan);Tsung-XianLee,NationalTaiwanUniv.ofScienceandTechnology(Taiwan);Ching-CherngSun,NationalCentralUniv.(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8486-30]
Conference 8486
spie.org/opadvance · TEL:+13606763290 · help@spie.org 115
SESSION 8 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 2:30 to 3:30 pm
Tunable LensesSession Chair: Robert M. Bunch, Rose-HulmanInstituteofTechnology
(UnitedStates)
Liquid crystal lens focusing in monocentric multiscale imagers,IgorStamenov,Univ.ofCalifornia,SanDiego(UnitedStates);EricTremblay,EcolePolytechniqueFédéraledeLausanne(Switzerland);KatherineBaker,JosephFord,Univ.ofCalifornia,SanDiego(UnitedStates). . . . . . . . . . . . . . . [8486-31]
Analysis of factors affecting performance of electro-optical tunable lens,LiweiLi,DougBryant,KentStateUniv.(UnitedStates);TonyVanHeugten,eVision,LLC(UnitedStates);PhilipJ.Bos,KentStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8486-32]
Microelectrofluidic lens for variable curvature,Jong-HyeonChang,EunsungLee,Kyu-DongJung,SeungwanLee,MinseogChoi,WoonbaeKim,SamsungAdvancedInstituteofTechnology(Korea,Republicof) . . . . . . . . . . . . [8486-33]
Optical Engineering Plenary Session . Tues. 4:00 to 5:35 pm
Session Chairs: Jose Sasian, CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates); R. John Koshel, PhotonEngineeringLLC(UnitedStates)andCollegeofOpticalSciences,TheUniv.ofArizona
(UnitedStates)
4:00pm: Welcome and Opening Remarks
4:05pm: A New Job for Telescopes: Making Solar Electricity, J.RogerP.Angel,StewardObservatoryMirrorLab.,TheUniv.ofArizonaCollegeofOpticalSciences(UnitedStates)andREhnuLLC(UnitedStates)
4:50pm:From Titanic to the Tiny: Three Decades of Underwater Optical Imaging, JulesS.Jaffe,ScrippsInstitutionofOceanography(USA)
Lens Design Technical Event . . . . . . . Tues. 8:00 to 10:00 pm
Session Chair:Rich Pfisterer, PhotonEngineering,LLC(UnitedStates)
“Let’s Give ‘Em Something to Talk About!”Lensdesigners!Joinusforourannualgatheringtomeetanddiscuss...lensdesign!Let’stalkaboutwhatwe’redesigning,howwe’regoingaboutdoingit(whatmaterials,software,techniques,etc.),andwhichproblemswe’reencountering.We’llalsoexplorecurrenttechnicalandcommercialtrendsinthemarketplace.
Light refreshments sponsored by:
The Optical Solutions Group at
Conference 8486
Wednesday 15 AugustSESSION 9 . . . . . . . . . . . . . . . . . . . . . . . . .Wed. 8:00 to 10:30 am
Optical Thin FilmsSession Chair: H. Angus Macleod, ThinFilmCenter,Inc.(UnitedStates)
Generation of Si3N4 layers for laser applications,JensLandrock,MichaelZeuner,MatthiasNestler,DirkRost,Roth&RauMicroSystemsGmbH(Germany);MarcKelemen,RudolphMoritz,m2k-laserGmbH(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8486-34]
Innovative guided mode method for measuring the penetration depth in partially exposed photo-resist layers,ThomasM.Wood,InstitutMatériauxMicroélectroniqueNanosciencesdeProvence(France);VincentBrissonneau,ThalesOptroniqueSA(France);JeanBaptisteBrückner,InstitutMateriauxNanoelectroniquedeProvence(France);FrancoisFlory,JudikaelLeRouzo,LudovicEscoubas,InstitutMatériauxMicroélectroniqueNanosciencesdeProvence(France). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8486-35]
Empirical modelling of the properties of optical thin film materials in ion-beam-assisted evaporation,DirkIsfort,DianaA.Tonova,ThomasKoch,CarlZeissAG(Germany);StefanSpinzig,CarlZeissJenaGmbH(Germany)[8486-36]
Co-extruded multilayer films for high capacity optical data storage,CoryW.Christenson,ChrisRyan,BrentValle,AnujSaini,JosephLott,JackJohnson,DavidShiraldi,CaseWesternReserveUniv.(UnitedStates);ChristophWeder,Univ.ofFribourg(Switzerland);EricBaer,KennethD.Singer,JieShan,CaseWesternReserveUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . [8486-37]
Design of a five-layered symmetrical structure for an achromatic phase retardation,YiJunJen,MengJieLin,ChienChiChen,NationalTaipeiUniv.ofTechnology(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8486-38]
Gain in optical coatings,H.AngusMacleod,ChristopherClark,ThinFilmCenter,Inc.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8486-39]
116 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Conference 8487Wednesday-Thursday 15-16 August 2012 • Proceedings of SPIE Vol. 8487
Novel Optical Systems Design and Optimization XVConference Chairs:G. Groot Gregory, Synopsys,Inc.(UnitedStates);Arthur J. Davis, ReflexiteEnergySolutions(UnitedStates)
Program Committee:W. Andrew Cheng, PROSYSOpticsCorp.(UnitedStates);Jyh-Long Chern, PowerLensTechnologyInc.(Taiwan)andNationalChiaoTungUniv.(Taiwan);Frank S. Grochocki, BallAerospace&TechnologiesCorp.(UnitedStates);Andrew R. Harvey, Univ.ofGlasgow(UnitedKingdom);Joseph M. Howard, NASAGoddardSpaceFlightCtr.(UnitedStates);Richard C. Juergens, RaytheonMissileSystems(UnitedStates);R. John Koshel, PhotonEngineeringLLC(UnitedStates)andCollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates);Scott A. Lerner, nLIGHTCorp.(UnitedStates);Rongguang Liang, CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates);Paul K. Manhart, NASALangleyResearchCtr.(UnitedStates);Rubén Mohedano, LightPrescriptionsInnovatorsEurope,S.L.(Spain);Jorge Ojeda-Castaneda, Univ.deGuanajuato(Mexico);Craig Olson, L-3WESCAMSonomaOperations(UnitedStates);Andrew Rakich, LargeBinocularTelescopeObservatory(UnitedStates);Michael D. Robinson, RicohInnovations,Inc.(UnitedStates);Kevin P. Rolland-Thompson, Synopsys,Inc.(UnitedStates);José Sasián, CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates);David L. Shealy, TheUniv.ofAlabamaatBirmingham(UnitedStates);Andrew W. Sparks, L-3Wescam(UnitedStates);Marija Strojnik, Ctr.deInvestigacionesenÓptica,A.C.(Mexico)
Monday 13 AugustPosters-Monday . . . . . . . . . . . . . . . . . . . . Mon. 5:30 to 7:30 pm
Conference attendees are invited to attend the poster session on Monday evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
Use of holographic lenses to realize Double aperture speckle interferometer for its use in detection of phase object using double exposure speckle modulated fringe pattern,HiralalYadav,NationalInstituteofTechnology,Jamshedpur(India);RajendraK.Jayaswal,JamshedpurWomen’sCollege(India);AbhijitGhosh,BirlaInstituteofTechnology(India);NirmalenduDeo,NextGenerationTechnology,Inc.(UnitedStates);P.K.Barhai,BirlaInstituteofTechnology(India). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8487-04]
An overview of supporting ways for large-size movement mirror: a case study of radial support for large-aperture rotating prism,AnhuLi,WeiWang,YeDing,TongjiUniv.(China);JianfengSun,ShanghaiInstituteofOpticsandFineMechanics(China);YongjianZhu,ZhejiangUniv.ofScience&Technology(China);ZhizhongLi,TongjiUniv.(China). . . . . . . . . . . . . . . . . . . . . . . [8487-30]
Hybrid information transmitting system,EvgenijDashkevich,St.PetersburgStateUniv.ofAerospaceInstrumentation(RussianFederation). . . . . . [8487-31]
2D-orientation tomography of biological tissues polycrystalline networks,MykhailoP.Gorsky,YuriyFedkovychChernivtsiNationalUniv.(Ukraine) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8487-32]
Two-dimensional Mueller matrix phase tomography of self-similarity birefringence structure of biological tissues,VladimirA.Ushenko,YuriyFedkovychChernivtsiNationalUniv.(Ukraine). . . . . . . . . . . . . . . . . . . [8487-33]
Fourier phasometry of polarization filtered biological liquids images,PavelO.Angelsky,YuriyFedkovychChernivtsiNationalUniv.(Ukraine). . . . [8487-34]
Compact motorized circular wheel of polarization optics for ultra-broadband polarization state generation,Chun-JenWeng,Ken-YuhHsu,Yung-FuChen,NationalChiaoTungUniv.(Taiwan);Da-RenLiu,InstrumentTechnologyResearchCtr.(Taiwan) . . . . . . . . . . . . . . . . . . . . . . . . . . . [8487-35]
Widefield long working distance micro objectives,AlexeyD.Frolov,NationalResearchUniv.ofInformationTechnologies,MechanicsandOptics(RussianFederation);OlgaA.Vinogradova,DmitryN.Frolov,Labor-microscopes(RussianFederation) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8487-36]
Correlation processing of polarization inhomogenous images in laser diagnostics of biological tissues,AlexanderV.Dubolazov,YuriyFedkovychChernivtsiNationalUniv.(Ukraine). . . . . . . . . . . . . . . . . . . . . . . . . . . . [8487-37]
Optical system for study of temporal dynamics of a change in the complex degree of polarization in liquor laser images,AlexanderV.Dubolazov,YuriyFedkovychChernivtsiNationalUniv.(Ukraine). . . . . . . . . . . . . . . . . . . [8487-38]
Stokes polarimetry of biological tissues oncological changes,ArtemO.Karachevtsev,YuriyFedkovychChernivtsiNationalUniv.(Ukraine) . . [8487-39]
Tilt operator for harmonic fields and its application to propagation through plane interfaces,FrankWyrowski,SiteZhang,DanielAsoubar,Friedrich-Schiller-Univ.Jena(Germany);MichaelKuhn,LightTransVirtualLabUG(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8487-40]
Focused cylindrical vector beam assisted microscopic pSPR biosensor with an ultra wide dynamic range,RongWang,NankaiUniv.(China). . . . [8487-41]
Illumination Technical Event . . . . . . . . Mon. 8:00 to 10:00 pm
Chair: Jake Jacobsen,Synopsys,Inc.(USA)
Interestinfree-formopticshasbeenincreasinginrecentyears.Withadvancesincomputationalmethods,theuseofsuchsurfaceshasbecomepracticalforawiderangeofapplicationswhereprecisetailoringtheilluminationpatterniscritical.Atthisyear’stechnicaleventwewilldiscussissuessurroundingthespecificationanduseoffree-formopticsforilluminationsystems.
Thefollowingspeakershaveagreedtotalkattheeventandparticipateinapaneldiscussionafterwards:
Dr. William Cassarly, Synopsys,Inc.(USA)
Prof. Pablo Benítez,Univ.PolitécnicadeMadrid(Spain)andLightPrescriptionsInnovatorsLLC(USA)
Prof. Harald Ries, OpticsandEnergyConceptsAG(Germany)
Attheendoftheplannedevent,timepermitting,anymemberoftheaudiencemaypresentinformationwithinthebroadfieldofillumination.Lightrefreshmentswillbeserved.
Light refreshments sponsored by:
The Optical Solutions Group at
Tuesday 14 AugustOptical Engineering Plenary Session . Tues. 4:00 to 5:35 pm
Session Chairs: Jose Sasian, CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates); R. John Koshel, PhotonEngineeringLLC(UnitedStates)andCollegeofOpticalSciences,TheUniv.ofArizona
(UnitedStates)
4:00pm: Welcome and Opening Remarks
4:05pm: A New Job for Telescopes: Making Solar Electricity, J.RogerP.Angel,StewardObservatoryMirrorLab.,TheUniv.ofArizonaCollegeofOpticalSciences(UnitedStates)andREhnuLLC(UnitedStates)
4:50pm:From Titanic to the Tiny: Three Decades of Underwater Optical Imaging, JulesS.Jaffe,ScrippsInstitutionofOceanography(USA)
Lens Design Technical Event . . . . . . . Tues. 8:00 to 10:00 pm
Session Chair:Rich Pfisterer, PhotonEngineering,LLC(UnitedStates)
“Let’s Give ‘Em Something to Talk About!”Lensdesigners!Joinusforourannualgatheringtomeetanddiscuss...lensdesign!Let’stalkaboutwhatwe’redesigning,howwe’regoingaboutdoingit(whatmaterials,software,techniques,etc.),andwhichproblemswe’reencountering.We’llalsoexplorecurrenttechnicalandcommercialtrendsinthemarketplace.
Light refreshments sponsored by:
The Optical Solutions Group at
spie.org/opadvance · TEL:+13606763290 · help@spie.org 117
Optomechanical/Instrument Technical Group Event . . . . . . . . . . . . Tues. 8:00 to 10:00 pm
Session Chair: Alson E. Hatheway, AlsonE.HathewayInc.(UnitedStates)
Thisistheannualmeetingofthepremiergroupofoptomechanicalengineersthatdesignandanalyzetheworld’sopticalinstrumentsandsystems.ThisgatheringisopentoallattendeestotheOpticsandPhotonicsSymposium.AnyonewhowishestoputanitemontheagendashouldcontacttheChair,AlHatheway,ataeh@aehinc.com.
OurprincipalspeakerwillbeMr.BradSteele,DirectorofEngineeringatQuartus,Inc.,SanDiego,California.Histopicwillbe“MethodsEmployedinDesignforMountingLargeApertureTransmissiveOptics.”Quartushassuccessfullydesignedanddeployednumerousopticalsystemsmountinglargetransmissiveoptics.Hewillshareapproachesandinsightsintosystemoptimizationandnovelanalysismethodsdevelopedtosupportthedesignprocess.
FollowingMr.Steelethefloorwillbeopenforotheragendaitemsandourtraditional‘ProblemsandSolutionsWorkshop’session.BepreparedtopresentsomechallengestotheGroup.
Wednesday 15 AugustWelcome and Opening Remarks . . . . . . . .Wed. 8:40 to 8:50 am
G. Groot Gregory,Synopsys,Inc.(UnitedStates); Arthur J. Davis,ReflexiteEnergySolutions(UnitedStates)
SESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . .Wed. 8:50 to 10:10 am
InstrumentationSession Chair: Craig Olson, L-3WESCAMSonomaOperations(United
States)
Design and implementation of an imaging nephelometer,DanielK.Frayer,MichaelTaylor,NationalSecurityTechnologies,LLC(UnitedStates) . [8487-01]
An examination of the sensitivity and systematic error of the NASA GEMS Bragg Reflection Polarimeter using ray tracing simulations,RyanAllured,TheUniv.ofIowa(UnitedStates);TakashiOkajima,NASAGoddardSpaceFlightCtr.(UnitedStates);ReginaSoufli,MonicaFernandezPerea,MichaelJ.Pivovaroff,LawrenceLivermoreNationalLab.(UnitedStates);HannahMarlowe,ScottT.Griffiths,PhilipKaaret,TheUniv.ofIowa(UnitedStates). . . . [8487-03]
Measurement of optical characteristics in dielectric liquid lens by Shack-Hartmann wave front sensors,PeiJ.Wang,JerA.Yeh,YuT.Tung,ChiaY.Hsu,NationalTsingHuaUniv.(Taiwan) . . . . . . . . . . . . . . . . . . . . . . . . [8487-05]
Use of holographic lenses to record double exposure specklegram for generation of speckle correlation fringes in measurement volume of Laser Doppler Anemometry,HiralalYadav,NationalInstituteofTechnology,Jamshedpur(India);AbhijitGhosh,BirlaInstituteofTechnology(India);NirmalenduDeo,NextGenerationTechnology,Inc.(UnitedStates);KingshukBose,BirlaInstituteofTechnologyandScience(India). . . . . . . . . . . . [8487-02]
SESSION 2 . . . . . . . . . . . . . . . . . . . . Wed. 10:40 am to 12:00 pm
Novel SystemsSession Chair: Andrew W. Sparks, L-3WESCAMSonomaOperations
(UnitedStates)
Optical system designs based on bi-directional sensor devices,ConstanzeGrossmann,UteGawronski,GuntherNotni,AndreasTünnermann,Fraunhofer-InstitutfürAngewandteOptikundFeinmechanik(Germany). . . . . . . . [8487-06]
LED illuminator for a microdisplay projector,SimonMagarill,Synopsys,Inc.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8487-07]
8-views full HD single projector autostereoscopic system,YuChangWang,DeltaElectronics,Inc.(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8487-08]
Geometrical stereo matching image guidance for ground vehicle on focused image pixel grouping and stacked images statistical operation,AkiraAkiyama,KanazawaTechnicalCollege(Japan);NobuakiKobayashi,KanazawaInstituteofTechnology(Japan);HideoKumagai,TamagawaSeikiCo.,Ltd.(Japan);EiichiroMutoh,TheSocietyofJapaneseAerospaceCompanies(Japan);HiromitsuIshii,NihonUniv.(Japan). . . . . . . . . . . . . . . . . . . . . [8487-09]
Lunch/Exhibition Break.............................. 12:00to1:30pm
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 1:30 to 3:20 pm
Design MethodsSession Chair: Kevin P. Rolland-Thompson, Synopsys,Inc.(United
States)
Non-MacAdam color discrimination ellipses (Invited Paper),PeterI.Goldstein,PhilipsSolid-StateLightingSolutions(UnitedStates) . . . . . . . . . . . . . [8487-10]
Asphere design for dummies,ScottW.Sparrold,KeitaOka,EdmundOptics,Inc.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8487-11]
Radially symmetric freeform lens design for extended sources,PeterI.Goldstein,PhilipsSolid-StateLightingSolutions(UnitedStates). . . . . [8487-12]
Direct optimization of as-built lens performance,JamesP.McGuire,Jr.,Synopsys,Inc.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8487-13]
Novel approach for merit function optimization in hybrid imaging system through finite impulse response method,Chuan-ChungChang,Yuan-LinChen,Kuang-VuChen,Hsiao-YueTsao,Chir-WeeiChang,IndustrialTechnologyResearchInstitute(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8487-14]
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 3:50 to 6:00 pm
Computational ToolsSession Chair: Arthur J. Davis, ReflexiteEnergySolutions(United
States)
SAGUARO: Open source data analysis and visualization software for optical engineering (Invited Paper),GregA.Smith,BenjaminJ.Lewis,MichaelPalmer,DaeWookKim,AdrianR.Loeff,JamesH.Burge,CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . [8487-15]
Analysis and compression of plenoptic camera images with Zernike polynomials,JimSchwiegerling,TheUniv.ofArizona(UnitedStates);GabrielC.Birch,ScottTyo,CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8487-16]
Photorealistic rendering application to the design of LED flash lens,Jyh-LongChern,PowerLensTechnology,Inc.(Taiwan). . . . . . . . . . . . . . . [8487-17]
Parabasal field decomposition and its application to non-paraxial field propagation,FrankWyrowski,DanielAsoubar,SiteZhang,Friedrich-Schiller-Univ.Jena(Germany);MichaelKuhn,LightTransVirtualLabUG(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8487-18]
Design of scale distorting imaging devices with tilted object plane,CorneliusF.Hahlweg,Helmut-SchmidtUniv.(Germany). . . . . . . . . . . . . . . . . . . [8487-19]
Acquisition errors in micro-satellite synthetic aperture telescopes,IsaiaS.Glaser,HolonInstituteofTechnology(Israel). . . . . . . . . . . . . . . . . . . . [8487-20]
Thursday 16 AugustWelcome and Opening Remarks . . . . . . Thurs. 8:20 to 8:30 am
G. Groot Gregory, Synopsys,Inc.(UnitedStates); Arthur J. Davis,ReflexiteEnergySolutions(UnitedStates)
SESSION 5 . . . . . . . . . . . . . . . . . . . . . . . Thurs. 8:30 to 10:30 am
Biomedical SystemsSession Chair: R. John Koshel, CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates)andPhotonEngineeringLLC(UnitedStates)
Extended depth of field system for long distance iris acquisition,Yung-LinChen,Sheng-HsunHsieh,Kuo-EnHung,NationalChiaoTungUniv.(Taiwan);Yung-HuiLi,FengChiaUniv.(Taiwan);Chung-HaoTien,NationalChiaoTungUniv.(Taiwan) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8487-21]
Development of a numerical framework for studying intrinsic parameter of a micro-lens-based optical detector,SteffenPaar,XiaomingJiang,WolfhardSemmler,JörgPeter,DeutschesKrebsforschungszentrumDKFZ(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8487-22]
A novel electro/optical pump/probe system for bioelectromagnetic investigations,AnnalisaDeAngelis,VincentCouderc,PhilippeLeproux,AlexisLabruyère,AlessandroTonello,DeliaArnaud-Cormos,Univ.deLimoges(France). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8487-23]
Design of a confocal fluorescence microscope: space saving and affordable,ChristinBechtel,TechnischeUniv.Dresden(Germany);JensKnobbe,HeinrichGrüger,HubertLakner,Fraunhofer-InstitutfürPhotonischeMikrosysteme(Germany).................................... [8487-24]
Conference 8487
118 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Design of an optical probe compatible for multimodal imaging,MinseogChoi,SeungwanLee,JonghyeonChang,EunsungLee,KyudongJung,WoonbaeKim,SamsungAdvancedInstituteofTechnology(Korea,Republicof) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8487-25]
An optimized adaptive optics experimental setup for in vivo retinal imaging,SandraE.Balderas-Mata,LuisG.ValdiviesoGonzalez,GustavoRamírez-Zavaleta,EstelaLópez-Olazagasti,EduardoTepichin-Rodriguez,InstitutoNacionaldeAstrofísica,ÓpticayElectrónica(Mexico). . . . . . . . . . . . . [8487-26]
SESSION 6 . . . . . . . . . . . . . . . . . . . Thurs. 11:00 am to 12:10 pm
Music and HistorySession Chair: G. Groot Gregory, Synopsys,Inc.(UnitedStates)
Topics in optics and music (Invited Paper),AndrewW.Sparks,L-3WESCAMSonomaOperations(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . [8487-27]
The unique sound of the Univibe pedal,CorneliusF.Hahlweg,Helmut-SchmidtUniv.(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8487-28]
Uranium glass in optics: historical review and current research,CorneliusF.Hahlweg,Helmut-SchmidtUniv.(Germany);HendrikRothe,Helmut-SchmidtUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8487-29]
Conference 8487
Formation of a Digital Image: The Imaging Chain SimplifiedbyRobert D. FieteVol.PM218
Field Guide to Adaptive Optics, Second EditionbyRobert K. Tyson and Benjamin W. FrazierVol.FG24
Books of Related InterestVisittheonsiteBookstoreororderonlinetoday:spie.org/publications
Field Guide to Image ProcessingbyKhan M. Iftekharuddin and Abdul A. AwwalVol.FG25
Field Guide to RadiometrybyBarbara G. GrantVol.FG23
spie.org/opadvance · TEL:+13606763290 · help@spie.org 119
Conference 8488 · NEWSunday-Monday 12-13 August 2012 • Proceedings of SPIE Vol. 8488
Zoom Lenses IVConference Chairs:Ellis I. Betensky, Consultant(Canada);Takanori Yamanashi, PanavisionInternationalLLC(UnitedStates)
Program Committee:Robert M. Bates, FiveFocalLLC(UnitedStates);Akira Fukushima, KonicaMinoltaTechnologyCtr.(Japan);Irina L. Livshits, NationalResearchUniv.ofInformationTechnologies,MechanicsandOptics(RussianFederation);Rung-Ywan Tsai, IndustrialTechnologyResearchInstitute(Taiwan);Wilhelm Ulrich, CarlZeissAG(Germany);Akira Yabe, Consultant(Germany);Richard N. Youngworth, RiyoLLC(UnitedStates)
Sunday 12 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 8:50 to 10:00 am
Modeling and OptimizationSession Chair: Wilhelm Ulrich, CarlZeissAG(Germany)
Toward the global optimum in zoom lens design (Invited Paper),AurelianDodoc,CarlZeissAG(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8488-01]
Method of zoom lenses aberrations analysis,IrinaL.Livshits,KseniaEzhova,VictorA.Zverev,NationalResearchUniv.ofInformationTechnologies,MechanicsandOptics(RussianFederation);NguenLuen,NationalResearchUniv.ofInformationTechnologies,MechanicsandOptics(VietNam). [8488-02]
Catadioptric varifocal objective,ElenaV.Ermolaeva,IrinaL.Livshits,VladimirVasiliyev,NationalResearchUniv.ofInformationTechnologies,MechanicsandOptics(RussianFederation) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8488-03]
SESSION 2 . . . . . . . . . . . . . . . . . . . . . Sun. 10:30 am to 12:00 pm
Zoom Lens Design Basics 2012Session Chair: Takanori Yamanashi, PanavisionInternationalLLC
(UnitedStates)
Developments and trends in infrared zoom lenses from 2000 to 2010 (Invited Paper),AllenMann,AMAssociates(UnitedStates). . . . . . . . . . . . . . . [8488-04]
Fundamental considerations for large magnification range zoom lens design (tutorial) (Invited Paper),EllisI.Betensky,Consultant(Canada);RichardN.Youngworth,RiyoLLC(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . [8488-05]
The AWMC metric for zoom lens assessment,RichardN.Youngworth,RiyoLLC(UnitedStates);EllisI.Betensky,Consultant(Canada). . . . . . . . . [8488-06]
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:00to1:30pm
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 1:30 to 3:00 pm
Applications I: BiomedicalSession Chair: Richard N. Youngworth, RiyoLLC(UnitedStates)
Afocal zoom lenses and their applications (Invited Paper),ArturHoegele,CarlZeissMeditecAG(Germany);JohannesWinterot,CarlZeissJenaGmbH(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8488-07]
Four zooming lens design for 3D laparoscope by using liquid lens,SeungwanLee,MinseogChoi,EunsungLee,Kyu-DongJung,Jong-HyeonChangChang,WoonbaeKim,SamsungAdvancedInstituteofTechnology(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8488-08]
Design of a 15x broadband macro zoom lens for NIR fluorescence image-guided surgery,JulieBentley,Univ.ofRochester(UnitedStates);JohnV.FrangioniM.D.,SylvainGioux,BethIsraelDeaconessMedicalCtr.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8488-09]
Design, assembly, and testing of a telecentric zoom lens for the Cygnus x-ray source,RobertM.Malone,StuartA.Baker,NationalSecurityTechnologies,LLC(UnitedStates);KristinaK.Brown,NationalSecurityTechnoligies,LLC(UnitedStates);BrianC.Cox,NationalSecurityTechnoligies.LLC(UnitedStates);AldenH.Curtis,DavidL.Esquibel,PaulA.Flores,DanielK.Frayer,BrentC.Frogget,NationalSecurityTechnologies,LLC(UnitedStates);MichaelR.Furlanetto,LosAlamosNationalLab.(UnitedStates);JamesR.Garten,NationalSecurityTechnologies,LLC(UnitedStates);ToddJ.Haines,LosAlamosNationalLab.(UnitedStates);RussellA.Howe,MorrisI.Kaufman,NationalSecurityTechnologies,LLC(UnitedStates);NickolasS.P.King,LosAlamosNationalLab.(UnitedStates);StephenS.Lutz,NationalSecurityTechnologies,LLC(UnitedStates);KevinD.McGillivray,NationalSecurityTechnologies.LLC(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . [8488-10]
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 3:30 to 5:00 pm
Applications II: Miniature OpticsSession Chair: Akira Fukushima, KonicaMinoltaTechnologyCtr.
(Japan)
Development of compact optical zoom lenses with extended-depth-of-field (Invited Paper),MadsDemenikov,PeterM.W.Skovgaard,JesperF.Offersgaard,KaleidoTechnologyApS(Denmark)................. [8488-11]
Optical zoom lens module using MEMS deformable mirrors for portable device,Jia-ShiunLu,Guo-DungSu,NationalTaiwanUniv.(Taiwan). [8488-12]
Thin zoom camera module by large-stroke micromachined deformable mirrors,YuHungHuang,Guo-DungSu,NationalTaiwanUniv.(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8488-13]
Zoom camera design with liquid lenses and discrete lens groups shifts through genetic algorithm optimization,Cheng-MuTsai,KunShanUniv.(Taiwan);Yi-ChinFang,NationalKaohsiungFirstUniv.ofScienceandTechnology(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8488-14]
Symposium-Wide Plenary Session . . . . . . . . . . . . . . . . . . . . Sun. 6:00 to 7:25 pm6:00pm: Introduction and Opening Remarks
6:05pm: The Exciting Science of Light with Metamaterials, VladimirM.Shalaev,PurdueUniv.(USA)
6:45pm:Future of Optics and Photonics, BahaaE.A.Saleh,CREOL,TheCollegeofOpitcsandPhotonicsattheUniv.ofCentralFlorida(USA)
Monday 13 AugustSESSION 5 . . . . . . . . . . . . . . . . . . . . . . . . . .Mon. 8:30 to 9:50 am
Applications III: PhotographySession Chair: Ellis I. Betensky, Consultant(Canada)
The trend of an interchangeable zoom lens and the action of NIKKOR for these ten years (Invited Paper),TakayukiSensui,NikonCorp.(Japan)[8488-15]
Recent advances in digital camera optics (Invited Paper),KeizoIshiguro,PanasonicCorp.(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8488-16]
Solutions on a high-speed wide-angle zoom lens with aspheric surfaces,TakanoriYamanashi,PanavisionInternationalLLC(UnitedStates). . . [8488-17]
120 spie.org/opadvance · TEL:+13606763290 · help@spie.org
SESSION 6 . . . . . . . . . . . . . . . . . . . . Mon. 10:20 am to 12:10 pm
Product Design and EvaluationSession Chairs: Robert M. Bates, FiveFocalLLC(UnitedStates);Akira
Yabe, Consultant(Germany)
ForaPDFofthe2012zoomlensdesignproblemstatement:http://spie.org/documents/events/Conf8488_ZoomLens-IV_DesignProblem.pdf
High-speed anamorphic zoom lens: design and applications (Invited Paper),SergeyB.Biryuchinskiy,St.PetersburgStateUniv.ofFilmandTelevision(RussianFederation)andVIGITEK(UnitedStates)andStPetersburgStateUnivofInformationTechnologies,MechanicsandOptics(RussianFederation);KonstantinV.Melnikov,Laser&InformationTechnologiesCo.,Ltd.(Belarus). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8488-18]
Techniques for correcting color and Petzval in complex zoom lenses,JulieBentley,Univ.ofRochester(UnitedStates) . . . . . . . . . . . . . . . . . . . . . [8488-19]
High-performance zoom lenses with a forward-located stop (Invited Paper),IainA.Neil,ScotOptix(Switzerland). . . . . . . . . . . . . . . . . . . . . . . . . . . [8488-20]
The 2012 zoom lens design problem,RobertM.Bates,FiveFocalLLC(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8488-21]
TO ENTER: The 2012 Zoom Lens Design Problem . . . . . . . . . . . . . . . . . . . . Mon. 11:40 amThezoomlensdesignproblemforthe2012ZoomLensIVconferenceisafirstofitskind.Thechallengeistodesignalensoperatingatasinglewavelengthof587.6nmwitha20:1zoomratiousingonlyfourelements;akintothe1990IODCMonochromaticQuartetdesignproblem.Thelensdesignoffersseveraldegreesoffreedomincludingarangeofglassandasphericelementsinordertoachievethecontinuouszoomthrougheffectivefocallengthsfrom4mmto80mm,withabackfocallength>16mm.Throughoutthezoommotion,thefirstelementandtheaperturestoparekeptinfixedpositionsrelativetotheimageplaneandlensoperatesataconstantf/10.Thegoaloftheproblemistominimizethelengthofthesystemasmeasuredfromthevertexofthefrontelementtotheimageplane.ThedesignisrequiredtomeetanRMSWFE<0.07wavestoafieldheightof1.25mm,whilesupportingafullfieldheightof2.5mmwithlessthan5%magnitudedistortion.Thereareadditionalmechanicalconstraints.
Allentriesmustbesubmittedby15 May 2012.
ForaPDFofthe2012zoomlensdesignproblemstatement:
http://spie.org/documents/events/Conf8488_ZoomLens-IV_DesignProblem.pdf
Ifyouhaveanyquestionsabouttheproblem,contactzoomlensproblem@fivefocal.comorrefertotheFAQsectionofthelensdesignproblemwebsite:
http://www.fivefocal.com/2012/04/2012-zoom-lens-conference-iv-design-problem/.
Conference 8488
spie.org/opadvance · TEL:+13606763290 · help@spie.org 121
Conference 8489Wednesday-Thursday 15-16 August 2012 • Proceedings of SPIE Vol. 8489
Polymer Optics and Molded Glass Optics: Design, Fabrication, and Materials IIIConference Chairs:David H. Krevor, TactusTechnology,Inc.(UnitedStates);William S. Beich, G-SPlasticOptics(UnitedStates);Michael P. Schaub, RaytheonMissileSystems(UnitedStates);Stefan M. Bäumer, PhilipsLightingB.V.(Netherlands)
Program Committee:Alan Symmons, LightPathTechnologies,Inc.(UnitedStates)
Wednesday 15 AugustWelcome and Opening Remarks . . . . . . . .Wed. 8:30 to 8:40 am
David H. Krevor,TactusTechnology,Inc.(UnitedStates)
SESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . .Wed. 8:40 to 10:00 am
Advances in Molding and Fabrication ProcessesSession Chair: David H. Krevor, TactusTechnology,Inc.(UnitedStates)
Implications of diamond-turned vs. diamond-ground mold fabrication techniques on precision-molded optics (Invited Paper),LouMertus,AlanSymmons,LightPathTechnologies,Inc.(UnitedStates) . . . . . . . . . . . [8489-01]
Rainbow-colored photonic bandgap structure fabricated by holographic lithography,KeLiu,HuinaXu,HaifengHu,QiaoqiangGan,AlexanderN.Cartwright,Univ.atBuffalo(UnitedStates) . . . . . . . . . . . . . . . . . . . . . [8489-02]
A review of thermoforming for the production of polymer optics,MarkSchuetz,KaraShell,ReplexPlastics(UnitedStates). . . . . . . . . . . . . . [8489-03]
Fast multiphoton microfabrication of freeform polymer microstructures by spatiotemporal focusing and patterned generation (Invited Paper),Yi-ChengLi,Shean-JenChen,NationalChengKungUniv.(Taiwan). . . . . . . . . . [8489-04]
SESSION 2 . . . . . . . . . . . . . . . . . . . . Wed. 10:30 am to 12:00 pm
Polymer Process Modeling and Novel Optical ProductsSession Chair: Michael P. Schaub, RaytheonMissileSystems(United
States)
Applying simulation to optimize plastic molded optical parts (Invited Paper),MatthewJaworski,Autodesk,Inc.(UnitedStates);AlexanderBakharev,FrancoCosta,Autodesk,Inc.(Australia). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8489-05]
Comparison of molded plastics Fresnel lenses with molded plastics nonimaging “cones” for LED collimation,NelsonE.Claytor,RichardN.Claytor,OscarM.Lechuga,FresnelTechnologies,Inc.(UnitedStates)[8489-06]
Low-cost Fresnel microlens array fabricated by a home-built maskless lithography system,GiuseppeA.Cirino,UniversidadeFederaldeSãoCarlos(Brazil);SergioA.Lopera,RonaldoD.Mansano,SaoPauloUniv.(Brazil);ArlindoN.Montagnoli,UFSCAR(Brazil);LuizG.Neto,Univ.deSãoPaulo(Brazil). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8489-07]
Design and fabrication of secondary optical lenses for LED arrays applied in interior illumination,Cheng-HsienWu,Jia-HongJhuang,NationalKaohsiungUniv.ofAppliedSciences(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . [8489-08]
Lunch/Exhibition Break.............................. 12:00to1:40pm
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 1:40 to 3:00 pm
Novel Polymer Optical ProductsSession Chair: Stefan M. Bäumer, PhilipsLightingB.V.(Netherlands)
The design of SWIR imaging lenses using plastic optics,R.HamiltonShepardIII,MITLincolnLab.(UnitedStates);MichaelSchaub,RaytheonMissileSystems(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8489-09]
Reactive mesogen retarders,BillyTran,TomBaur,MeadowlarkOptics,Inc.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8489-10]
Polymeric laser protective windows,BenG.Phipps,Wamco,Inc.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8489-11]
The fabrication of deformable mirror by patterned ionic-polymer-metal composite,WeiCheng,Guo-DungSu,NationalTaiwanUniv.(Taiwan)[8489-12]
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 3:30 to 4:30 pm
Advances in Polymer Optical MaterialsSession Chair: William S. Beich, G-SPlasticOptics(UnitedStates)
New melt-processable thermoplastic polyimides for optoelectronic applications (Invited Paper),AdityaNarayanan,GurulingamurthyHaralur,SABICInnovativePlastics(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8489-13]
Optical and mechanical properties of a tuneable polyimide membrane lens,ChristianKelb,DominikHoheisel,LeibnizUniv.Hannover(Germany)andLeibnizUniversitätHannover(Germany);LutzRissing,LeibnizUniv.Hannover(Germany);EduardReithmeier,LeibnizUniv.Hannover(Germany)andHannoverschesZentrumfürOptischeTechnologien(Germany)andLeibnizUniversitätHannover(Germany). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8489-14]
Hydrophobic and oleophobic coating technologies for polymer optics,DanFiore,BrianWilson,NorthAmericanCoatingLabs.(UnitedStates). . . [8489-15]
Panel Discussion . . . . . . . . . . . . . . . . . Wed. 4:30 to 5:30 pm
Polymers vs. Glass, and Other Questions Concerning Polymer Optics and Molded Glass Optics
Moderator:
David H. Krevor, TactusTechnology,Inc.(UnitedStates)
Panelists:
William S. Beich,G-SPlasticOptics(UnitedStates)
Michael P. Schaub,RaytheonMissileSystems(UnitedStates)
Stefan M. Bäumer, PhilipsLightingB.V.(Netherlands)
Alan Symmons,LightPathTechnologies,Inc.(UnitedStates)
Thispaneldiscussionwillofferallparticipantstheopportunitytoaskquestionsonanyaspectofpolymeropticsandmoldedglassoptics.Aprimarydiscussionsubjectwillbethediscriminatorsbetweenpolymersandinorganicglass.Wewilldiscussboththedesignandmanufacturinglimitationsandfreedomswhenchoosingbetweenpolymericandinorganicglassmaterials.Therewillalsobetheopportunitytodiscussyourdesignorproductionquestionwiththeexpertsinthefield.FeaturedpanelistsincludeMichaelSchaub,authorof“TheDesignofPlasticOpticalSystems”andeditorof“MoldedOptics:DesignandManufacture,”andStefanBäumer,editorof“HandbookofPlasticOptics.”
122 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Thursday 16 AugustWelcome and Opening Remarks . . . . . . Thurs. 8:35 to 8:40 am
David H. Krevor, TactusTechnology,Inc.(UnitedStates)
SESSION 5 . . . . . . . . . . . . . . . . . . . . . . . Thurs. 8:40 to 10:10 am
Advances in Glass Molding and Optical ProductsSession Chair: Michael P. Schaub, RaytheonMissileSystems(United
States)
Design considerations and manufacturing limitations of Insert Precision Glass Molding (IPGM) (Invited Paper),AlanSymmons,BryanAuz,LightPathTechnologies,Inc.(UnitedStates)............................. [8489-16]
Precision molding of advanced glass optics: new possibilities for lens arrays and free form optics,BerndBresseler,ThomasBergs,GuidoPongs,AixtoolingGmbH(Germany). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8489-17]
Glass reflectors for LED downlight applications,UlfGeyer,MarcC.Hübner,AnsgarHellwig,ThomasHessling,AuerLightingGmbH(Germany) . . [8489-18]
Energy efficient line generators utilizing free-form glass mold lenses,MasafumiSeigo,NaluxCo.,Ltd.(Japan). . . . . . . . . . . . . . . . . . . . . . . [8489-19]
SESSION 6 . . . . . . . . . . . . . . . . . . . . . . Thurs. 10:40 to 11:40 am
Advances in Glass and Polymer OpticsSession Chair: Alan Symmons, LightPathTechnologies,Inc.(United
States)
Numerical and experimental study on the viscoelastic behaviour of the optical glass in the wafer based precision glass moulding,AliSarhadi,JesperH.Hattel,CemC.Tutum,HansN.Hansen,TechnicalUniv.ofDenmark(Denmark) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8489-20]
Applicability of glass for transmission LED optics,AnsgarHellwig,MarcC.Hübner,ThomasHessling,UlfGeyer,AuerLightingGmbH(Germany) [8489-21]
Plastic vs. glass: contrasting material requirements for reflective and refractive CPV solar systems,DavidH.Krevor,TactusTechnology,Inc.(UnitedStates);SteveHorne,SolFocus,Inc.(UnitedStates). . . . . . . . . . . . . . [8489-22]
Conference 8489
spie.org/opadvance · TEL:+13606763290 · help@spie.org 123
Conference 8490Monday 13 August 2012 • Proceedings of SPIE Vol. 8490
Laser Beam Shaping XIIIConference Chairs:Andrew Forbes, CSIRNationalLaserCtr.(SouthAfrica)andUniv.ofKwaZulu-Natal(SouthAfrica);Todd E. Lizotte, HitachiViaMechanics(USA),Inc.(UnitedStates)
Program Committee:Daniel M. Brown, OptosensorsTechnology,Inc.(UnitedStates);Fred M. Dickey, FMDConsultingLLC(UnitedStates);Michael Duparré, Friedrich-Schiller-Univ.Jena(Germany);Julio César Gutiérrez-Vega, InstitutoTecnológicoydeEstudiosSuperioresdeMonterrey(Mexico);Kurt J. Kanzler, JENOPTIKOpticalSystems,Inc.(UnitedStates);Alexis V. Kudryashov, ActiveOpticsNightNLtd.(RussianFederation);Carlos López-Mariscal, U.S.NavalResearchLab.(UnitedStates);John Rauseo, NaluxCo.,Ltd.(UnitedStates);José Sasián, CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates);David L. Shealy, TheUniv.ofAlabamaatBirmingham(UnitedStates);Kenneth J. Weible, SUSSMicroOpticsSA(Switzerland)
Monday 13 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . .Mon. 8:30 to 10:20 am
Methods and DesignSession Chair: Fred M. Dickey, FMDConsultingLLC(UnitedStates)
Diffractive and micro-optics for laser beam shaping (Invited Paper),MohammadR.Taghizadeh,AndrewJ.Waddie,Heriot-WattUniv.(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8490-01]
Review of design and applications of two-lens plano-aspheric refractive laser beam shapers,DavidL.Shealy,TheUniv.ofAlabamaatBirmingham(UnitedStates);JohnA.Hoffnagle,Picarro,Inc.(UnitedStates) . . . . . [8490-02]
Optical and mechanical tolerances for two-lens plano-aspheric refractive laser beam shapers,JohnA.Hoffnagle,Picarro,Inc.(UnitedStates);DavidL.Shealy,TheUniv.ofAlabamaatBirmingham(UnitedStates) . . . . . . . [8490-03]
Graded-index design in coherent beam shaping,DiLin,JamesR.Leger,Univ.ofMinnesota,TwinCities(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . [8490-04]
The generation of flat-top beams by complex amplitude modulation with a phase-only spatial light modulator,AndrewForbes,StefRoux,CSIRNationalLaserCtr.(SouthAfrica);AdriaanHendriks,CouncilforScientificandIndustrialResearch(SouthAfrica);CarlosLopez-Mariscal,U.S.NavalResearchLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8490-05]
SESSION 2 . . . . . . . . . . . . . . . . . . . . Mon. 10:50 am to 12:30 pm
Non-diffracting and Vortex BeamsSession Chair: John A. Hoffnagle, Picarro,Inc.(UnitedStates)
Coherent superposition of propagation-invariant laser beams,RoseSoskind,Rutgers,TheStateUniv.ofNewJersey(UnitedStates);MichaelSoskind,WestWindsor-PlainsboroHighSchoolSouth(UnitedStates);YakovSoskind,DHPCTechnologies(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8490-06]
Shaping quasi-nondiffracting beams using a circular Radon transform,ManuelG.Jurado-Taracena,JulioC.Gutiérrez-Vega,TecnológicodeMonterrey(Mexico). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8490-07]
Intra-cavity generation of a superposition of Bessel-Gauss beams,J.DavidWong-Campos,RaulI.Hernandez-Aranda,TecnológicodeMonterrey(Mexico)[8490-08]
Putting light in a spin,AndrewForbes,CSIRNationalLaserCtr.(SouthAfrica)andUniv.ofKwaZulu-Natal(SouthAfrica). . . . . . . . . . . . . . . . . . . . . . [8490-09]
Parametric assessment of computer-generated holograms,CarlosLopez-Mariscal,U.S.NavalResearchLab.(UnitedStates). . . . . . . . . . . . . . . [8490-10]
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:30to1:30pm
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 1:30 to 3:10 pm
ApplicationsSession Chair: Mohammed R. Taghizadeh, Heriot-WattUniv.(United
Kingdom)
Thermo-Optical (TOP) analysis of transmissive elements for laser systems,AlexanderGatej,AnnikaRichmann,RWTHAachenUniv.(Germany);PeterLoosen,RWTHAachenUniv.(Germany)andFraunhofer-InstituteforLaserTechnology(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8490-11]
A virtual pivot MEMS rotary comb actuator for tunable laser application,T.M.FahimAmin,Univ.ofAlberta(Canada)andDept.ofChemistry,UniversityofAlberta(Canada);QuamrulHuda,Univ.ofAlberta(Canada)andDept.ofElectricalandComputerEngineering,Univ.ofAlberta(Canada);YuebinNing,GrahamMcKinnon,NorcadaInc.(Canada);JohnTulip,BorealLaserInc.(Canada);WolfgangJäger,Univ.ofAlberta(Canada). . . . . . . . . . . . . . [8490-12]
Beam shaper failure modes when used in an ultrafast (femtosecond) micromachining laser application,ToddLizotte,HitachiViaMechanics(USA),Inc.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8490-13]
High power CO 2 laser beam control by means of adaptive optics,AlexisV.Kudryashov,ActiveOpticsNightNLtd.(RussianFederation). . . . . . . [8490-14]
Multiple optical traps using radial walsh filters,NasrinReza,LakshminarayanHazra,Univ.ofCalcutta(India). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8490-15]
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 3:40 to 5:20 pm
DevicesSession Chair: Carlos Lopez-Mariscal, U.S.NavalResearchLab.
(UnitedStates)
Minimizing interference in microlens array homogenizer for a coherent UV laser,StenA.Lindau,MicronicMydataAB(Sweden) . . . . . . . . . . . . . [8490-16]
Examination and optimizing of a liquid crystal display used as spatial light modulator concerning the fringing field effect,ChristianLingel,TobiasHaist,WolfgangOsten,Univ.Stuttgart(Germany). . . . . . . . . . . . . . . . . . . . . [8490-17]
Variable xy-UV beam expander for 355-nm high-power laser beam shaping,GeorgNadorff,CVIMellesGriot(UnitedStates);StenLindau,MicronicMydataAB(Sweden);FrankDeWittIV,CVIMellesGriot(UnitedStates) . . . . . [8490-18]
Imaging techniques with refractive beam-shaping optics,AlexanderV.Laskin,VadimLaskin,AdlOpticaOpticalSystemsGmbH(Germany) . [8490-19]
Multi-wavelength fabrications of vertical-cavity surface-emitting lasers,BaoLuGuan,BeijingUniv.ofTechnology(China). . . . . . . . . . . . . . . . . . . . [8490-20]
Posters-Monday . . . . . . . . . . . . . . . . . . . . Mon. 5:30 to 7:30 pmConference attendees are invited to attend the poster session on Monday
evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
Active beam shaping in multiple laser guide stars,KatharineJ.Jones,WBAOConsultantGroup(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8490-21]
Development of the micro-scanning optical system of yellow DPSS laser applied to the ophthalmologic area,AlessandroMotta,GlaucoCostal,TiagoAlmeida,YuriFontes,GiulianoRossi,FatimaYasuoka,MarioStefani,JarbasCastro,OptoEletrônicaS.A.(Brazil);MariaPaiva,EscoladeEngenhariadeSaoCarlos(Brazil) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8490-22]
Enhancing of thermal effects in ultra-fattening Yb-doped fiber lasers,DanielToral,ArturoCastillo-Guzman,ValentinGuzman-Ramos,DanielE.Ceballos-Herrera,RomeoSelvas-Aguilar,Univ.AutónomadeNuevoLeón(Mexico). . . . .[8490-23]
Thermal sensor using a sharp end-tapered Er-doped amplifier,DanielToral,ArturoCastillo-Guzman,ValentinGuzman-Ramos,DanielE.Ceballos-Herrera,RomeoSelvas-Aguilar,Univ.AutónomadeNuevoLeón(Mexico). . . . [8490-24]
Visualization of optical fields with ellipsoidal geometry,AntonioOrtiz-Ambriz,JulioCesarGutierrez-Vega,TecnológicodeMonterrey(Mexico). . . . . [8490-25]
Monolithic optical components for splitting of high-power beams,ManfredJarczynski,ThomasMitra,MikhailIvaneko,LutzAschke,LIMOLissotschenkoMikrooptik(Germany);ChristophWächter,FraunhoferInstitutfuerAngewandteOptikundFeinmechanikJena(Germany);UlrikeFuchs,TorstenLinke,SvenR.Kiontke,asphericonGmbH(Germany). . . . . . . . . . . . . . . . . . . . . . . . . [8490-26]
124 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Conference 8491Sunday-Monday 12-13 August 2012 • Proceedings of SPIE Vol. 8491
Optical System Alignment, Tolerancing, and Verification VIConference Chairs:José Sasián, CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates);Richard N. Youngworth, RiyoLLC(UnitedStates)
Program Committee:Scott C. Burkhart, LawrenceLivermoreNationalLab.(UnitedStates);Matthew B. Dubin, CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates);Sen Han, SoochowUniv.(China);Jürgen Jahns, FernUniv.inHagen(Germany);Chao-Wen Liang, NationalCentralUniv.(Taiwan);Robert M. Malone, NationalSecurityTechnologies,LLC(UnitedStates);Maria D. Nowak, NASAGoddardSpaceFlightCtr.(UnitedStates);Raymond G. Ohl IV, NASAGoddardSpaceFlightCtr.(UnitedStates);Craig Olson, L-3CommunicationsSonomaEO(UnitedStates);Robert E. Parks, OpticalPerspectivesGroup,LLC(UnitedStates);Mitchell C. Ruda, Ruda-Cardinal,Inc.(UnitedStates);Daniel G. Smith, NikonResearchCorp.ofAmerica(UnitedStates);Yana Z. Williams, Ametek/AtlasMaterialTestingSolution(UnitedStates)
Sunday 12 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 8:50 to 10:30 am
Desensitization and TolerancingSession Chair: Robert M. Malone, NationalSecurityTechnologies,LLC
(UnitedStates)
Wavefront coding to reduce the alignment sensitivity of two-mirror telescopes,BrianCatanzaro,CFEServices(UnitedStates). . . . . . . . [8491-01]
Ultra-precision fabrication of high density micro-optical backbone interconnection for data center and mobile application,UlrichLohmann,JuergenJahns,FernUniv.inHagen(Germany);ChristophWerner,ThomasWagner,EUROMICRONWerkzeugeGmbH(Germany). . . . . . . . . . . . [8491-02]
Tolerancing considerations for visual system (Invited Paper),JimSchwiegerling,TheUniv.ofArizona(UnitedStates). . . . . . . . . . . . . . . [8491-03]
Practical method of cost-based tolerancing (Invited Paper),AkiraYabe,Consultant(Germany). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8491-04]
SESSION 2 . . . . . . . . . . . . . . . . . . . . . Sun. 11:00 am to 12:20 pm
Alignment and Baffle Tolerances in Space SystemsSession Chair: Ulrich Lohmann, FernUniv.inHagen(Germany)
Optical alignment for space spectrometers explained,OanavanderTogt,FolkertDraaisma,TNO(Netherlands). . . . . . . . . . . . . . . . . . . . . . . . . . [8491-05]
Precise alignment of x-ray mirror components utilizing pneumatic actuators,StephenE.Kendrick,PaulAtcheson,RobertWarden,JeroldCole,BethKelsic,DianeFear,BallAerospace&TechnologiesCorp.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8491-06]
Alignment solutions for the Optical Development System Lab for the ATLAS instrument,TylerC.Evans,SGT,Inc.(UnitedStates). . . . . . . . . . . . . [8491-07]
Stray light and baffle assembly sensitivity analysis of the Formosat-5 telescope,Ting-MingHuang,Cheng-FangHo,Po-HanHuang,Yu-ChuanLin,Stenq-TsongChang,InstrumentTechnologyResearchCtr.(Taiwan). [8491-08]
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:20to1:50pm
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 1:50 to 3:10 pm
Verification and OptomechanicsSession Chair: Yana Z. Williams, AtlasMaterialTestingTechnologyLLC
(UnitedStates)
Optical design and performance testing of an athermal SWIR gas correlation imager,AnthonyA.Tanbakuchi,MarkW.Smith,SandiaNationalLabs(UnitedStates);JeffA.Mercier,SandiaNationalLabs.(UnitedStates);AaronM.Ison,SandiaNationalLabs(UnitedStates);ToddJ.Embree,SandiaNationalLabs.(UnitedStates);StevenR.Vigil,SandiaNationalLabs(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8491-09]
Rapid spatial characterization measurements of a multi-element focal plane using derived geometrical information,JamesW.Baer,BallAerospace&TechnologiesCorp.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . [8491-10]
A support structure for a compliant deformable mirror,F.ErnestoPenado,JamesH.ClarkIII,JoelDugdale,NorthernArizonaUniv.(UnitedStates)[8491-11]
Opposed Port Alignment System (OPAS): A commercial astronomical telescope modified for viewing the interior of the NIF target chamber,AnastaciaM.Manuel,TomMcCarville,LynnSeppala,JeffKlingmann,DanKalantar,LawrenceLivermoreNationalLab.(UnitedStates). . . . . . . . [8491-12]
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 3:40 to 5:30 pm
Optical System AlignmentSession Chair: Sen Han, SoochowUniv.(China)
Use of a flat panel display for measurement of sine condition violations,SaraLampen,MatthewDubin,JamesH.Burge,CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . [8491-13]
Binocular collimation vs conditional alignment (Invited Paper),WilliamJ.Cook,U.S.Army(UnitedStates)andCaptain’sNauticalSupplies(UnitedStates)andATMPublishing(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . [8491-14]
Practical alignment using an autostigmatic microscope,RobertE.Parks,OpticalPerspectivesGroup,LLC(UnitedStates). . . . . . . . . . . . . . . . . [8491-15]
Optomechanical design and alignment strategies demonstrated on a zoom system,MarioSondermann,HannesScheibe,BenjaminJohn,ThomasNobis,CarlZeissAG(Germany). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8491-16]
Computer-aided alignment method using rms WFE value as an optimization criterion,YunjongKim,Univ.ofScience&Technology(Korea,Republicof)andKoreaResearchInstituteofStandardsandScience(Korea,Republicof);Ho-SoonYang,KoreaResearchInstituteofStandardsandScience(Korea,Republicof)andUniversityofScienceandTechnology(Korea,Republicof);Yun-WooLee,KoreaResearchInstitueofStandardsandScience(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8491-17]
Symposium-Wide Plenary Session . . . . . . . . . . . . . . . . . . . . Sun. 6:00 to 7:25 pm6:00pm: Introduction and Opening Remarks
6:05pm: The Exciting Science of Light with Metamaterials, VladimirM.Shalaev,PurdueUniv.(USA)
6:45pm:Future of Optics and Photonics, BahaaE.A.Saleh,CREOL,TheCollegeofOpitcsandPhotonicsattheUniv.ofCentralFlorida(USA)
Monday 13 AugustPosters-Monday . . . . . . . . . . . . . . . . . . . . Mon. 5:30 to 7:30 pm
Conference attendees are invited to attend the poster session on Monday evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
Optical design, performance, and tolerancing of an Offner imaging spectrograph,HanaKu,SeohyunKim,KAIST(Korea,Republicof). . [8491-18]
Effect of the lens wedge on the optical performance of a refractive telescope,Po-HanHuang,Shenq-TsongChang,Ming-YingHsu,Ting-MingHuang,InstrumentTechnologyResearchCtr.(Taiwan). . . . . . . . . . . . [8491-19]
The alignment and iso-static mount bonding technique of the aerospace Cassegrain telescope primary mirror,WeiChengLin,Shenq-TsongChang,Yu-ChuanLin,Po-HsuanHuang,Ming-YingHsu,Chia-YenChan,Ting-MingHuang,InstrumentTechnologyResearchCtr.(Taiwan). . . . . . . . . . . . [8491-20]
spie.org/opadvance · TEL:+13606763290 · help@spie.org 125
The research on measurement and alignment of large optical component and off-axis parabolic mirror applied in large aperture telescopes,WeiChengLin,Shenq-TsongChang,Ming-YingHsu,Yen-RuHuang,Ho-LinTsay,Ting-MingHuang,InstrumentTechnologyResearchCtr.(Taiwan) . . . [8491-21]
Study on the method to test large-aperture hyperboloid convex mirror,XiaohuiMeng,BeijingInstituteofSpaceMechanicsandElectricity(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8491-22]
In vacuum performance evaluation of the MUX camera for the CBERS 3&4 Satellites,LucimaraC.N.Scaduto,AlexandreT.Malavolta,LuizF.Vales,RodrigoG.Modugno,EricaG.Carvalho,SergioEvangelista,FatimaM.Yasuoka,MarioA.Stefani,JarbasC.Castro,OptoEletrônicaS.A.(Brazil). . . . . [8491-23]
Optomechanical and thermal integrated analysis of a new cryogenic refractometer,LeiNi,QifengRen,ShengLiao,InstituteofOpticsandElectronics(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8491-24]
Verification of Fresnel lens in high concentration photovoltaic system,An-ChiWei,PowerLensTechnology,Inc.(Taiwan)andFoxsemiconIntegratedTechnologyInc.(Taiwan);Jyh-RouSze,InstrumentTechnologyResearchCtr.(Taiwan);Jyh-LongChern,PowerLensTechnology,Inc.(Taiwan) . . . [8491-25]
Conference 8491
Books of Related InterestVisittheonsiteBookstoreororderonlinetoday:spie.org/publications
Image Acquisition and Preprocessing for Machine Vision SystemsbyP. K. SinhaVol.PM197
Signal and Image Restoration: Information-Theoretic ApproachesbyJoseph Noonan and Prabahan BasuVol.PM213
Field Guide to Probability, Random Processes, and Random Data AnalysisbyLarry C. Andrews and Ronald L. PhillipsVol.FG22
Hyperspectral Remote SensingbyMichael T. EismannVol.PM210
Field Guide to Optomechanical Design and AnalysisbyKatie Schwertz and Jim BurgeVol.FG26
126 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Conference 8492Monday 13 August 2012 • Proceedings of SPIE Vol. 8492
Optical System Contamination: Effects, Measurements, and Control 2012Conference Chairs:Sharon A. Straka, NASAGoddardSpaceFlightCtr.(UnitedStates);Nancy Carosso, NASAGoddardSpaceFlightCtr.(UnitedStates);Joanne Egges, BallAerospace&TechnologiesCorp.(UnitedStates)
Program Committee:Mark T. Boies, ResearchSupportInstruments,Inc.(UnitedStates);H. Dewitt Burns, Jr., NASAMarshallSpaceFlightCtr.(UnitedStates);Mark S. Crowder, BallAerospace&TechnologiesCorp.(UnitedStates);Jonathan P. Elders, RaytheonSpace&AirborneSystems(UnitedStates);Carlos E. Soares, TheBoeingCo.(UnitedStates);David P. Taylor, TheAerospaceCorp.(UnitedStates);O. Manuel Uy, TheJohnsHopkinsUniv.AppliedPhysicsLab.(UnitedStates)
Monday 13 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . .Mon. 8:30 to 10:10 am
Contamination, Optical, and Thermal Coatings Development, Testing, and Measurements
Session Chair: Joanne Egges, BallAerospace&TechnologiesCorp.(UnitedStates)
Chromate conversion coating: Iridite 14-2 thermal/optical characterization,MarcelloRodriguez,NASAGoddardSpaceFlightCtr.(UnitedStates) [8492-01]
Development and testing of molecular adsorber coatings,NithinAbraham,MarkHasegawa,SharonA.Straka,NASAGoddardSpaceFlightCtr.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8492-02]
Contamination resistant coatings for enhanced laser damage thresholds,BruceH.Weiller,JesseD.Fowler,RandyM.Villahermosa,TheAerospaceCorp.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8492-03]
Desert Research and Technology Studies exposure of Lotus-coated electrodynamic shield samples: part II,DanielleV.Margiotta,NASAGoddardSpaceFlightCtr.(UnitedStates);KristinR.McKittrick,SGT,Inc.(UnitedStates)andNASAGoddardSpaceFlightCtr.(UnitedStates);SharonA.Straka,NASAGoddardSpaceFlightCtr.(UnitedStates);CraigB.Jones,SGT,Inc.(UnitedStates)andNASAGoddardSpaceFlightCtr.(UnitedStates). . . . . . . [8492-04]
Pre-launch testing and evaluation of typical mirror coatings for space optical instruments,JamesB.Heaney,LonnyR.Kauder,ScottC.Freese,SGT,Inc.(UnitedStates);ManuelA.Quijada,NASAGoddardSpaceFlightCtr.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8492-05]
SESSION 2 . . . . . . . . . . . . . . . . . . . . Mon. 10:30 am to 12:10 pm
Contamination Effects, Measurement, and Mitigation ISession Chair: Nancy Carosso, NASAGoddardSpaceFlightCtr.
(UnitedStates)
Measurement of the accumulation of water ice on optical components in cryogenic vacuum environments,TrevorM.Moeller,L.MontgomerySmith,FrankG.Collins,JesseM.Labello,JamesP.Rogers,TheUniv.ofTennesseeSpaceInstitute(UnitedStates);HeardS.Lowry,DustinCrider,AerospaceTestingAlliance(UnitedStates)............................... [8492-06]
Measurement of cryogenic ice sublimation using quartz crystal microbalances,RadfordL.PerryIII,GeorgeMeadows,LaurenMosier,MichaelS.Woronowicz,SGT,Inc.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . [8492-07]
Application of ASTM E-1559 apparatus to study H 2O desorption,MichaelS.Woronowicz,RadfordL.PerryIII,GeorgeMeadows,SGT,Inc.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8492-08]
Outgas testing of Arlon® Thermabond conductive electronic adhesive,KeithR.Olson,TheAerospaceCorp.(UnitedStates). . . . . . . . . . . . . . . . . . [8492-12]
Evaluation of bakeout effectiveness by optical measurement of a contaminated surface,HiroshiYokozawa,SusumuBaba,EijiMiyazaki,YugoKimoto,JapanAerospaceExplorationAgency(Japan) . . . . . . . . . . . . [8492-09]
Lunch/Exhibition Break.............................. 12:10to1:40pm
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 1:40 to 3:20 pm
Contamination Effects, Measurement, and Mitigation IISession Chair: David P. Taylor, TheAerospaceCorp.(UnitedStates)
Photofixing studies of outgassed components of volatile contaminant materials,NataleJ.Ianno,FenZhou,JinyaPu,Univ.ofNebraska-Lincoln(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8492-10]
VUV modification of surfaces To induce film formation,DianneJ.Coleman,TheAerospaceCorp.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . [8492-11]
On small disturbance ascent vent behavior,MichaelS.Woronowicz,SGT,Inc.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8492-13]
Assessment of particle deposition inside payload fairing from launch vehicle launch plume contribution,De-LingLiu,SteveV.Didziulis,TheAerospaceCorp.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8492-14]
Molecular contamination modeling: diffusion and desorption kinetics for complex thermal profiles,G.Devaud,BallAerospace&TechnologiesCorp.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8492-21]
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 3:40 to 5:20 pm
Contamination Control, Monitoring, and VerificationSession Chair: Michael S. Woronowicz, SGT,Inc.(UnitedStates)
Next generation nano-contamination monitoring,StevenKochevar,ParticleMeasuringSystems,Inc.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . [8492-15]
Comparison of particle sampling results from tape lifts and rinsing,JoanneEgges,BallAerospace&TechnologiesCorp.(UnitedStates). . . . . . . [8492-16]
Micromachined reference standards for particle counting,DavidP.Taylor,TheAerospaceCorp.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . [8492-17]
Investigation of various clean room gloves for cleanliness,LynetteD.Lobmeyer,MichaelPirkey,BallAerospace&TechnologiesCorp.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8492-18]
Operations of cleanrooms during a forest fire including protocols and monitoring results,JoanneEgges,BruceA.Matheson,MichaelPirkey,BallAerospace&TechnologiesCorp.(UnitedStates). . . . . . . . . . . . . . . . . [8492-19]
Posters-Monday . . . . . . . . . . . . . . . . . . . . Mon. 5:30 to 7:30 pmConference attendees are invited to attend the poster session on Monday
evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
Optical throughput model,StevenA.Smallwood,LukeElasky,ITTExelisInc.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8492-20]
spie.org/opadvance · TEL:+13606763290 · help@spie.org 127
Conference 8493Monday-Wednesday 13-15 August 2012 • Proceedings of SPIE Vol. 8493
Interferometry XVI: Techniques and AnalysisConference Chairs:Joanna Schmit, BrukerNanoSurfacesDivision(UnitedStates);Katherine Creath, Optineering(UnitedStates)andCollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates);Catherine E. Towers, Univ.ofLeeds(UnitedKingdom)
Conference Co-Chair:Jan Burke, BremerInstitutfürAngewandteStrahltechnik(Germany)
Program Committee:Astrid Aksnes, NorwegianUniv.ofScienceandTechnology(Norway);Armando Albertazzi Gonçalves, Jr., Univ.FederaldeSantaCatarina(Brazil);Brent C. Bergner, SpectrumScientific,Inc.(UnitedStates);Arnaud Dubois, Institutd’OptiqueGraduateSchool(France);Cosme Furlong, WorcesterPolytechnicInstitute(UnitedStates);Ulf Griesmann, NationalInstituteofStandardsandTechnology(UnitedStates);Werner P. O. Jüptner, BremerInstitutfürangewandteStrahltechnikGmbH(Germany);Guillermo H. Kaufmann, Univ.NacionaldeRosario(Argentina);Seung-Woo Kim, KAIST(Korea,Republicof);Angarai R. Ganesan, IndianInstituteofTechnologyMadras(India);Malgorzata Kujawinska, WarsawUniv.ofTechnology(Poland);Michael B. North Morris, 4DTechnologyCorp.(UnitedStates);Wolfgang Osten, Univ.Stuttgart(Germany);Yukitoshi Otani, UtsunomiyaUniv.(Japan);Jannick P. Rolland, Univ.ofRochester(UnitedStates);Manuel Servin, Ctr.deInvestigacionesenÓptica,A.C.(Mexico);H. Philip Stahl, NASAMarshallSpaceFlightCtr.(UnitedStates);Mitsuo Takeda, TheUniv.ofElectro-Communications(Japan);Benito Vazquez Dorrío, Univ.deVigo(Spain);Wei Wang, Heriot-WattUniv.(UnitedKingdom);Song Zhang, IowaStateUniv.(UnitedStates)
Monday 13 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . .Mon. 8:30 to 10:20 am
On the FringeSession Chair: Katherine Creath, CollegeofOpticalSciences,The
Univ.ofArizona(UnitedStates)andOptineering(UnitedStates)
Measurement and modeling of the thermal behavior of a laboratory DASH interferometer (Invited Paper),KennethD.Marr,ChristophR.Englert,U.S.NavalResearchLab.(UnitedStates);JohnM.Harlander,St.CloudStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8493-01]
Digital holography reconstruction algorithms to estimate the morphology and depth of non-spherical absorbing particles,DanielR.Guildenbecher,PhillipL.Reu,SandiaNationalLabs.(UnitedStates). . . . . . . . . . . . . . [8493-02]
Spectrally resolved complex transmittance measurements of infrared nanostructured devices,JulienJaeck,AdrienFallou,GrégoryVincent,ONERA(France);Jean-LucPelouard,Ctr.NationaldelaRechercheScientifique(France);JérômePrimot,RiadHaïdar,ONERA(France). . . . . . . . . . . . . . . . . . . [8493-03]
A digital gradient sensing method for evaluating orthogonal stress gradients in transparent solids subjected to mechanical loads,HareeshV.Tippur,ChandruPeriasamy,AuburnUniv.(UnitedStates). . . . . . . . . . [8493-04]
An interferometric observation of topological effect by novel axially symmetrical wave plate,ToshitakaWakayama,ToruYoshizawa,SaitamaMedicalUniv.(Japan);YukitoshiOtani,UtsunomiyaUniv.(Japan) . . . [8493-05]
SESSION 2 . . . . . . . . . . . . . . . . . . . . Mon. 10:50 am to 12:10 pm
Optical Coherence TomographySession Chair: Jannick P. Rolland, Univ.ofRochester(UnitedStates)
Nondestructive metrology of layered polymeric optical materials using optical coherence tomography,JianingYao,PanomsakMeemon,Kye-SungLee,StephenHead,JannickP.Rolland,Univ.ofRochester(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8493-06]
Characterization of ink-jet printed organic RGB color filters with spectral domain optical coherence tomography,JakubCzajkowski,PauliinaVilmi,RafalSliz,JanneLauri,TapioFabritius,RistoMyllylä,Univ.ofOulu(Finland). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8493-07]
Wavelength-scanning polarimetric interferometry using channeled spectroscopic polarization state generator,KazuhikoOka,TakahiroKinoshita,HokkaidoUniv.(Japan) . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8493-08]
Composite low-coherence interferometer for imaging of immersed tissue with high accuracy,I-JenHsu,Chun-WeiChang,ChungYuanChristianUniv.(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8493-09]
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:10to1:40pm
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 1:40 to 3:10 pm
Spatial Structures and AberrationsSession Chair: Brent C. Bergner, SpectrumScientific,Inc.(United
States)
Sub-Angstrom surface metrology with a virtual reference interferometer (Invited Paper),KlausR.Freischlad,Zemetrics,Inc.(UnitedStates) . . [8493-10]
Comparison of the area structure function to alternate approaches for optical surface characterization,LiangyuHe,AngelaDavies,ChristopherJ.Evans,TheUniv.ofNorthCarolinaatCharlotte(UnitedStates). . . . . . [8493-11]
Diffraction effects for interferometric measurements due to imaging aberrations,PingZhou,ChunyuZhao,JimBurge,CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . [8493-12]
Fitting high-order Zernike polynomials to finite data,BenjaminJ.Lewis,JamesH.Burge,CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8493-13]
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 3:40 to 5:30 pm
Calibration TechniquesSession Chair: Michael B. North Morris, 4DTechnologyCorp.
(UnitedStates)
Calibrating the sag due to gravity of horizontal interferometer reference flats (Invited Paper),JanBurke,CSIROMaterialsScienceandEngineering(Australia);UlfGriesmann,NationalInstituteofStandardsandTechnology(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8493-14]
Absolute interferometric tests of spherical surfaces based on rotational and translational shears,JohannesA.Soons,UlfGriesmann,NationalInstituteofStandardsandTechnology(UnitedStates) . . . . . . . . . . . . . . . . . . . . . [8493-15]
Self calibration for slope-dependent errors in profilometry by using the random ball test,YueZhou,TheUniv.ofNorthCarolinaatCharlotte(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8493-16]
Diffractive reference mirrors for calibrating interferometer transmission spheres,QuandouWang,LingfengChen,UlfGriesmann,JohannesA.Soons,NationalInstituteofStandardsandTechnology(UnitedStates) . . . . . [8493-17]
Measurement uncertainty analysis of a homodyne Michelson interferometer,MarkusBrandner,MeinhardAuer,TechnischeUniv.Graz(Austria). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8493-18]
128 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Posters-Monday . . . . . . . . . . . . . . . . . . . . Mon. 5:30 to 7:30 pmConference attendees are invited to attend the poster session on Monday
evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
A real-time adaptive phase-shifting interferometry,WeiruiZhao,GenruiCao,BeijingInstituteofTechnology(China). . . . . . . . . . . . . . . . . . . . . . . . . [8493-41]
Single shot phase shifting interferometry using a two-step self-tuning phase shifting method,DavidIgnacioSerranoGarcía,Noel-IvanToto-Arellano,AmaliaMartínez-García,JuanAntonioRayas-Álvarez,Ctr.deInvestigacionesenÓptica,A.C.(Mexico) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8493-42]
Towards a general theory for NxN pixelated carrier frequency interferometry,JoseMoisesPadilla,ManuelServin,JulioEstrada-Rico,AdonaiGonzalez,Ctr.deInvestigacionesenÓptica,A.C.(Mexico). . . . . . . . . [8493-43]
Study of the refractometric stability of an interferometer equipment for gauge block calibration,JavierDiz-Bugarin,BenitoVazquezDorrío,JesusBlanco-Garcia,Univ.deVigo(Spain);FranciscoYebra,IsmaelOutomuro,Lab.OficialdeMetroloxiadeGalicia(Spain);MartaMiranda,Univ.deVigo(Spain);MartaOtero,FranciscoRodríguez,JoseLuisValencia,Lab.OficialdeMetroloxiadeGalicia(Spain).......................................... [8493-44]
Interferometric measurement of thermal expansion in post-cured photopolymers,GustavoF.Arenas,Univ.NacionaldeMardelPlata(Argentina)andCONICET(Argentina);RicardoDuchowicz,Ctr.deInvestigacionesenÓptica,A.C.(Argentina)andUniversidadNacionaldeLaPlata(Argentina). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8493-45]
Refractive index sensor using long period fiber gratings and Mach Zehnder interferometer all optical fiber,MonicaC.Hernandez,Univ.deGuanajuato(Mexico);JuanC.Hernández,Univ.deGuanajuto(Mexico);JulíanM.Estudillo,RobertoRojas,RuthI.Mata,EdgarMéndez,HéctorJ.Estrada,Univ.deGuanajuato(Mexico). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8493-46]
Evaluation of interferometric patterns of supersonic fluid flows by the differential Fourier transform method,FranciscoRodriguez-Lorenzo,AIMENTechnologyCtr(Spain);BenitoVazquezDorrío,JesusBlanco-García,Univ.deVigo(Spain). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8493-47]
Polynomial fitting model for phase reconstruction: interferograms with high fringe density,DanielMalacara-Doblado,Ctr.deInvestigacionesenÓptica,A.C.(Mexico). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8493-48]
Spatial and temporal study of a semisolid membrane by high speed optical interferometry,DavidA.Gutiérrez-Hernández,CarlosPerez-Lopez,Ctr.deInvestigacionesenÓptica,A.C.(Mexico);JuanC.Martínez-Espinosa,JuanA.Aranda-Ruiz,InstitutoPolitécnicoNacional(Mexico). . . . . . . . . . . . . . [8493-49]
Selection of phase-recovery algorithms for fringe processing in optical measurement of micro-surface,YongjianZhu,ZhejiangUniv.ofScienceandTechnology(China);JingxinNa,JilinUniv.(China);WeiqingPan,ZhejiangUniv.ofScienceandTechnology(China);AnhuLi,TongjiUniv.(China);YananZhi,ShanghaiInstituteofOptics&FineMechanics(China);YongLi,ZhejiangUniv.ofScienceandTechnology(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8493-50]
Digital holographic interferometry applied to mixed-mode fracture analysis,PauloAciolyM.dosSantos,LuizCarlosdaSilvaNunes,GabrielaN.deOliveira,Univ.FederalFluminense(Brazil) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8493-51]
Software configurable optical test system for non-null testing of refractive optics,MargaretZ.Dominguez,PengSu,RobertE.Parks,JamesH.Burge,CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates). . . . [8493-52]
Precision improving of double beam shadow moiré interferometer by phase shifting interferometry for the stress of flexile substrate,Kuo-TingHuang,Hsi-ChaoChen,Ssu-FanLin,Ke-MingLin,Hong-YeSyue,NationalYunlinUniv.ofScienceandTechnology(Taiwan) . . . . . . . . . . . . . . . . . . . . . . . . . . [8493-53]
Dynamic interferometric moiré patterns as optical numerical code generator,PauloAciolyM.dosSantos,GabrielaN.deOliveira,MarcosE.deOliveira,Univ.FederalFluminense(Brazil) . . . . . . . . . . . . . . . . . . . . . . [8493-54]
Fiber-optic low coherence sensor to blood hematocrit measurement based on Fabry-Perot interferometer,MichalKruczkowski,GdanskUniv.ofTechnology(Poland). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8493-55]
Tuesday 14 AugustSESSION 5 . . . . . . . . . . . . . . . . . . . . . . . . Tues. 8:30 to 10:10 am
Fringe AnalysisSession Chair: Adam R. Styk, WarsawUniv.ofTechnology(Poland)
How to remove fundamental-frequency phase errors from phase-shifting results,JanBurke,BremerInstitutfürangewandteStrahltechnikGmbH(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8493-19]
Error estimation of phase detection algorithms and comparison of window functions,RyoheiHanayama,TheGraduateSchoolfortheCreationofNewPhotonicsIndustries(Japan);KenichiHibino,NationalInstituteofAdvancedIndustrialScienceandTechnology(Japan) . . . . . . . . . . . . . . . . . . . . . [8493-20]
Regularized self-tuning phase demodulation for phase-shifting interferometry with arbitrary phase shifts,OrlandoM.Medina,JulioEstrada,ManuelServin,Ctr.deInvestigacionesenÓptica,A.C.(Mexico). . . . . [8493-21]
Analysis of eliminating noise based on S-Transform in fringe pattern,MinZhong,WenjingChen,SichuanUniv.(China). . . . . . . . . . . . . . . . . . . . [8493-22]
Sinusoidal wavelength-scanning interferometer for profile measurement of metal surfaces,OsamiSasaki,NiigataUniv.(Japan) . . . . . . . . . . . . . [8493-23]
SESSION 6 . . . . . . . . . . . . . . . . . . . . Tues. 10:40 am to 12:10 pm
Unwrapping TechniquesSession Chair: Benito Vazquez Dorrío, Univ.deVigo(Spain)
Spatio-temporal phase unwrapping of dynamic biological objects (Invited Paper),GoldieL.Goldstein,4DTechnologyCorp.(UnitedStates)andUniversityofArizona(UnitedStates);KatherineCreath,CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates)andUniversityofArizona(UnitedStates)andOptineering(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8493-24]
Generalized theory of phase unwrapping approaches and optimal wavelength selection strategies for multi-wavelength interferometric techniques,KonstantinosFalaggis,WarsawUniv.ofTechnology(Poland);DavidP.Towers,CatherineE.Towers,Univ.ofLeeds(UnitedKingdom). . . [8493-25]
Recursive linear systems for phase unwrapping,JulioC.Estrada-Rico,ManuelServin,Ctr.deInvestigacionesenÓptica,A.C.(Mexico). . . . . [8493-26]
Phase unwrapping fitting local planes to phase gradient,EfrénGonzaléz-Ramiréz,EnriquedelaRosaMiranda,Univ.AutónomadeZacatecas(Mexico);LuisR.Berriel-Valdos,InstitutoNacionaldeAstrofísica,ÓpticayElectrónica(Mexico);TonatiuhSaucedoAnaya,JoséI.delaRosa-Vargas,MaríaA.Araiza-Esquivel,Univ.AutónomadeZacatecas(Mexico) . . . . . . . . . . . . . . . . [8493-27]
Lunch/Exhibition Break.............................. 12:10to2:00pm
SESSION 7 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 2:00 to 3:30 pm
Specular and Translucent Object MeasurementSession Chair: Jan Burke, BremerInstitutfürangewandteStrahltechnik
GmbH(Germany)
Deflectometry challenges interferometry: the competition gets tougher! (Invited Paper),ChristianFaber,E.Olesch,R.Krobot,GerdHäusler,Friedrich-Alexander-Univ.Erlangen-Nürnberg(Germany). . . . . . . . . . . . . . . . . . [8493-28]
Optimization of dynamic structured illumination for surface slope measurements,GuillaumeP.Butel,TheUniv.ofArizona(UnitedStates);GregA.Smith,JamesH.Burge,CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8493-29]
Recovering shapes of specular objects in motion via normal vector map consistency,AlexeyPak,Fraunhofer-InstitutfürOptronik,SystemtechnikundBildauswertung(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8493-30]
Fast error simulation of optical 3D measurements at translucent objects,PeterLutzke,PeterKühmstedt,GuntherNotni,Fraunhofer-InstitutfürAngewandteOptikundFeinmechanik(Germany). . . . . . . . . . . . . . . . . [8493-31]
Conference 8493
spie.org/opadvance · TEL:+13606763290 · help@spie.org 129
Optical Engineering Plenary Session . Tues. 4:00 to 5:35 pm
Session Chairs: Jose Sasian, CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates); R. John Koshel, PhotonEngineeringLLC(UnitedStates)andCollegeofOpticalSciences,TheUniv.ofArizona
(UnitedStates)
4:00pm: Welcome and Opening Remarks
4:05pm: A New Job for Telescopes: Making Solar Electricity, J.RogerP.Angel,StewardObservatoryMirrorLab.,TheUniv.ofArizonaCollegeofOpticalSciences(UnitedStates)andREhnuLLC(UnitedStates)
4:50pm:From Titanic to the Tiny: Three Decades of Underwater Optical Imaging, JulesS.Jaffe,ScrippsInstitutionofOceanography(USA)
Wednesday 15 AugustSESSION 8 . . . . . . . . . . . . . . . . . . . . . . . . .Wed. 8:30 to 10:20 am
Digital HolographySession Chair: Ulf Griesmann, NationalInstituteofStandardsand
Technology(UnitedStates)
Determination of vibration amplitude from phase-shifted digital holograms (Invited Paper),AdamR.Styk,WarsawUniv.ofTechnology(Poland). [8493-32]
Single-shot multi-wavelength shape measurements with restricted aperture,SilkeHuferath-vonLuepke,EdwinN.Kamau,ChristophvonKopylow,ThomasKreis,BremerInstitutfürangewandteStrahltechnikGmbH(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8493-33]
Instantaneously captured images using multi-wavelength digital holography,JosephW.Haus,BenDapore,ParthaBanerjee,GeorgesNehmetallah,PaulMcManamon,NicholasMiller,PeterPowers,Univ.ofDayton(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8493-34]
Accurate and quantitative phase retrieval methods for a series of defocused images with application to in-line Gabor microscopy,KonstantinosFalaggis,TomaszKozacki,MichałJózwik,MalgorzataKujawinska,WarsawUniv.ofTechnology(Poland). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8493-35]
Water drops lenses applied to digital holographic microscopy,AlejandroRestrepo-Martínez,FranciscoE.López,InstitutoTecnológicoMetropolitano(Colombia). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8493-36]
SESSION 9 . . . . . . . . . . . . . . . . . . . . Wed. 10:50 am to 12:10 pm
Strain and Shape MeasurementSession Chair: Joanna Schmit, BrukerCorp.(UnitedStates)
Image quality improvement of an achromatic DSPI interferometer,ArmandoAlbertazziGonçalves,Jr.,MatiasR.Viotti,Univ.FederaldeSantaCatarina(Brazil). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8493-37]
Three-dimensional data processing with advanced computer graphics tools,SongZhang,IowaStateUniv.(UnitedStates). . . . . . . . . . . . . . [8493-38]
Analysis of solving the point correspondence problem by trifocal tensor for real-time phase measurement profilometry,KaiZhong,ZhongweiLi,HuazhongUniv.ofScienceandTechnology(China) . . . . . . . . . . . . . . [8493-39]
Improve Fourier transform profilometry by locally area modulating squared binary structured pattern,SongZhang,WilliamLohry,IowaStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8493-40]
Conference 8493
130 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Conference 8494Monday-Thursday 13-16 August 2012 • Proceedings of SPIE Vol. 8494
Interferometry XVI: ApplicationsConference Chairs:Cosme Furlong, WorcesterPolytechnicInstitute(UnitedStates);Christophe Gorecki, FEMTO-ST(France);Erik L. Novak, BrukerAXS,Inc.(UnitedStates)
Program Committee:Armando Albertazzi Gonçalves, Jr., UFSC(Brazil);Anand Krishna Asundi, NanyangTechnologicalUniv.(Singapore);Ralf B. Bergmann, BremerInstitutfürangewandteStrahltechnikGmbH(Germany);Angela Davies, TheUniv.ofNorthCarolinaatCharlotte(UnitedStates);Peter J. de Groot, ZygoCorporation(UnitedStates);Nazif Demoli, InstitutZaFiziku(Croatia);Pietro Ferraro, IstitutoNazionalediOttica(Italy);Jorge Mauricio Flores Moreno, Ctr.deInvestigacionesenÓptica,A.C.(Mexico);Motoharu Fujigaki, WakayamaUniv.(Japan);Kay Gastinger, NorwegianUniv.ofScienceandTechnology(Norway);Zhenbang Gong, ShanghaiUniv.(China);Steen Grüner Hanson, TechnicalUniv.ofDenmark(Denmark);James B. Hadaway, TheUniv.ofAlabamainHuntsville(UnitedStates);Pierre M. Jacquot, EcolePolytechniqueFédéraledeLausanne(Switzerland);Jae Wan Kim, KoreaResearchInstituteofStandardsandScience(Korea,Republicof);Malgorzata Kujawinska, WarsawUniv.ofTechnology(Poland);Fernando Mendoza Santoyo, Ctr.deInvestigacionesenÓptica,A.C.(Mexico);Gunther Notni, Fraunhofer-InstitutfürAngewandteOptikundFeinmechanik(Germany);Wolfgang Osten, Univ.Stuttgart(Germany);Xiang Peng, ShenzhenUniv.(China);Ryszard J. Pryputniewicz, WorcesterPolytechnicInstitute(UnitedStates);Phillip L. Reu, SandiaNationalLabs.(UnitedStates);Pierre R. L. Slangen, EcoledesMinesd’Alès(France);Vivi Tornari, FoundationforResearchandTechnology-Hellas(Greece);Catherine E. Towers, Univ.ofLeeds(UnitedKingdom);James D. Trolinger, MetroLaser,Inc.(UnitedStates);Rainer Tutsch, TechnischeUniv.Braunschweig(Germany)
Monday 13 AugustPosters-Monday . . . . . . . . . . . . . . . . . . . . Mon. 5:30 to 7:30 pm
Conference attendees are invited to attend the poster session on Monday evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
Interferometer inspection of local defect type Young-Chalmers,BenitoCanales-Pacheco,AlejandroCornejo-Rodríguez,FermínGranados-Agustín,EstebanRueda-Soriano,PedroCebrian-Xochihuila,InstitutoNacionaldeAstrofísica,ÓpticayElectrónica(Mexico). . . . . . . . . . . . . . . . . . . . . . . [8494-19]
Quantitative phase microscopy for the study of bone cells on multiple roughness surfaces,JesúsE.González-Laprea,AnaH.Márquez,RafaelEscalona,KaremNoris,Univ.SimonBolivar(Venezuela). . . . . . . . . . . [8494-27]
The spectrum of a bent fiber Fabry-Perot interferometer under small variations of the refractive index of the environment,StanislavO.Gurbatov,YuryN.Kulchin,OlegB.Vitrik,InstituteforAutomationandControlProcesses(RussianFederation). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8494-28]
Adaptive fiber-optic accelerometer with population gratings in Er/Yb-doped fibers and Sagnac configuration,JorgeH.Lopez,MarcosPlataSánchez,SergueiI.Stepanov,Ctr.deInvestigaciónCientíficaydeEducaciónSuperiordeEnsenada(Mexico) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8494-29]
Interferometry of AlN-based microcantilevers to determine the material properties and failure mechanisms,ChristopheGorecki,FEMTO-ST(France);KatarzynaKrupa,WarsawUniv.ofTechnology(Poland). . . . . . . . . . . [8494-30]
Tuesday 14 AugustOptical Engineering Plenary Session . Tues. 4:00 to 5:35 pm
Session Chairs: Jose Sasian, CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates); R. John Koshel, PhotonEngineeringLLC(UnitedStates)andCollegeofOpticalSciences,TheUniv.ofArizona
(UnitedStates)
4:00pm: Welcome and Opening Remarks
4:05pm: A New Job for Telescopes: Making Solar Electricity, J.RogerP.Angel,StewardObservatoryMirrorLab.,TheUniv.ofArizonaCollegeofOpticalSciences(UnitedStates)andREhnuLLC(UnitedStates)
4:50pm:From Titanic to the Tiny: Three Decades of Underwater Optical Imaging, JulesS.Jaffe,ScrippsInstitutionofOceanography(USA)
Wednesday 15 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 1:30 to 3:10 pm
Micro- and Nano-scale MeasurementsSession Chairs: Cosme Furlong, WorcesterPolytechnicInstitute(United
States);Christophe Gorecki, FEMTO-ST(France);Erik L. Novak, BrukerAXS,Inc.(UnitedStates)
Characterization of MEMS structural dynamics with a multi-channel fiber-optic heterodyne vibrometer (Invited Paper),JamesM.Kilpatrick,AdvancedSystems&Technologies,Inc.(UnitedStates);AdelaApostol,MetroLaser,Inc.(UnitedStates);VladimirMarkov,AdvancedSystems&Technologies,Inc.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8494-01]
Micromachined array-type Mirau interferometer for MEMS metrology,ChristopheGorecki,FEMTO-ST(France). . . . . . . . . . . . . . . . . . . . . . . [8494-02]
Interferometric and tomographic investigations of polymer microtips fabricated at the externity of optical fibers,MałgorzataKujawińska,WarsawUniv.ofTechnology(Poland);VincentParat,LovaLite(France);MichałDudek,BartłomiejSiwicki,SławomirWójcik,WarsawUniv.ofTechnology(Poland);GregoryBaethge,BrahimDahmani,LovaLite(France). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8494-03]
Calibration of the DOE lens array based multipoint diffraction strain sensor,HuiZhu,AnandK.Asundi,NanyangTechnologicalUniv.(Singapore). [8494-04]
SESSION 2 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 3:40 to 5:00 pm
Characterization of Dynamic Events ISession Chairs: Armando Albertazzi Gonçalves, Jr., UFSC(Brazil);
Brent C. Frogget, NationalSecurityTechnologies,LLC(UnitedStates)
A 14-channel multipoint vibrometry system using dynamic holography,ChristianLingel,TobiasHaist,WolfgangOsten,Univ.Stuttgart(Germany);ChristianRembe,MarcusWinter,PolytecGmbH(Germany). . . . . . . . [8494-13]
Eliminating atmospheric optical noise through digital holography,JamesD.Trolinger,FrankWu,EddieScott,BenBuckner,JacobGeorge,MetroLaser,Inc.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8494-06]
Calibration method using sampling moire method for phase-shifting digital holography with multiple imaging devices,MotoharuFujigaki,RyosukeGoto,YorinobuMurata,WakayamaUniv.(Japan) . . . . . . . . . . . . . . . . . . . . . [8494-07]
Digital holographic otoscope for measurements of the human tympanic membrane in-vivo,IvoT.Dobrev,ElleryJ.Harrington,WorcesterPolytechnicInstitute(UnitedStates);TaoCheng,MassachusettsEyeandEarInfirmary(UnitedStates);CosmeFurlong,WorcesterPolytechnicInstitute(UnitedStates);JohnRosowski,MassachusettsGeneralHospital(UnitedStates). . . . [8494-08]
spie.org/opadvance · TEL:+13606763290 · help@spie.org 131
Thursday 16 AugustSESSION 3 . . . . . . . . . . . . . . . . . . . . . . . Thurs. 8:30 to 10:10 am
Characterization of Dynamic Events IISession Chairs: Richard E. Bills, ZygoCorporation(UnitedStates);Wansong Li, VereinigteElektronik-WerkstättenGmbH(Germany)
Investigation of thermomechanical effects of lighting conditions on canvas paintings by laser shearography,MortezaKhaleghiMeybodi,IvoDobrev,WorcesterPolytechnicInstitute(UnitedStates);PhilipKlausmeyer,WorcesterArtMuseum(UnitedStates);ElleryJ.Harrington,CosmeFurlong,WorcesterPolytechnicInstitute(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . [8494-09]
Improvements in the marking of defects on large structures surfaces during shearographic inspection,DanielP.Willemann,AnaluciaV.Fantin,ArmandoAlbertazzi,Univ.FederaldeSantaCatarina(Brazil) . . . . . . . . . . . . . . . [8494-10]
Dynamic displacement distribution measurement of deforming structure using sampling moire camera,TakuyaHara,MotoharuFujigaki,YorinobuMurata,WakayamaUniv.(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8494-11]
A fisheye lens as a photonic Doppler velocimetry probe,BrentC.Frogget,BrianM.Cata,BrianC.Cox,DouglasO.DeVore,DavidL.Esquibel,NationalSecurityTechnologies,LLC(UnitedStates);DanielK.Frayer,NationalSecurityTechnologiesLLC(UnitedStates);MorrisI.Kaufman,RobertM.Malone,VincentT.Romero,NationalSecurityTechnologies,LLC(UnitedStates);MichaelR.Furlanetto,DavidB.Holtkamp,LosAlamosNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8494-12]
A polarization-based frequency shifting interferometer and the signal processing acceleration method based on parallel processing architecture,SeungHyunLee,MinYoungKim,KyungpookNationalUniv.(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8494-14]
SESSION 4 . . . . . . . . . . . . . . . . . . . Thurs. 10:40 am to 12:00 pm
Novel Methods and ApplicationsSession Chairs: Malgorzata Kujawinska, WarsawUniv.ofTechnology
(Poland);Motoharu Fujigaki, WakayamaUniv.(Japan)
3D metrology system realized by a tailored free-form mirror (Invited Paper),SusanneZwick,StefanHeist,YannickFranzl,RalfSteinkopf,GuntherNotni,Fraunhofer-InstitutfürAngewandteOptikundFeinmechanik(Germany)[8494-15]
Absolute optical surface measurement with deflectometry,WansongLi,VereinigteElektronik-WerkstättenGmbH(Germany);ThorstenBothe,GOMmbH(Germany);MarcP.Sandner,JanBurke,BremerInstitutfürangewandteStrahltechnikGmbH(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8494-16]
A next-generation optical surface form inspection instrument for high-volume production applications,RichardBills,KlausFreischlad,ZygoCorporation(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8494-17]
Lunch/Exhibition Break........................... 12:00amto1:30pm
SESSION 5 . . . . . . . . . . . . . . . . . . . . . . . . Thurs. 1:30 to 2:50 pm
NDT and Materials CharacterizationSession Chairs: Susanne Zwick, Fraunhofer-InstitutfürAngewandte
OptikundFeinmechanik(Germany);Ivo T. Dobrev, WorcesterPolytechnicInstitute(UnitedStates)
Clamping load measurement using DSPI,DaveI.Sims,Mohamad-RezaSiadat,OaklandUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . [8494-18]
Point Diffraction Interferometer for measurement of the refraction index of a glass plate,EstebanRueda-Soriano,InstitutoNacionaldeAstrofísica,ÓpticayElectrónica(Mexico);FerminS.Granados-Agustín,InsitutoNacionaldeAstrofísica,ÓpticayElectrónica(Mexico);M.ElizabethPercino-Zacarías,PedroCebrian-Xochihuila,BenitoCanales-Pacheco,InstitutoNacionaldeAstrofísica,ÓpticayElectrónica(Mexico). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8494-20]
Measuring of temperatures of phase objects using a point-diffraction interferometer plate made with the thermocavitation process,JuanCarlosAguilarLópez,InstitutoNacionaldeAstrofísicaÓpticayElectrónica(Mexico);LuisR.BerrielValdos,JoseF.AguilarValdés,InstitutoNacionaldeAstrofísica,ÓpticayElectrónica(Mexico). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8494-21]
Aberration compensation and position scanning of a subaperture stitching algorithm,Po-ChihLin,Yan-AnChen,Hung-ShengChang,Chao-WenLiang,Yi-ChunChen,NationalCentralUniv.(Taiwan)................... [8494-22]
SESSION 6 . . . . . . . . . . . . . . . . . . . . . . . . Thurs. 3:20 to 4:40 pm
Fringe and Image ProcessingSession Chairs: Cosme Furlong, WorcesterPolytechnicInstitute(United
States);Christophe Gorecki, FEMTO-ST(France);Erik L. Novak, BrukerAXS,Inc.(UnitedStates)
Measurement of amorphic corundum layers by self-focusing optical coherence tomography system with matrix detector,SlawomirTomczewski,LeszekSalbut,WarsawUniv.ofTechnology(Poland). . . . . . . . . . . . . [8494-23]
Non-uniform projection angle processing in computed tomography,TristanJ.Tayag,YanicSimo,TexasChristianUniv.(UnitedStates). . . . . . . . [8494-24]
A modified phase unwrapping algorithm based on phase filtering,HailongChen,XiaoliLiu,XiangPeng,ShenzhenUniv.(China) . . . . . . . . . . . . . [8494-25]
Photorealistic modeling from optical digitization,XingmingLiu,ShenzhenUniv.(China)andTianjinUniv.(China);XiangPeng,ShenzhenUniv.(China);YongkaiYin,TianjinUniv.(China);AmengLi,XiaoliLiu,ShenzhenUniv.(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8494-26]
Conference 8494
132 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Conference 8495Monday-Thursday 13-16 August 2012 • Proceedings of SPIE Vol. 8495
Reflection, Scattering, and Diffraction from Surfaces IIIConference Chair:Leonard M. Hanssen, NationalInstituteofStandardsandTechnology(UnitedStates)
Program Committee:Gérard Berginc, ThalesOptroniqueS.A.(France);Andrea M. Brown, TheJohnsHopkinsUniv.AppliedPhysicsLab.(UnitedStates);Michael G. Dittman, BallAerospace&TechnologiesCorp.(UnitedStates);Aristide C. Dogariu, CREOL,TheCollegeofOpticsandPhotonics,Univ.ofCentralFlorida(UnitedStates);John C. Fleming, BallAerospace&TechnologiesCorp.(UnitedStates);Greg Gbur, TheUniv.ofNorthCarolinaatCharlotte(UnitedStates);Hsueh-Mei W. Graham, LockheedMartinAeronauticsCo.(UnitedStates);Brian G. Hoover, AdvancedOpticalTechnologies(UnitedStates);Danhong Huang, AirForceResearchLab.(UnitedStates);Alexei A. Maradudin, Univ.ofCalifornia,Irvine(UnitedStates);Richard N. Pfisterer, PhotonEngineeringLLC(UnitedStates);Arne Roos, UppsalaUniv.(Sweden);Hendrik Rothe, Helmut-SchmidtUniv.(Germany);Shouhong Tang, KLA-TencorCorp.(UnitedStates);Benjamin Tsai, NationalInstituteofStandardsandTechnology(UnitedStates)
Monday 13 AugustPosters-Monday . . . . . . . . . . . . . . . . . . . . Mon. 5:30 to 7:30 pm
Conference attendees are invited to attend the poster session on Monday evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
Roughness evaluation of very smooth surfaces using a novel method of scatter measurement,RomualdSynak,WlodzimierzLipinski,MarcinPawelczak,InstituteofMathematicalMachines(Poland). . . . . . . . . . . [8495-38]
Thin metal film thickness detection method based on surface plasmon resonance effect,QinggangLiu,ChaoLiu,TianjinUniv.(China) . . . . [8495-39]
Reflectance variability of surface coatings reveals characteristic power relations in the eigenvalue spectrum,JoseM.Medina,Univ.doMinho(Portugal);JoseA.Diaz,Univ.deGranada(Spain);RuiBarros,Univ.doMinho(Portugal). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8495-40]
Self focusing transmittances.,JavierMuñoz-Lopez,GabrielMarinez-Niconoff,PatriciaMartinez-Vara,JavierSilva-Barranco,InstitutoNacionaldeAstrofísica,ÓpticayElectrónica(Mexico). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8495-41]
Structural features of the diffraction field,GabrielMarinez-Niconoff,JavierMuñoz-Lopez,PatriciaMartinez-Vara,InstitutoNacionaldeAstrofísica,ÓpticayElectrónica(Mexico) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8495-42]
Calibration of a reflection deflectometry system: Software Configurable Optical Testing System (SCOTS) for measuring precision aspheric optics I,YuhaoWang,PengSu,TianquanSu,ShanshanWang,JamesH.Burge,CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates) . . . . . . . . . . [8495-43]
Homogeneity measurements of hardness standards with a non-destructive optical method,JoséG.Suárez-Romero,EduardoHernandez-Gomez,InstitutoTecnológicodeQuerétaro(Mexico);JuanB.Hurtado-Ramos,Ctr.deInvestigacionenCienciaAplicadayTecnologiaAvanzada(Mexico). . [8495-44]
A fast and accurate surface plasmon resonance system,YulianaM.EspinosaSánchez,DonatoLuna-Moreno,Ctr.deInvestigacionesenÓpticaA.C.(Mexico). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8495-45]
Vectorial analysis of the tunneling phenomena in the open elliptic quantum billiard,HipolitoGarcia-Gracia,JulioC.Gutierrez-Vega,TecnológicodeMonterrey(Mexico). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8495-46]
Tuesday 14 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . Tues. 8:30 to 10:00 am
Scattering Theory ISession Chair: John C. Fleming, BallAerospace&TechnologiesCorp.
(UnitedStates)
Domain of validity of the equation for total integrated scatter (TIS) (Invited Paper),JamesE.Harvey,NarakChoi,CREOL,TheCollegeofOpticsandPhotonics,Univ.ofCentralFlorida(UnitedStates);AndreyKrywonos,Univ.ofCentralflorida(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8495-01]
Upper roughness limitations on the TIS/RMS relationship,JohnC.Stover,TheScatterWorksInc.(UnitedStates);SvenSchroeder,AngelaDuparré,Fraunhofer-InstitutfürAngewandteOptikundFeinmechanik(Germany)[8495-02]
Comparison of the domain of validity of several approximate surface scatter theories,NarakChoi,JamesE.Harvey,CREOL,TheCollegeofOpticsandPhotonics,Univ.ofCentralFlorida(UnitedStates). . . . . . . . . . . . [8495-03]
Converting surface roughness data into PSD and BSDF,RichardN.Pfisterer,PhotonEngineeringLLC(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . [8495-04]
SESSION 2 . . . . . . . . . . . . . . . . . . . . . . . Tues. 10:30 to 11:50 am
Imaging Methods and Applications ISession Chair: Richard N. Pfisterer, PhotonEngineeringLLC(United
States)
Design of combined microscopical and scatterometrical imaging devices for surface inspection,WenjingZhao,Helmut-Schmidt-Univ.(Germany);CorneliusF.Hahlweg,HendrikRothe,Helmut-SchmidtUniv.(Germany)[8495-05]
Backscatter-based projectile trajectory measurement in ballistics under daylight conditions,UweChalupka,HendrikRothe,Helmut-Schmidt-Univ.(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8495-06]
Calibration for GMT software configurable optical testing system,ShanshanWang,BeijingInstituteofTechnology(China);ManalKhreishi,YuhaoWang,CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates);H.M.Martin,LargeBinocularTelescopeObservatory(UnitedStates);JamesH.Burge,PengSu,CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates). [8495-07]
Surface characterization using combined analysis of original and scatter images,WenjingZhao,Helmut-Schmidt-Univ.(Germany);CorneliusF.Hahlweg,HendrikRothe,Helmut-SchmidtUniv.(Germany) . . . . . . . . . . . . . . . . [8495-08]
Lunch/Exhibition Break........................... 11:50amto1:20pm
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 1:20 to 3:30 pm
Optical Properties: Theory and MeasurementSession Chair: Brian G. Hoover, AdvancedOpticalTechnologies
(UnitedStates)
Inter-laboratory comparison using integrating sphere spectrophotometers to measure reflectance and transmittance of specular, diffuse, and light-redirecting glazing products (Invited Paper),JacobC.Jonsson,CharlieCurcija,LawrenceBerkeleyNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . [8495-09]
Comparison of NRC goniometric and integrating sphere methods for realizing an absolute diffuse reflectance scale,RéjeanBaribeau,JoanneC.Zwinkels,NationalResearchCouncilCanada(Canada). . . . . . . . . . . . [8495-10]
Establishing infrared reflectance standards with micro-manufactured surfaces,SergeyN.Mekhontsev,LeonardM.Hanssen,NationalInstituteofStandardsandTechnology(UnitedStates);VladimirB.Khromchenko,SpaceDynamicsLab.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8495-11]
Effective medium analysis on the optical properties of silicon nanowire arrays,HanWang,GeorgiaInstituteofTechnology(UnitedStates)andHarbinInstituteofTechnology(China);XiangleiLiu,LipingWang,ZhuominM.Zhang,GeorgiaInstituteofTechnology(UnitedStates). . . . . . . . . . . . . . . . . . [8495-12]
Temperature-dependent emissivity model using DC-resistance and reflectance measurements,AndreaM.Brown,MichaelE.Thomas,JohnJ.Orndorff,JohnsHopkinsUniv.AppliedPhysicsLab.(UnitedStates) . [8495-13]
Coherent backscattering cone from superdiffusive media,JacopoBertolotti,Univ.Twente(Netherlands)andUniv.Florence(Italy);MatteoBurresi,EuropeanLab.forNon-linearSpectroscopy(Italy);VivekananthanRadhalakshmi,EuropeanLab.forNon-linearSpectroscopy(Italy)andUniv.Florence(Italy);RomoloSavo,EuropeanLab.forNon-linearSpectroscopy(Italy);KevinVynck,EuropeanLab.forNon-linearSpectroscopy(Italy)andUniv.Florence(Italy);DiederikS.Wiersma,EuropeanLab.forNon-linearSpectroscopy(Italy). . . . . . . . [8495-14]
spie.org/opadvance · TEL:+13606763290 · help@spie.org 133
Optical Engineering Plenary Session . Tues. 4:00 to 5:35 pm
Session Chairs: Jose Sasian, CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates); R. John Koshel, PhotonEngineeringLLC(UnitedStates)andCollegeofOpticalSciences,TheUniv.ofArizona
(UnitedStates)
4:00pm: Welcome and Opening Remarks
4:05pm: A New Job for Telescopes: Making Solar Electricity, J.RogerP.Angel,StewardObservatoryMirrorLab.,TheUniv.ofArizonaCollegeofOpticalSciences(UnitedStates)andREhnuLLC(UnitedStates)
4:50pm:From Titanic to the Tiny: Three Decades of Underwater Optical Imaging, JulesS.Jaffe,ScrippsInstitutionofOceanography(USA)
Wednesday 15 AugustSESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . .Wed. 8:40 to 10:30 am
Scattering Theory IISession Chair: Alexei A. Maradudin, Univ.ofCalifornia,Irvine(United
States)
Estimating hemispherical scatter from incident plane measurements of isotropic samples (Invited Paper),JohnC.Stover,TheScatterWorksInc.(UnitedStates);SvenSchroeder,AngelaDuparre,AlexandervonFinck,Fraunhofer-InstitutfürAngewandteOptikundFeinmechanik(Germany)[8495-15]
A BRDF model for scratches and digs,GaryL.Peterson,BreaultResearchOrganization,Inc.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8495-16]
Wavelength-dependent resonant surface-plasmon mediated light scattering by a slit array filled with different dielectrics,DanhongHuang,AirForceResearchLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8495-17]
How accurate is the Kubelka-Munk theory of diffuse reflection? a quantitative answer,MichaelE.Thomas,RichardI.Joseph,JohnsHopkinsUniv.AppliedPhysicsLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . [8495-18]
Coherence model for laser and solar scattering from diffuse metals,BrianG.Hoover,DavidE.Taliaferro,AdvancedOpticalTechnologies(UnitedStates);L.DavidWellems,DavidL.Bowers,AppliedTechnologyAssociates(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8495-19]
SESSION 5 . . . . . . . . . . . . . . . . . . . . Wed. 11:00 am to 12:20 pm
Measurement Instrumentation and Applications ISession Chair: Hsueh-Mei W. Graham, LockheedMartinAeronautics
Co.(UnitedStates)
BRDF measurements using a tunable supercontinuum fiber laser source designed for the STARR II gonioreflectometer,HeatherJ.Patrick,NationalInstituteofStandardsandTechnology(UnitedStates);ClarenceJ.Zarobila,JungResearchandDevelopmentCorp.(UnitedStates)andNationalInstituteofStandardsandTechnology(UnitedStates);ThomasA.Germer,CatherineA.Cooksey,BenjaminK.Tsai,NationalInstituteofStandardsandTechnology(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8495-20]
Quantification of the systematic and random measurement uncertainty of a polarimetric scatterometry system designed for enhanced e-field device characterization,ThomasM.Fitzgerald,Univ.ofDaytonResearchInstitute(UnitedStates);MichaelA.Marciniak,AirForceInstituteofTechnology(UnitedStates);StephenE.Nauyoks,AirForceInsituteofTechnology(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8495-21]
Scatterometer basing on a STAR GEM idea for optical measurements of micro-lenses,EtsuoKawate,NationalInstituteofAdvancedIndustrialScienceandTechnology(Japan);MiroslavHain,InstituteofMeasurementScience(Slovakia);FumikoHiwatashi,SystemsEngineeringInc.(Japan). . . . . [8495-22]
The Southwest Research Institute Ultraviolet Reflectance Chamber (SwURC): a far ultraviolet reflectometer,GregoryS.Winters,KurtD.Retherford,MichaelW.Davis,StephenM.Escobedo,EdwardL.Patrick,EricBassett,MaggieE.Nagengast,MattH.Fairbank,PaulF.Miles,JoelW.Parker,RandallGladstone,AlanStern,SouthwestResearchInstitute(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8495-23]
Lunch/Exhibition Break.............................. 12:20to2:00pm
SESSION 6 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 2:00 to 3:30 pm
Imaging Methods and Applications IISession Chair: Hendrik Rothe, Helmut-SchmidtUniv.(Germany)
The focusing of light scattered from diffuse reflectors using phase modulation (Invited Paper),JessicaM.Schafer,MichaelA.Marciniak,AirForceInstituteofTechnology(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . [8495-24]
High dynamic range and polarization imaging for on-machine fringe projection metrology,EricWhitenton,NationalInstituteofStandardsandTechnology(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8495-25]
Scattering computation for 3D laser imagery and reconstruction algorithms (Invited Paper),IonBerechet,SISPIA(France);GérardBerginc,ThalesOptroniqueS.A.(France);StefanBerechet,SISPIA(France). . . . . . . . [8495-26]
Matrix determination of hidden object reflectance by indirect photography,SimonS.Ferrel,MichaelA.Marciniak,AirForceInstituteofTechnology(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8495-27]
SESSION 7 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 4:00 to 5:00 pm
Measurement Instrumentation and Applications IISession Chair: Danhong Huang, AirForceResearchLab.(United
States)
Measuring grazing-angle DHR with the Infrared Grazing Angle Reflectometer,MichaelR.Benson,MichaelA.Marciniak,AirForceInstituteofTechnology(UnitedStates);JeffreyW.Burks,AirForceResearchLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8495-28]
Extension of the NIST infrared reference integrating sphere system to 28 μm,LeonardM.Hanssen,SergeyN.Mekhontsev,SimonG.Kaplan,NationalInstituteofStandardsandTechnology(UnitedStates) . . . . . . . . . . . . [8495-29]
Advanced gloss sensing for robotic applications,ChristianDeinhammer,MarkusBrandner,TechnischeUniv.Graz(Austria)................ [8495-30]
Thursday 16 AugustSESSION 8 . . . . . . . . . . . . . . . . . . . . . . . Thurs. 8:50 to 10:20 am
Measurement and Analysis TechniquesSession Chair: Andrea M. Brown, JohnsHopkinsUniv.AppliedPhysics
Lab.(UnitedStates)
Sophisticated light scattering techniques from the VUV to IR regions (Invited Paper),SvenSchröder,Fraunhofer-InstitutfürAngewandteOptikundFeinmechanik(Germany);MarcusTrost,TobiasHerffurth,Fraunhofer-InstitutfürAngewandteOptikundFeinmechanik(Germany)andFriedrich-Schiller-Univ.Jena(Germany);AlexandervonFinck,AngelaDuparré,Fraunhofer-InstitutfürAngewandteOptikundFeinmechanik(Germany). . . . . . . . . . . . . . . . . [8495-31]
Effects of a measurement floor on Mueller matrix measurements in a DRR BSDF system,StephenE.Nauyoks,MichaelA.Marciniak,AirForceInstituteofTechnology(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8495-32]
Using differential ray tracing in stray light analysis,DavidF.Rock,TheAerospaceCorp.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8495-33]
Optical non-contact micrometer thickness measurement system for silica thick films,KavintheranThambiratnam,Univ.Malaya(Malaysia);HarithB.Ahmad,Univ.ofMalaya(Malaysia);MohYasin,Univ.Airlangga(Indonesia);SulaimanW.Harun,Univ.ofMalaya(Malaysia). . . . . . . . . . . . . . . . . . [8495-34]
SESSION 9 . . . . . . . . . . . . . . . . . . . Thurs. 10:50 am to 12:00 pm
Measurement Instrumentation and Applications IIISession Chair: Benjamin K. Tsai, NationalInstituteofStandardsand
Technology(UnitedStates)
Extensive goniometric spectral measurements at desert sites for military engineering (Invited Paper),ThomasE.Berry,Jr.,JohnC.Morgan,JohnS.Furey,TereDeMoss,JulieR.Kelley,JasonR.McKenna,U.S.ArmyEngineerResearchandDevelopmentCtr.(UnitedStates) . . . . . . . . . . . . . . . . . [8495-35]
Optimized diffusers for reflective mirasol displays: experience from metrology characterization,EvgeniY.Poliakov,RusselA.Martin,IonBita,MatthewSampsell,QUALCOMMMEMSTechnologies,Inc.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8495-36]
Optical sensor for ice detection in harsh environments,MarkusBrandner,MichaelJ.Moser,TechnischeUniv.Graz(Austria). . . . . . . . . . . . . . . . [8495-37]
Conference 8495
134 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Conference 8496Sunday-Monday 12-13 August 2012 • Proceedings of SPIE Vol. 8496
Terahertz Emitters, Receivers, and Applications IIIConference Chairs:Manijeh Razeghi, NorthwesternUniv.(UnitedStates);Alexei N. Baranov, Univ.Montpellier2(France);Henry O. Everitt, U.S.ArmyAviationandMissileResearchDevelopmentandEngineeringCtr.(UnitedStates);John M. Zavada, NationalScienceFoundation(UnitedStates);Tariq Manzur, NavalUnderseaWarfareCtr.(UnitedStates)
Program Committee:Stefano Barbieri, Lab.MatériauxetPhénomènesQuantiques,CNRS,Univ.Paris7-DenisDiderot(France);Daniel Dolfi, ThalesResearch&Technology(France);Jérôme Faist, ETHZurich(Switzerland);Mauro Fernandes Pereira, Jr., SheffieldHallamUniv.(UnitedKingdom);Guido Giuliani, Univ.degliStudidiPavia(Italy);Qing Hu, MassachusettsInstituteofTechnology(UnitedStates);M. Quamrul Huda, Univ.ofAlberta(Canada);Gaël Mouret, Univ.duLittoralCôted’Opale(France);Gregory S. Nusinovich, Univ.ofMaryland,CollegePark(UnitedStates);Carlo Sirtori, Univ.Paris7-DenisDiderot(France);Zachary D. Taylor, Univ.ofCalifornia,LosAngeles(UnitedStates);Gintaras Valusis, Ctr.forPhysicalSciencesandTechnology(Lithuania);Miriam S. Vitiello, ConsiglioNazionaledelleRicerche(Italy)
Sunday 12 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 8:30 to 10:10 am
Quantum Cascade LasersSession Chairs: Manijeh Razeghi, NorthwesternUniv.(UnitedStates);Vyacheslav A. Trofimov, LomonosovMoscowStateUniv.(Russian
Federation)
Recent trends in THz optoelectronics: high-power extraction surface-emitting lasers and sub-diffraction-limit resonators (Invited Paper),RaffaeleColombelli,GangyiXu,AloyseDegiron,ElodieStrupiechonski,Institutd’ÉlectroniqueFondamentale(France). . . . . . . . . . . . . . . . . . . . . . . . . [8496-01]
Operation of terahertz quantum cascade lasers above 160K covering a frequency range of 1.8 THz to 4.3 THz (Invited Paper),SushilKumar,LehighUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8496-02]
Intersubband lasing without inversion in diluted nitride quantum wells,MauroFernandesPereira,Jr.,SheffieldHallamUniv.(UnitedKingdom)[8496-03]
FDTD analysis of THz plasmonic resonators,MustafaKarabiyik,NezihPala,ChowdhuryAl-Amin,FloridaInternationalUniv.(UnitedStates). . . . . . [8496-04]
SESSION 2 . . . . . . . . . . . . . . . . . . . . . Sun. 10:40 am to 12:00 pm
Fundamentals and Quantum Cascade LasersSession Chairs: Gintaras Valusis, Ctr.forPhysicalSciencesand
Technology(Lithuania);John M. Zavada, NationalScienceFoundation(UnitedStates)
Intersubband laser diodes from IR to THz: recent advances and future trends (Invited Paper),ManijehRazeghi,NorthwesternUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8496-05]
Terahertz quantum cascade laser sources based on difference-frequency generation: from passive nonlinearity to leaky THz waveguide device concepts (Invited Paper),AugustinasVizbaras,WalterSchottkyInstitut(Germany);KarunVijayraghavan,RobertW.Adams,TheUniv.ofTexasatAustin(UnitedStates);GerhardBoehm,WalterSchottkyInstitut(Germany);MikhailA.Belkin,TheUniv.ofTexasatAustin(UnitedStates);MarkusC.Amann,WalterSchottkyInstitut(Germany). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8496-06]
Terahertz quantum cascade laser sources based on Cerenkov difference-frequency generation,KarunVijayraghavan,RobertW.Adams,TheUniv.ofTexasatAustin(UnitedStates);AugustinasVizbaras,WalterSchottkyInstitut(Germany);MinJang,TheUniv.ofTexasatAustin(UnitedStates);ChristianGrasse,GerhardBoehm,MarkusC.Amann,WalterSchottkyInstitut(Germany);MikhailA.Belkin,TheUniv.ofTexasatAustin(UnitedStates) . . . . . . [8496-07]
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:00to1:30pm
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 1:30 to 3:30 pm
THz OscillatorsSession Chairs: Raffaele Colombelli, Institutd’Électronique
Fondamentale(France);Tariq Manzur, NavalUnderseaWarfareCtr.(UnitedStates)
Ultrahigh spectral purity optoelectronic THz oscillators: towards THz metrology (Invited Paper),MehdiAlouini,InstitutdePhysiquedeRennes(France). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8496-08]
Resonant-tunnelling diodes for THz applications (Invited Paper),MichaelFeiginov,CezarySydlo,OlegCojocari,PeterMeissner,TechnischeUniv.Darmstadt(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8496-09]
Terahertz narrow-band tune amplification effect in triple-barrier quantum well resonant-tunneling nanostructures,VladimirN.Murzin,SergeyY.Savinov,VladimirV.Kapaev,P.N.LebedevPhysicalInstitute(RussianFederation) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8496-10]
Narrow linewidth tunable THz signal radiated by 1.55μm photomixing,AntoineRolland,InstitutdePhysiquedeRennes(France)andInstitutd’Electronique,deMicroélectronique,etdeNanotechnologie(France);GuillaumeDucournau,Institutd’Electronique,deMicroélectronique,etdeNanotechnologie(France);Goulc’henLoas,InstitutdePhysiquedeRennes(France);EmilienPeytavit,AlexandreBeck,TahsinAkalin,MohamedZaknoune,Jean-FrançoisLampin,Institutd’Electronique,deMicroélectronique,etdeNanotechnologie(France);MarcBrunel,FrançoisBondu,MarcVallet,MehdiAlouini,InstitutdePhysiquedeRennes(France). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8496-11]
Design of quasi-optical, terahertz circulator with ultra-wideband operation,JohnYan,LarryBarnett,CalvinW.Domier,NevilleC.Luhmann,Jr.,Univ.ofCalifornia,Davis(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8496-12]
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 4:00 to 5:50 pm
New Sources of THz RadiationSession Chairs: Wojciech Knap, Univ.Montpellier2(France);Medhi
Alouini, InstitutdePhysiquedeRennes(France)
Nonlinear optical THz-wave sources and applications (Invited Paper),KodoKawase,RIKEN(Japan)andNagoyaUniv.(Japan);Shin’ichiroHayashi,RIKEN(Japan);KeiTakeya,NagoyaUniv.(Japan). . . . . . . . . . . . . . . . . . . . . . [8496-13]
Frequency tunable electronic sources working at room temperature in the 1 to 3 THz band (Invited Paper),AlainE.Maestrini,Univ.PierreetMarieCurie(France);ImranMehdi,JoséV.Siles,JetPropulsionLab.(UnitedStates);JohnS.Ward,RaytheonCo.(UnitedStates);RobertH.Lin,JetPropulsionLab.(UnitedStates);BertrandC.Thomas,RPGRadiometerPhysicsGmbH(Germany);ChoonsupLee,JohnJ.Gill,GoutamChattopadhyay,ErichSchlecht,JohnC.Pearson,PeterH.Siegel,JetPropulsionLab.(UnitedStates). . . . . . . [8496-14]
Photoconductive terahertz sources based on plasmonic gratings (Invited Paper),MonaJarrahi,ChristopherBerry,Univ.ofMichigan(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8496-15]
Optoelectronic phase-locked loop for millimeter-wave and THz beat note stabilization,AntoineRolland,Goulc’henLoas,MarcBrunel,LudovicFrein,MarcVallet,MehdiAlouini,InstitutdePhysiquedeRennes(France). . [8496-16]
Symposium-Wide Plenary Session . . . . . . . . . . . . . . . . . . . . Sun. 6:00 to 7:25 pm6:00pm: Introduction and Opening Remarks
6:05pm: The Exciting Science of Light with Metamaterials, VladimirM.Shalaev,PurdueUniv.(USA)
6:45pm:Future of Optics and Photonics, BahaaE.A.Saleh,CREOL,TheCollegeofOpitcsandPhotonicsattheUniv.ofCentralFlorida(USA)
spie.org/opadvance · TEL:+13606763290 · help@spie.org 135
Monday 13 AugustSESSION 5 . . . . . . . . . . . . . . . . . . . . . . . . .Mon. 8:00 to 10:00 am
THz DetectionSession Chairs: Stephen Anthony Lynch, CardiffUniv.(United
Kingdom);Alain E. Maestrini, Univ.PierreetMarieCurie(France)
Terahertz detection and emission by field-effect transistors (Invited Paper),WojciechKnap,Univ.Montpellier2(France) . . . . . . . . . . . . . . . . . . . . [8496-17]
Detectors for terahertz multi-pixel coherent imaging (Invited Paper),AlvydasLisauskas,ViktorKrozer,HartmutG.Roskos,JohannWolfgangGoethe-Univ.FrankfurtamMain(Germany);LinasMinkevicius,DaliusSeliuta,IrmantasKasalynas,VincasTamosiunas,GintarasValusis,Ctr.forPhysicalSciencesandTechnology(Lithuania) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8496-18]
High-sensitivity sub-millimeter-wave detector module implementing InP-based zero-biased Schottky-barrier diode,HiroshiIto,KitasatoUniv.(Japan);YoshifumiMuramoto,NTTPhotonicsLabs.(Japan);HiroshiYamamoto,KitasatoUniv.(Japan);TadaoIshibashi,NTTPhotonicsLabs.(Japan). . . . . . . [8496-19]
Investigation of the terahertz plasmon resonance in single-wall carbon nanotubes,DaliusSeliuta,Ctr.forPhysicalSciencesandTechnology(Lithuania)andVilniusGediminasTechnicalUniv.(Lithuania);MikhailShuba,AlesiaPaddubskaya,PolinaP.Kuzhir,GregoryY.Slepyan,SergeyA.Maksimenko,VitalyKsenevich,PavelBuka,BelarusStateUniv.(Belarus);IrmantasKa?alynas,JanMacutkevic,GintarasValu?is,Ctr.forPhysicalSciencesandTechnology(Lithuania);ChristianThomsen,TechnischeUniv.Berlin(Germany);AkhleshLakhtakia,ThePennsylvaniaStateUniv.(UnitedStates). . . . . . . . . . . [8496-20]
A terahertz-wave perfect polarization rotator based on a metamaterial,Yi-JuChiang,Ta-JenYen,NationalTsingHuaUniv.(Taiwan). . . . . . . . . [8496-21]
SESSION 6 . . . . . . . . . . . . . . . . . . . . . . . .Mon. 10:30 to 11:50 am
Novel ApproachesSession Chairs: Henry O. Everitt, U.S.ArmyAviationandMissile
Research,DevelopmentandEngineeringCtr.(UnitedStates);Arunas Krotkus, Ctr.forPhysicalSciencesandTechnology(Lithuania)
Semiconductor nanowire field-effect transistors: towards high-frequency THz detectors (Invited Paper),AlessandroPitanti,ScuolaNormaleSuperiorediPisa(Italy) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8496-22]
Quantum control in silicon using coherent THz pulses (Invited Paper),StephenA.Lynch,CardiffUniv.(UnitedKingdom);PhilipT.Greenland,Univ.CollegeLondon(UnitedKingdom);AlexanderF.G.vanderMeer,FOM-InstituteforPlasmyPhysicsRijnhuizen(Netherlands);BenedictN.Murdin,Univ.ofSurrey(UnitedKingdom);CarlR.Pidgeon,Heriot-WattUniv.(UnitedKingdom);BrittaRedlich,FOM-InstituteforPlasmyPhysicsRijnhuizen(Netherlands);NguyenQ.Vinh,Univ.ofCalifornia,SantaBarbara(UnitedStates);GabrielAeppli,Univ.CollegeLondon(UnitedKingdom) . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8496-23]
Broadband THz high-resolution interferometry using coherent synchrotron radiation,PascaleRoy,SynchrotronSOLEIL(France). . . . . . . . . . . . . [8496-24]
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11:50amto1:20pm
SESSION 7 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 1:20 to 3:00 pm
THz ImagingSession Chairs: Michael Feiginov, TechnischeUniv.Darmstadt
(Germany)
Real-time terahertz microscope with palm-size terahertz camera and compact quantum cascade laser (Invited Paper),NaokiOda,TsutomuIshi,NECCorp.(Japan);AlanM.Lee,LongWavePhotonicsLLC(UnitedStates);QingHu,MassachusettsInstituteofTechnology(UnitedStates);HitoshiTabata,TheUniv.ofTokyo(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8496-25]
Probing biological systems with terahertz spectroscopy (Invited Paper),EmmaPickwell-MacPherson,HongKongUniv.ofScienceandTechnology(HongKong,China);EdwardP.Parrott,TheChineseUniv.ofHongKong(HongKong,China);YiwenSun,ShenzhenUniv.(China). . . . . . . . . . . . . . . . [8496-26]
Fast-scanning THz imaging system for medical applications,ShijunSung,Ctr.forAdvancedSurgicalandInterventionalTechnology(UnitedStates);NuhbaFokwa,Univ.ofCalifornia,LosAngeles(UnitedStates);NehaBajwa,PriyamvadaTewari,MartinCuljat,RahulSingh,Ctr.forAdvancedSurgicalandInterventionalTechnology(UnitedStates);WarrenGrundfest,ZacharyD.Taylor,Univ.ofCalifornia,LosAngeles(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . [8496-27]
Efficiency of using correlation function for estimation of probability of substance detection on the base of THz spectral dynamics,VyacheslavA.Trofimov,DmitryA.Kirillov,LomonosovMoscowStateUniv.(RussianFederation) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8496-28]
SESSION 8 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 3:30 to 5:30 pm
ApplicationsSession Chairs: Mauro Fernandes Pereira, Jr., SheffieldHallamUniv.
(UnitedKingdom);Mona Jarrahi, Univ.ofMichigan(UnitedStates)
Dual band 550/1200 GHz wideband spectrometer for planetary observation (Invited Paper),ErichT.Schlecht,VahrazJamnejad,RobertF.Jarnot,JetPropulsionLab.(UnitedStates);BertrandThomas,RadiometerPhysicsGmbH(Germany);RichardRaffanti,TechneInstruments,Inc.(UnitedStates);RobertH.Lin,ImranMehdi,JetPropulsionLab.(UnitedStates). . . . . . . . . . . . . [8496-29]
Semiconductor investigation by terahertz radiation pulses (Invited Paper),ArunasKrotkus,Ctr.forPhysicalSciencesandTechnology(Lithuania)[8496-30]
Detection and identification of substance (explosive, drugs) using the dynamics of spectral lines distorted by influence of ambient medium,VyacheslavA.Trofimov,NikolayV.Peskov,LomonosovMoscowStateUniv.(RussianFederation). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8496-31]
Diffusion tensor and reflective THz imaging: a parallel study of burn wound hydration,NehaBajwa,Univ.ofCalifornia,LosAngeles(UnitedStates);ShijunSung,RahulSingh,Ctr.forAdvancedSurgicalandInterventionalTechnology(UnitedStates);MartinCuljat,Univ.ofCalifornia,LosAngeles(UnitedStates);AlexanderStojadinovic,CombatWoundInitiativeProgram(UnitedStates);WarrenGrundfest,ZacharyD.Taylor,Univ.ofCalifornia,LosAngeles(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8496-32]
Double resonance spectroscopy for remote sensing of trace molecular gases,DaneJ.Phillips,TheUniv.ofAlabamainHuntsville(UnitedStates);ElizabethA.Tanner,Ierus,Inc.(UnitedStates);SrikantaiahSreeHarsha,TheAEgisTechnologiesGroup,Inc.(UnitedStates);WayneD.Kimura,STIOptronics,Inc.(UnitedStates);JenniferHolt,FrankC.DeLucia,TheOhioStateUniv.(UnitedStates);HenryO.Everitt,U.S.ArmyAviationandMissileResearch,DevelopmentandEngineeringCtr.(UnitedStates)................ [8496-33]
Posters-Monday . . . . . . . . . . . . . . . . . . . . Mon. 5:30 to 7:30 pmConference attendees are invited to attend the poster session on Monday
evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
Terahertz spectroscopic imaging using noncollinear electro-optic sampling and a multistep mirror without shifting the object,NorihikoItani,KazunoriMaruyama,Shin-yaHasegawa,ShinichiWakana,FujitsuLabs.,Ltd.(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8496-34]
Polarization-independent terahertz three-dimensional subwavelength confinement in coupled slit structures,Joong-WookLee,GwangjuInstituteofScienceandTechnology(Korea,Republicof) . . . . . . . . . . . . . . . . . . . [8496-35]
Room temperature Nb 5N 6 microbolometer for 0.2THz and 0.65THz signals detecting,LinKang,Xu-CouTu,JianChen,Pei-HengWu,NanjingUniv.(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8496-36]
InGaAs bow-tie diodes for terahertz imaging: low-frequency noise characterisation,DaliusSeliuta,LinasMinkevicius,Ctr.forPhysicalSciencesandTechnology(Lithuania);JonasMatukas,ViliusPalenskis,SandraPralgauskaite,VilniusUniv.(Lithuania);IrmantasKasalynas,GintarasValusis,Ctr.forPhysicalSciencesandTechnology(Lithuania) . . . . . . . . . . . . . . . . [8496-37]
Imaging and characterization of solar cells by terahertz techniques,LinasMinkevicius,RasaSuzanoviciene,GediminasMolis,ArunasKrotkus,SauliusBalakauskas,RimvydasVenckevicius,Ctr.forPhysicalSciencesandTechnology(Lithuania);IrmantasKasalynas,Ctr.forPhysicalSciencesandTechnology(Lithuania)andVilniusUniv.(Lithuania);DaliusSeliuta,Ctr.forPhysicalSciencesandTechnology(Lithuania);GintarasValusis,VincasTamosiunas,Ctr.forPhysicalSciencesandTechnology(Lithuania)andVilniusUniv.(Lithuania) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8496-38]
Conference 8496
136 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Conference 8497Sunday-Monday 12-13 August 2012 • Proceedings of SPIE Vol. 8497
Photonic Fiber and Crystal Devices: Advances in Materials and Innovations in Device Applications VIConference Chairs:Shizhuo Yin, ThePennsylvaniaStateUniv.(UnitedStates);Ruyan Guo, TheUniv.ofTexasatSanAntonio(UnitedStates)
Program Committee:Partha P. Banerjee, Univ.ofDayton(UnitedStates);Liliana Braescu, InstitutNationaldelaRechercheScientifique(Canada);Joseph Grant, NASAStennisSpaceCtr.(UnitedStates);Ken-Yuh Hsu, NationalChiaoTungUniv.(Taiwan);Rongqing Hui, TheUniv.ofKansas(UnitedStates);Yoonchan Jeong, SeoulNationalUniv.(Korea,Republicof);Suganda Jutamulia, Univ.ofNorthernCalifornia(UnitedStates);Tsuyoshi Konishi, OsakaUniv.(Japan);Nicholai V. Kukhtarev, AlabamaA&MUniv.(UnitedStates);Ravindra B. Lal, AlabamaA&MUniv.(UnitedStates);Byoungho Lee, SeoulNationalUniv.(Korea,Republicof);Sergei F. Lyuksyutov, TheUniv.ofAkron(UnitedStates);Karl M. Reichard, ThePennsylvaniaStateUniv.(UnitedStates);Gérald Roosen, Institutd’OptiqueGraduateSchool(France);Paul Ruffin, U.S.ArmyResearch,DevelopmentandEngineeringCommand(UnitedStates);Ching-Cherng Sun, NationalCentralUniv.(Taiwan);Xiang Zhang, Univ.ofCalifornia,Berkeley(UnitedStates)
Honorary Conference Chair: Francis T. S. Yu, ThePennsylvaniaStateUniv.(UnitedStates)
Sunday 12 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 8:50 to 10:20 am
Photonic Fiber and Crystal Materials ISession Chairs: Ruyan Guo, TheUniv.ofTexasatSanAntonio(United
States);Narsingh B. Singh, SMS&TLLC(UnitedStates)
Nano morphology of ZnSe on patterned substrate (Invited Paper),NarsinghB.Singh,SMS&TLLC(UnitedStates);AndreBerghmans,KentonGreen,GaryKanner,NorthropGrummanElectronicSystems(UnitedStates);DavidKahler,NorthropGrummanCorp.(UnitedStates);DavidKnuteson,MatthewKing,SeanMcLaughlin,NorthropGrummanElectronicSystems(UnitedStates) . [8497-01]
Finite element modeling of acousto-optic effect and optimization of the figure of merit,RobertMcIntosh,AmarS.Bhalla,RuyanGuo,TheUniv.ofTexasatSanAntonio(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . [8497-02]
Ultra-torsion-sensitivity in Yb-doped fiber lasers with high birrefringent photonic crystal fiber,DanielToral,ArturoCastillo-Guzman,ValentinGuzman-Ramos,DanielE.Ceballos-Herrera,RomeoSelvas-Aguilar,Univ.AutónomadeNuevoLeón(Mexico). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8497-03]
Strong self-focusing of laser beam in a medium with quadratic nonlinear response,VyacheslavA.Trofimov,TatianaM.Lysak,LomonosovMoscowStateUniv.(RussianFederation)................................... [8497-04]
SESSION 2 . . . . . . . . . . . . . . . . . . . . . Sun. 10:50 am to 12:10 pm
Photonic Fiber and Crystal Materials IISession Chairs: Partha Banerjee, Univ.ofDayton(UnitedStates);
Ruyan Guo, TheUniv.ofTexasatSanAntonio(UnitedStates)
Superluminiscent Er 3+/Yb 3+-doped fiber source design for 1550nm applications,GrethellPerez-Sanchez,Ctr.deInvestigacióneInnovaciónTecnológica(Mexico);EnriquePinzon-Escobar,Univ.NacionalAutónomadeMéxico(Mexico);IsmaelTorres-Gomez,Ctr.deInvestigaciónesenOptica(Mexico);JoseA.Alvarez-Chavez,Ctr.deInvestigacióneInnovaciónTecnológica(Mexico) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8497-05]
Holographic imaging and interferometry with non-Bragg diffraction orders in lithium niobate and photothermoplastic film,NicholaiV.Kukhtarev,TatianaKukhtareva,AlabamaA&MUniv.(UnitedStates). . . . . . . . . . . . . . . . . [8497-06]
Competition of linearly polarized modes in fibers containing Bragg gratings in a wide temperature range,SergeiF.Lyuksyutov,TheUniv.ofAkron(UnitedStates);GrigoryAdamovsky,NASAGlennResearchCtr.(UnitedStates);JeffreyR.Mackey,ASRCAerospaceCorp.(UnitedStates);BertramFloyd,SierraLobo,Inc.(UnitedStates);UjithaA.Abeywickrema,IgorFedin,TheUniv.ofAkron(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8497-07]
Optimization of the polarization state for photorefractive crystal-based collinear holographic data storage system,JianhuaLi,LiangcaiCao,QingshengHe,GuofanJin,TsinghuaUniv.(China) . . . . . . . . . . . . . . . [8497-08]
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:10to2:00pm
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 2:00 to 3:20 pm
Photonic Fiber and Crystal Materials IIISession Chairs: Nickolai V. Kukhtarev, AlabamaA&MUniv.(United
States);Ruyan Guo, TheUniv.ofTexasatSanAntonio(UnitedStates)
Low-voltage, high-speed electro-optic scanner and switch in crystal-ion-sliced thin-film lithium niobate,JamesE.Toney,MikeShnider,NeilSmith,VincentStenger,PeterPontius,JamesBusch,SriSriram,SRICOInc.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8497-09]
All-optical switch based on stimulated Raman scattering,ArielFlores-Rosas,InstitutoNacionaldeAstrofísica,ÓpticayElectrónica(Mexico);JuanManuelMerlo-Ramirez,TecnológicodeMonterrey(Mexico) . . . . . . . . . . . . . . [8497-10]
Spectral distribution of the fluorescence depolarization excited in erbium-doped fibers in 1490-1570 nm range,LilianaO.Martínez-Martínez,EliseoHernández-Hernández,SergueiStepanov,Ctr.deInvestigaciónCientíficaydeEducaciónSuperiordeEnsenada(Mexico) . . . . . . . . . . . . . . . . . . . . . [8497-11]
Thermal stability solutions for optical current sensor using thermoelectric calibration,ShupingWang,Univ.ofNorthTexas(UnitedStates);XiaolingYang,BeijingUnionUniv.(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8497-12]
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 3:50 to 5:10 pm
Photonic Fiber and Crystal Materials IVSession Chairs: Abdalla M. Darwish, DillardUniv.(UnitedStates);
Ruyan Guo, TheUniv.ofTexasatSanAntonio(UnitedStates)
Double-pulse laser deposition of polymer nanocomposite films for optical sensors and light emitting applications,AbdallaM.Darwish,SimeonWilson,MichaelSagapolutele,DillardUniv.(UnitedStates);SergeyS.Sarkisov,Sr.,SSSOpticalTechnologies,LLC(UnitedStates). . . . . . . . . . . . . . . . . . . . . . [8497-13]
Application of the transfer matrix method to reflection gratings in positive and negative index materials,HanLi,RolaAylo,ParthaBanerjee,GeorgesT.Nehmetallah,Univ.ofDayton(UnitedStates). . . . . . . . . . . . . . . . . . . . [8497-14]
Nanofocusing by an all-angle negative refraction photonic crystal,QimingZhang,XiangpingLi,MinGu,SwinburneUniv.ofTechnology(Australia)[8497-15]
Compact demultiplexing mechanism utilizing slow-light regime in cascaded photonic crystal waveguides,AhmetEminAkosman,MehmetMutlu,BilkentUniv.(Turkey);HamzaKurt,TOBBUniv.ofEconomicsandTechnology(Turkey);EkmelOzbay,BilkentUniv.(Turkey). . . . . . . . . . . . . . . . . . . . . . . . . . . [8497-16]
Symposium-Wide Plenary Session . . . . . . . . . . . . . . . . . . . . Sun. 6:00 to 7:25 pm6:00pm: Introduction and Opening Remarks
6:05pm: The Exciting Science of Light with Metamaterials, VladimirM.Shalaev,PurdueUniv.(USA)
6:45pm:Future of Optics and Photonics, BahaaE.A.Saleh,CREOL,TheCollegeofOpitcsandPhotonicsattheUniv.ofCentralFlorida(USA)
spie.org/opadvance · TEL:+13606763290 · help@spie.org 137
Monday 13 AugustSESSION 5 . . . . . . . . . . . . . . . . . . . . . . . . .Mon. 8:50 to 10:20 am
Photonic Fiber and Crystal Devices and Applications ISession Chairs: Paul Ruffin, U.S.ArmyAviationandMissileCommand
(UnitedStates);Shizhuo Yin, ThePennsylvaniaStateUniv.(UnitedStates)
2D soliton formation of BEC at its interaction with external potential (Invited Paper),VyacheslavA.Trofimov,ArtemV.Rozantsev,LomonosovMoscowStateUniv.(RussianFederation)................................... [8497-17]
Numerical study on transformation optical device using Luneburg lens and Bragg grating for converting cylindrical waves to plane waves,EuiYoungSong,SeoulNationalUniv.(Korea,Republicof);HwiKim,KoreaUniv.(Korea,Republicof);ByounghoLee,SeoulNationalUniv.(Korea,Republicof)[8497-18]
Recent advances in fabrication and application of IR single crystal fiber,ShizhuoYin,ThePennsylvaniaStateUniv.(UnitedStates);ClaireLuo,GeneralOptoSolutions,LLC(UnitedStates);JipingCheng,ThePennsylvaniaStateUniv.(UnitedStates);PaulRuffin,ChristinaBrantley,EugeneEdwards,U.S.ArmyAviationandMissileCommand(UnitedStates) . . . . . . . . . . . . . . . . . . [8497-19]
Optical distribution of LEDs measured by screen imaging synthesis method,YehWeiYu,Ching-CherngSun,NationalCentralUniv.(Taiwan). . . . . [8497-20]
SESSION 6 . . . . . . . . . . . . . . . . . . . . Mon. 10:50 am to 12:10 pm
Photonic Fiber and Crystal Devices and Applications IISession Chairs: Paul Ruffin, U.S.ArmyAviationandMissileCommand
(UnitedStates);Shizhuo Yin, ThePennsylvaniaStateUniv.(UnitedStates)
Dynamic and tunable optical waveguide based on KTN electro-optic crystals,Yun-ChingChang,ShizhuoYin,ThePennsylvaniaStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8497-21]
A novel sensing approach using nonlinear defect photonic crystal structures,DanT.Nguyen,RobertNorwood,CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8497-22]
Minimally invasive three-dimensional medical imaging and fiber-coupled wave mixing,ArdeshirOsanlou,GlyndwrUniv.(UnitedKingdom);HansI.Bjelkhagen,EvangelosMirlis,IntrepidEuropeLtd.(UnitedKingdom);BruceNapier,VividComponentsLtd(UnitedKingdom). . . . . . . . . . . . . . . . . [8497-23]
Speckle-reduction for fringe patterns using a database system based on the empirical mode decomposition,Wei-HungSu,Cheng-WeiLee,Chao-KueiLee,NationalSunYat-SenUniv.(Taiwan)....................... [8497-24]
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:10to2:00pm
SESSION 7 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 2:00 to 3:20 pm
Photonic Fiber and Crystal Devices and Applications IIISession Chairs: Wei-Hung Su, NationalSunYat-SenUniv.(Taiwan);
Shizhuo Yin, ThePennsylvaniaStateUniv.(UnitedStates)
150-nm continuous tuning of external-cavity quantum-dot lasers operated below 90-mA,GrayLin,Pei-YinSu,Hsu-ChiehCheng,NationalChiaoTungUniv.(Taiwan);Yu-ChenChen,UnionOptronicsCorp.(Taiwan)andNationalChiaoTungUniv.(Taiwan)................................... [8497-25]
Strongly asymmetric electromagnetic field distribution in chirped photonic crystal waveguides,AhmetEminAkosman,BilkentUniv.(Turkey);DoneErbas,HamzaKurt,TOBBUniv.ofEconomicsandTechnology(Turkey);EkmelOzbay,BilkentUniv.(Turkey). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8497-26]
Slow-light-based photonic crystal waveguides with cavities for all-optical switching applications,VijayJanyani,NageshJanrao,MalaviyaNationalInstituteofTechnology(India). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8497-27]
Giant tunable optical dispersion using chromo-modal excitation of a multimode waveguide,EricD.Diebold,KamYanHon,ZhongweiTan,JasonChou,ToddSienicki,ChaoWang,BahramJalali,Univ.ofCalifornia,LosAngeles(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8497-28]
SESSION 8 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 3:50 to 5:10 pm
Photonic Fiber and Crystal Devices and Applications IVSession Chairs: Guoqiang Li, TheOhioStateUniv.(UnitedStates);
Shizhuo Yin, ThePennsylvaniaStateUniv.(UnitedStates)
Nanoparticle-doped liquid crystal device for phase modulation,GuoqiangLi,TheOhioStateUniv.(UnitedStates);ThomasMauger,TheOhioStateUniv.HavenerEyeInstitute(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . [8497-29]
Analysis of nematic liquid crystal resonator for optical frequency comb generation,DiZhu,YanyanZhou,NanyangTechnologicalUniv.(Singapore)andA*STARSingaporeInstituteofManufacturingTechnology(Singapore);XiaYu,A*STARSingaporeInstituteofManufacturingTechnology(Singapore);FengLuan,PingShum,NanyangTechnologicalUniv.(Singapore). . . . . . . . [8497-30]
Ultrasensitive standoff chemical sensing based on nonlinear multi-photon laser wave-mixing spectroscopy,WilliamTong,MarcelHetu,MarcGregerson,MannaIwabuchi,TiffanyNeary,JorgeJimenez,AshleyWarren,SanDiegoStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8497-31]
Noise investigation and signal processing in fiber optic gas sensor with wavelength modulation of the DFB laser diode,JunChang,GuangpingLv,HengtaiChang,GuoqingZhou,QiangWang,CunguangZhu,HaiyongSong,JunqiangTian,FujunSong,TingGao,ShandongUniv.(China). . . . . . [8497-32]
Posters-Monday . . . . . . . . . . . . . . . . . . . . Mon. 5:30 to 7:30 pmConference attendees are invited to attend the poster session on Monday
evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
One-way electromagnetic wave propagation utilizing self-construction property of Bessel-like beams,AhmetEminAkosman,MehmetMutlu,BilkentUniv.(Turkey);MirbekTurduev,HamzaKurt,TOBBUniv.ofEconomicsandTechnology(Turkey);EkmelOzbay,BilkentUniv.(Turkey). . . . . . . . . . [8497-33]
Enhance the electric field by nanostructured metals,ChaoWang,ShizhuoYin,ThePennsylvaniaStateUniv.(UnitedStates);PaulRuffin,ChristinaBrantley,EugeneEdwards,U.S.ArmyAviationandMissileCommand(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8497-34]
High-aspect ratio titania 3-dimensional (TiO 2) nanostructures: fabrications and applications,ChihminLin,ShizhuoYin,ThePennsylvaniaStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8497-35]
Investigation of radiation-induced air fluorescence,JimmyYao,StuartYin,JackBrenizer,ThePennsylvaniaStateUniv.(UnitedStates);RonqingHui,TheUniv.ofKansas(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8497-36]
Polarizing Panda-type W-fibers,AlexanderM.Kurbatov,RomanA.Kurbatov,KuznetsovResearchInstituteforAppliedMechanics(RussianFederation) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8497-37]
Hollow-core photonic bandgap fiber with microfluid-infiltrated air holes for slow-light propagation,LiyongRen,JianLiang,Xi’anInstituteofOpticsandPrecisionMechanics(China);MaojinYun,QingdaoUniv.(China). . . . [8497-38]
Pressure dependence of the optical power of acetylene confined in the hollow-core photonic crystal fiber,ManuelI.Ocegueda,EliseoH.Hernández,SergueiStepanov,Ctr.deInvestigaciónCientíficaydeEducaciónSuperiordeEnsenada(Mexico);PeterAgruzov,AlexanderShamray,IoffePhysico-TechnicalInstitute(RussianFederation). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8497-39]
New geometry of photonic crystal fiber for improved dispersion compensation,VijayJanyani,SanjeevK.Metya,NageshJanrao,MalaviyaNationalInstituteofTechnology(India). . . . . . . . . . . . . . . . . . . . . . . . . [8497-40]
Deformation measurements using projected fringe profilometry,Wei-HungSu,Wei-TingCo,NationalSunYat-SenUniv.(Taiwan) . . . . . . . . . . . . [8497-41]
Image registration with fringe projection techniques: a simple approach to form a high-resolution image from multiple low-resolution images,Wei-HungSu,Yu-TingYao,Chao-KueiLee,NationalSunYat-senUniv.(Taiwan) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8497-42]
Analysis of beams interference reflected from atomic force microscope tip and periodic silicon surface under various humidity conditions: step towards dynamical sensing at the nanoscale,HansP.Banerjee,Univ.ofIllinoisatUrbana-Champaign(UnitedStates);AsankaT.Weerasinghe,SergeiF.Lyuksyutov,TheUniv.ofAkron(UnitedStates). . . . . . . . . . . . . . . . . . [8497-43]
Negative refraction phenomenon in a two-dimensional hexagonal lattices annular photonic crystal,MaojinYun,FengXia,MeilingLiu,JianLiang,QingdaoUniv.(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8497-44]
Conference 8497
138 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Negative refraction and superlensing in a two-dimensional triangular lattices graded photonic crystals,MaojinYun,MeilingLiu,QingdaoUniv.(China);FengXia,QingdaoUniv(China);JianLiang,QingdaoUniv.(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8497-45]
Investigation for persistence of two-center recording in various doubly-doped LiNbO 3 crystals,ZhifangChai,EastChinaNormalUniv.(China);Ya’nanZhi,ShanghaiInstituteofOpticsandFineMechanics(China);LuCui,XiaohuaQi,QiangHuan,EastChinaNormalUniv.(China) . . . . . . . . . . . . . . . . . . . [8497-46]
Design of an integrated 4×4 electro-optic switches based ferroelectric inverted domains,LingyuWan,ZhiyongLu,LiangfangChao,BaoshanShi,GuangxiUniv.(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8497-47]
Sensitivity enhancement of electro-optic polymer probing system using photo-isomerization and Fabry-Perot effects,Hsin-HerYu,Zong-YouKe,Zi-MaoSu,Wen-KaiKuo,NationalFormosaUniv.(Taiwan). . . . . . . . . . . [8497-48]
USAF target retrieval by one-shot digital holography using random phase modulation of signal beam,Chi-ShouWu,Yeh-WeiYu,Chih-YuanCheng,Che-ChuLin,Ching-CherngSun,NationalCentralUniv.(Taiwan). . . . [8497-49]
Construction of optoelectronic memory arrays based on vertical cavity surface-emitting lasers and optically-controlled electroabsorption modulators,DmytroKostiuchenko,VinnytsiaNationalTechnicalUniv.(Ukraine) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8497-50]
Impact of the gain saturation on steady states of ultrashort bit optical pulses in an erbium-doped single-mode fiber amplifier,MauroSanchez-Sanchez,Univ.delPapaloapan(Mexico);AlexandeS.Shcherbakov,InstitutoNacionaldeAstrofísica,ÓpticayElectrónica(Mexico). . . . . . . . . . . . . [8497-51]
Density of modes maps for design of the photonic crystal devices,IgorV.Guryev,IgorSukhoivanov,PedroRuizAguileraPatino,MiguelAngelAguileraPatino,JoseDavidLopezMontulvo,NataliaGurieva,JuanRicardoCabreraEsteves,EverardoVargasRodriguez,Univ.deGuanajuato(Mexico). . [8497-52]
The thermal management of high-power light emitting diodes,Ming-SengHsu,Chung-ChihChang,Jen-WeiHuang,Feng-LinShyu,ChineseMilitaryAcademy(Taiwan);Yau-ChyrWang,Nan-JeonInstituteofTechnology(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8497-53]
Ferroelectric memory based on ferroelectric-semiconductor heterostructure,ArmenR.Poghosyan,NatellaR.Aghamalyan,TigranAslanyan,RubenHovsepyan,InstituteforPhysicalResearch(Armenia);RuyanGuo,TheUniv.ofTexasatSanAntonio(UnitedStates) . . . . . . . . . . . . . . . . . . . [8497-54]
Thermo-optical property and frequency dispersion of lead barium niobate crystals,ChunlaiLi,Kuang-ChiInstituteofAdvancedTechnology,Shenzhen(China);AmarS.Bhalla,RuyanGuo,TheUniv.ofTexasatSanAntonio(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8497-55]
Theoretical studies on dynamics of fixed holograms with high-diffraction efficiency in LiNbO 3:Fe crystals,PeipeiHou,Ya’nanZhi,JianfengSun,LirenLiu,ShanghaiInstituteofOpticsandFineMechanics(China). . . . . . . [8497-56]
Enhancing radiation control of an optical leaky wave antenna in a resonator,SalvatoreCampione,CanerGuclu,QiSong,OzdalBoyraz,FilippoCapolino,Univ.ofCalifornia,Irvine(UnitedStates) . . . . . . . . . . . . . . . [8497-57]
Conference 8497
spie.org/opadvance · TEL:+13606763290 · help@spie.org 139
Conference 8498Wednesday-Thursday 15-16 August 2012 • Proceedings of SPIE Vol. 8498
Optics and Photonics for Information Processing VIConference Chairs:Abdul A. S. Awwal, LawrenceLivermoreNationalLab.(UnitedStates);Khan M. Iftekharuddin, OldDominionUniv.(UnitedStates)
Program Committee:Henri H. Arsenault, Univ.Laval(Canada);George Barbastathis, MassachusettsInstituteofTechnology(UnitedStates);Juan Campos, Univ.AutònomadeBarcelona(Spain);David P. Casasent, CarnegieMellonUniv.(UnitedStates);H. John Caulfield, AlabamaA&MUniv.(UnitedStates);Pietro Ferraro, IstitutoNazionalediOttica(Italy);Laurence Hassebrook, Univ.ofKentucky(UnitedStates);Kazuyoshi Itoh, OsakaUniv.(Japan);Mohammad Ataul Karim, OldDominionUniv.(UnitedStates);Byoungho Lee, SeoulNationalUniv.(Korea,Republicof);Abhijit Mahalanobis, LockheedMartinMissilesandFireControl(UnitedStates);Andrés Márquez, Univ.deAlicante(Spain);Mohammad A. Matin, Univ.ofDenver(UnitedStates);Osamu Matoba, KobeUniv.(Japan);Alastair D. McAulay, LehighUniv.(UnitedStates);Nasser M. Nasrabadi, U.S.ArmyResearchLab.(UnitedStates);Thomas J. Naughton, NationalUniv.ofIreland,Maynooth(Ireland);Mark Allen Neifeld, TheUniv.ofArizona(UnitedStates);Takanori Nomura, WakayamaUniv.(Japan);Ting-Chung Poon, VirginiaPolytechnicInstituteandStateUniv.(UnitedStates);Philippe Réfrégier, InstitutFresnel(France);Joseph Rosen, Ben-GurionUniv.oftheNegev(Israel);John T. Sheridan, Univ.CollegeDublin(Ireland);Enrique Tajahuerce-Romera, Univ.JaumeI(Spain);Jun Tanida, OsakaUniv.(Japan);Cardinal Warde, MassachusettsInstituteofTechnology(UnitedStates);Frank Wyrowski, Friedrich-Schiller-Univ.Jena(Germany);Toyohiko Yatagai, UtsunomiyaUniv.(Japan);Francis T. S. Yu, ThePennsylvaniaStateUniv.(UnitedStates);Maria Josefa Yzuel, Univ.AutònomadeBarcelona(Spain)
Sunday 12 AugustSymposium-Wide Plenary Session . . . . . . . . . . . . . . . . . . . . Sun. 6:00 to 7:25 pm6:00pm: Introduction and Opening Remarks
6:05pm: The Exciting Science of Light with Metamaterials, VladimirM.Shalaev,PurdueUniv.(USA)
6:45pm:Future of Optics and Photonics, BahaaE.A.Saleh,CREOL,TheCollegeofOpitcsandPhotonicsattheUniv.ofCentralFlorida(USA)
Wednesday 15 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . .Wed. 8:20 to 10:00 am
Hybrid SystemsSession Chair: Mohammad A. Matin, Univ.ofDenver(UnitedStates)
A GPU-based, real-time image processing for an axis-symmetrical optical laser triangulation system,PedroD.Buschinelli,ArmandoAlbertazziGonçalves,Jr.,GabrielA.B.Landeira,Univ.FederaldeSantaCatarina(Brazil). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8498-01]
Multiband OFDM-UWB signals over hybrid fiber-wireless link,SalihM.Kenshil,GasemRashwan,MohammadM.Matin,Univ.ofDenver(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8498-02]
Compression enhancement using the hybrid motion-estimation in sub-image array transformed from elemental image array in three-dimensional integral image,Hyoung-WooLee,Ju-HanLee,Ho-HyunKang,KwangwoonUniv.(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8498-03]
PAPR reduction in OFMD WiMAX application,GasemRashwan,SalihM.Kenshil,MohammadA.Matin,Univ.ofDenver(UnitedStates). . . . . . [8498-04]
Non-contact detection of cardiac rate based on visible light imaging device,HuishiZhu,YuejinZhao,LiquanDong,BeijingInstituteofTechnology(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8498-05]
SESSION 2 . . . . . . . . . . . . . . . . . . . . . . . .Wed. 10:30 to 11:50 am
Pattern Recognition ISession Chair: Abdul A. S. Awwal, LawrenceLivermoreNationalLab.
(UnitedStates)
Improvement of face recognition with composite correlation filters designed with combinatorial optimization,SergioPinto-Fernández,VictorH.Díaz-Ramírez,AlejandraSerrano-Trujillo,Ctr.deInvestigaciónyDesarrollodeTecnologíaDigital(Mexico). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8498-06]
Real-time multiclass object recognition system based on adaptive correlation filtering,ViridianaContreras,VictorH.Díaz-Ramírez,FranciscoJ.Ramirez-Arias,KeniaPicos,Ctr.deInvestigaciónyDesarrollodeTecnologíaDigital(Mexico). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8498-07]
Diffractive and sampling effects using spatial light modulators on Fourier transform holograms and two-beam interferograms,AlfonsoPadilla-Vivanco,RosaE.Farías-Díaz,Univ.PolitécnicadeTulancingo(Mexico);CarinaToxqui-Quitl,Univ.PolitecnicadeTulancingo(Mexico) . . . . . . . . . . . . . . . . . . [8498-08]
High-speed holographic correlation system by time-division recording method for copyright contents management on the internet,ErikoWatanabe,KanamiIkeda,KashikoKodate,TheUniv.ofElectro-Communications(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8498-09]
Lunch/Exhibition Break........................... 11:50amto1:40pm
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 1:40 to 4:10 pm
Pattern Recognition IISession Chair: Alastair D. McAulay, LehighUniv.(UnitedStates)
Compression scheme by use of object-segmented sub-image array transformed from elemental image array based on multiple objects in 3D integral imaging,Hyoung-WooLee,KwangwoonUniv.(Korea,Republicof);Ju-HanLee,KwnagwoonUniv.(Korea,Republicof);Ho-HyunKang,Eun-SooKim,KwangwoonUniv.(Korea,Republicof) . . . . . . . . . . . . . . . . . . . . [8498-10]
Automatic fusion of thermal and visual images,MuslaArslan,ShamimReza,KhanM.Iftekharuddin,OldDominionUniv.(UnitedStates). . . . . . . . . [8498-11]
Correlating a template with video using an optical correlator,AlastairD.McAulay,LehighUniv.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . [8498-12]
Accurate outdoor 3D shape measurements with structured illumination using narrow spectral filtering,MartinSchaffer,Friedrich-Schiller-Univ.Jena(Germany);MarcusGroße,Friedrich-Schiller-Univ.Jena(Gibraltar);BastianHarendt,RichardM.Kowarschik,Friedrich-Schiller-Univ.Jena(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8498-13]
Multi-dimensional distortion measurement for remote sensing images based on volume holographic optical correlator,TianxiangZheng,LiangcaiCao,TianZhao,QingshengHe,GuofanJin,TsinghuaUniv.(China). . [8498-14]
A comparative study of computer-generated random specklegrams for digital image correlation method (DICM),GuoqingGu,KaifuWang,NanjingUniv.ofAeronauticsandAstronautics(China). . . . . . . . . . . . . . . . . . . [8498-15]
Posters-Wednesday . . . . . . . . . . . . . . . . . Wed. 5:30 to 7:30 pmConference attendees are invited to attend the poster session on Wednesday evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
Diffraction analysis and imaging properties of Fresnel telescopy imaging system,AiminYan,LirenLiu,JianfengSun,EnwenDai,YuZhou,Ya’nanZhi,ShanghaiInstituteofOpticsandFineMechanics(China) . . . . . . . . . . [8498-29]
Multidimensional laser microscopy polarization-singular structure of phase-inhomogeneous layers for diagnostics and classification of their optical properties,AlexanderV.Dubolazov,YuriyFedkovychChernivtsiNationalUniv.(Ukraine) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8498-30]
Statistic analysis of topological transformation of birefringent structure matrix images of biological tissues,ArtemO.Karachevtsev,YuriyFedkovychChernivtsiNationalUniv.(Ukraine). . . . . . . . . . . . . . . . . . . . . . . . . . . . [8498-31]
140 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Spatial-frequency phasometry of biological polycrystalline networks coherent images,PavloO.Angelsky,YuriyFedkovychChernivtsiNationalUniv.(Ukraine) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8498-32]
Singular approach in processing of Mueller-matrix images for diagnostics optical anisotropy,LarysaV.Trifonyuk,RivneOncologicalRegionalHospital(Ukraine) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8498-33]
System of polarization correlometry of biological liquids,VolodymirG.Ushenko,YuriyFedkovychChernivtsiNationalUniv.(Ukraine). . . . . . [8498-34]
Scale-selective polarization cartography of biological polycrystalline net,YuriyA.Ushenko,YuriyFedkovychChernivtsiNationalUniv.(Ukraine)[8498-35]
The system of polarization-phase filtering of laser images of liquid-crystal networks of biological fluids,YuriyA.Ushenko,YuriyFedkovychChernivtsiNationalUniv.(Ukraine). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8498-36]
Complex and power spectra of optical signals using time-dispersion spectral analysis,ArsenyZhdanov,OlegD.Moskaletz,St.PetersburgStateUniv.ofAerospaceInstrumentation(RussianFederation) . . . . . . . . . . [8498-37]
Power optical signals spectrum assessment using resonance spectral analysis method,VasilyKazakov,OlegD.Moskaletz,MikhailA.Vaganov,St.PetersburgStateUniv.ofAerospaceInstrumentation(RussianFederation) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8498-38]
Information parameters of DWDM fiber-optic dynamic loop memory,AlexandreV.Polyakov,BelarusianStateUniv.(Belarus) . . . . . . . . . . . [8498-39]
Bio-holographic image segmentation by using interactive graph-cut,InkyuMoon,FaliuYi,ChosunUniv.(Korea,Republicof). . . . . . . . . . . . . . . . [8498-40]
Efficient hologram generation of 3D object using block-based region analysis and N-LUT method,Seung-CheolKim,Keun-DolNa,Min-WooKwon,Eun-SooKim,KwangwoonUniv.(Korea,Republicof). . . . . . . . . . . . . [8498-41]
FPGA-based hardware implementation of novel look-up table method,Seung-CheolKim,Si-HyungKim,Min-WooKwon,Eun-SooKim,KwangwoonUniv.(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8498-42]
Accelerated computation of CGH using inter-line and temporal-redundancy data of 3D video image,Seung-CheolKim,Dong-WookKim,Min-WooKwon,Eun-SooKim,KwangwoonUniv.(Korea,Republicof). . . . . . . . . . . . . [8498-43]
Study the sensitivity of BER performance in single-carrier and multicarrier (OFDM),SalehM.Albdran,AhmadA.Alshammari,MohammadA.Matin,Univ.ofDenver(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8498-44]
Study of bit error rate (BER) for multicarrier OFDM,AhmadA.Alshammari,SalehM.Albdran,MohammadA.Matin,Univ.ofDenver(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8498-45]
Thursday 16 AugustSESSION 4 . . . . . . . . . . . . . . . . . . . . . . . Thurs. 8:40 to 10:00 am
Optical Systems ISession Chair: Andrés Márquez, Univ.deAlicante(Spain)
Computer-automated program for calibration of an optical tweezers setup,CourtneyTaylor,AppalachianStateUniv.(UnitedStates). . . . . . . . . . [8498-16]
Analysis and design of wedge projection display based on ray tracing method,Chang-KunLee,TaewonLee,Sung-WookMin,KyungHeeUniv.(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8498-17]
A dynamic beam splitter using polymer dispersed liquid crystals materials,MarinaRiquelme,ManuelOrtuño,AndrésMárquez,SergiGallego,InmaculadaPascual,AugustoBeléndez,Univ.deAlicante(Spain). . . . . . . . . . . . . [8498-18]
Novel instrumentation of multispectral imaging technology for detecting tissue abnormity,DingrongYi,LinghuaKong,MoticChinaGroupCo.Ltd.(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8498-19]
SESSION 5 . . . . . . . . . . . . . . . . . . . . . . Thurs. 10:30 to 11:30 am
Optical Systems IISession Chair: Khan M. Iftekharuddin, OldDominionUniv.(United
States)
Analysis of periodic anisotropic media by means of split-field FDTD method and GPU computing,JorgeFrancés,AndrésMárquez,SergioBleda,Univ.deAlicante(Spain)andI.U.FísicaAplicadaalasCienciasylasTecnologías(Spain);JavierMartínez-Guardiola,Univ.deAlicante(Spain);MarielaL.ÁlvarezLópez,Univ.deAlicante(Spain)andI.U.FísicaAplicadaalasCienciasylasTecnologías(Spain);CristianNeipp,Univ.deAlicante(Spain);AugustoBeléndez,Univ.deAlicante(Spain)andI.U.FísicaAplicadaalasCienciasylasTecnologías(Spain). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8498-20]
Classical polarimetric method revisited to analyse the modulation capabilities of parallel aligned liquid crystal on silicon displays,AndrésMárquez,FranciscoJavierMartínez-Verdu,SergiGallego,ManuelOrtuñoSanchez,JorgeFrancésMonllor,AugustoBeléndez,InmaculadaPascual,Univ.deAlicante(Spain). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8498-21]
Development of an optical system for geometric inspection of outer surface of pipelines,MaryahE.M.Haertel,ArmandoAlbertazzi,JoãoRicardodeCastroMelo,AnaMariaBori,MaurícioReck,DarlanBecker,Univ.FederaldeSantaCatarina(Brazil). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8498-22]
Lunch/Exhibition Break........................... 11:30amto1:00pm
SESSION 6 . . . . . . . . . . . . . . . . . . . . . . . . Thurs. 1:00 to 3:00 pm
Optical ImagingSession Chair: Byoungho Lee, SeoulNationalUniv.(Korea,Republicof)
Development of tactile sensor using TOMBO,KenjiYamada,KayoYoshimoto,MakiTakeda,ToshiakiNagakura,KenIshihara,YukoOhno,OsakaUniv.(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8498-23]
Fast hologram pattern generation by radial symmetry interpolation,SeokLee,Ho-CheonWey,DongkyungNam,DusikPark,Chang-YeoungKim,SamsungAdvancedInstituteofTechnology(Korea,Republicof). . . . [8498-24]
Bi-directional two-dimensional/three-dimensional convertible integral imaging using scattering polarizer,JiwoonYeom,JisooHong,Soon-giPark,SeoulNationalUniv.(Korea,Republicof);Sung-WookMin,KyungHeeUniv.(Korea,Republicof);ByounghoLee,SeoulNationalUniv.(Korea,Republicof) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8498-25]
High-resolution, three-dimensional imaging using GPU-based computer-generated hologram,Yi-TaLee,Xin-JiLai,NationalTaiwanNormalUniv.(Taiwan);Han-YenTu,ChineseCultureUniv.(Taiwan);Chau-JernCheng,NationalTaiwanNormalUniv.(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . [8498-26]
Pre-distorted elemental image generation for off-axis integral floating system,YoungMinKim,Sung-WookMin,KyungHeeUniv.(Korea,Republicof) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8498-27]
Temporal anomalies in rotating mirror high-speed cameras,HansO.Rolfsnes,MichaelConneely,CharlesMain,PaulA.Campbell,Univ.ofDundee(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8498-28]
Conference 8498
spie.org/opadvance · TEL:+13606763290 · help@spie.org 141
Conference 8499Monday-Thursday 13-16 August 2012 • Proceedings of SPIE Vol. 8499
Applications of Digital Image Processing XXXVConference Chair:Andrew G. Tescher, AGTAssociates(UnitedStates)
Program Committee:Vittorio A. Baroncini, FondazioneUgoBordoni(Italy);Vasudev Bhaskaran, QualcommInc.(UnitedStates);Wo L. Chang, NationalInstituteofStandardsandTechnology(UnitedStates);Florian Ciurea, PelicanImagingCorp.(UnitedStates);Frederic Dufaux, TelecomParisTech(France);Touradj Ebrahimi, EcolePolytechniqueFédéraledeLausanne(Switzerland);Ali Habibi, Consultant(UnitedStates);Arianne T. Hinds, CableLabs(UnitedStates);T. Russell Hsing, TelcordiaTechnologies,Inc.(UnitedStates);Walter J. Husak, DolbyLabs.,Inc.(UnitedStates);C. C. Jay Kuo, TheUniv.ofSouthernCalifornia(UnitedStates);Dan Lelescu, PelicanImagingCorp.(UnitedStates);Andre J. Oosterlinck, KuleuvenR&D(Belgium);Sethuraman A. Panchanathan, ArizonaStateUniv.(UnitedStates);Hyunggon Park, EwhaWomansUniv.(Korea,Republicof);Fernando Pereira, InstitutodeTelecomunicações(Portugal);Yuriy A. Reznik, InterDigital,Inc.(UnitedStates);Thomas Richter, Univ.Stuttgart(Germany);John A. Saghri, CaliforniaPolytechnicStateUniv.,SanLuisObispo(UnitedStates);Peter Schelkens, VrijeUniv.Brussel(Belgium);Gary J. Sullivan, MicrosoftCorp.(UnitedStates);Pankaj Topiwala, FastVDOInc.(UnitedStates);Mihaela van der Schaar, Univ.ofCalifornia,LosAngeles(UnitedStates);Anthony Vetro, MitsubishiElectricResearchLabs.(UnitedStates)
Sunday 12 AugustSymposium-Wide Plenary Session . . . . . . . . . . . . . . . . . . . . Sun. 6:00 to 7:25 pm6:00pm: Introduction and Opening Remarks
6:05pm: The Exciting Science of Light with Metamaterials, VladimirM.Shalaev,PurdueUniv.(USA)
6:45pm:Future of Optics and Photonics, BahaaE.A.Saleh,CREOL,TheCollegeofOpitcsandPhotonicsattheUniv.ofCentralFlorida(USA)
Monday 13 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . .Mon. 8:00 to 11:50 am
Image Signal ProcessingSession Chair: Andrew G. Tescher, AGTAssociates(UnitedStates)
Resolution improvement of optical intrinsic signal imaging by automated removing outlier images during data analysis: a comparative study,DavidAbookasis,YekutielMeshorer,ArielUniv.Ctr.ofSamaria(Israel). . . . [8499-01]
Super-resolution pre-processing of data from undersampled imaging systems for phase diversity,EricA.Shields,SandiaNationalLabs.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8499-02]
Statistics of Fresnelet-coefficients in PSI holograms,MarcWilke,Univ.Stuttgart(Germany). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8499-03]
Performance evaluation of consumer-grade 3D sensors for static 6DOF pose estimation systems,JeremyA.Marvel,NationalInstituteofStandardsandTechnology(UnitedStates)andUniv.ofMaryland(UnitedStates);MarekFranaszek,TsaiHong,NationalInstituteofStandardsandTechnology(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8499-04]
Adaptive bilateral filter for video and image upsampling,RahulVanam,YanYe,InterDigital,Inc.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . [8499-05]
Comparison of refractive power maps from a reference surface: geometric versus Zernike power polynomials,AngelS.CruzFélix,SandraBalderas-Mata,EstelaLópez-Olazagasti,EduardoTepichín-Rodríguez,InstitutoNacionaldeAstrofísica,ÓpticayElectrónica(Mexico). . . . . . . . . . . . . . . . . . . . [8499-06]
Image reconstruction from compressive samples via a Max-product EM algorithm,ZhaoSong,AleksandarDogandzic,IowaStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8499-07]
Two-factor authentication system based on optical interference and one-way hash function,WenqiHe,XiangPeng,ShenzhenUniv.(China);XiangfengMeng,ShandongUniv.(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8499-08]
Image restoration based on topological properties of functions of two variables,ArtyomMakovetskii,ChelyabinskStateUniv.(RussianFederation);VitalyI.Kober,Ctr.deInvestigaciónCientíficaydeEducaciónSuperiordeEnsenada(Mexico) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8499-09]
New image compression algorithm based on improved reversible biorthogonal integer wavelet transform,Li-BaoZhang,Xian-chuanYu,BeijingNormalUniv.(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8499-10]
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11:50amto1:20pm
SESSION 2 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 1:20 to 4:30 pm
High Dynamic Range ImagingSession Chair: Frederic Dufaux, TelecomParisTech(France)
Building a high dynamic range video sensor with spatially non-regular optical filtering,MichaelSchöberl,Friedrich-Alexander-Univ.Erlangen-Nürnberg(Germany);AlexanderBelz,ArneNowak,Fraunhofer-InstitutfürIntegrierteSchaltungen(Germany);JürgenSeiler,AndréKaup,Friedrich-Alexander-Univ.Erlangen-Nürnberg(Germany);SiegfriedFoessel,Fraunhofer-InstitutfürIntegrierteSchaltungen(Germany) . . . . . . . . . . . . . . . . . . . [8499-11]
Video tone mapping,RonanBoitard,TechnicolorS.A.(France)andIRISA/INRIARennes(France);KadiBouatouch,RemiCozot,IRISA/INRIARennes(France);DominiqueThoreau,TechnicolorS.A.(France);AdrienGruson,IRISA/INRIARennes(France) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8499-12]
A comparative survey on high dynamic range video compression,AlperKoz,FredericDufaux,TelecomParisTech(France) . . . . . . . . . . . . . . . . . . . [8499-13]
Face detection and recognition in HDR images,NicolaAdami,SergioBenini,Univ.degliStudidiBrescia(Italy). . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8499-14]
Effect of tone mapping operators on visual attention deployment,MatthieuPerreiraDaSilva,PatrickLeCallet,RomualdPepion,Univ.deNantes(France). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8499-15]
Image and video compression for HDR content,DavidR.Bull,Univ.ofBristol(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8499-16]
A novel backward-compatible method for HDR images and videos,FrancescoBanterle,MassimilianoCorsini,RobertoScopigno,ConsiglioNazionaledelleRicerche(Italy). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8499-17]
A JPEG backward-compatible 3D and HDR image compression,TouradjEbrahimi,PavelKorshunov,EcolePolytechniqueFédéraledeLausanne(Switzerland) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8499-18]
Posters-Monday . . . . . . . . . . . . . . . . . . . . Mon. 5:30 to 7:30 pmConference attendees are invited to attend the poster session on Monday
evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
To develop a high-speed auto-alignment system by dual machine vision-based alignment system,Chun-JenChen,InstrumentTechnologyResearchCtr.(Taiwan);Wen-YuhJywe,NationalFormosaUniv.(Taiwan);Chun-LiChang,InstrumentTechnologyResearchCtr.(Taiwan);YunFengTeng,NationalFormosaUniv.(Taiwan);Min-WeiHung,InstrumentTechnologyResearchCtr.(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8499-62]
Center location of circular targets with surface fitting method,YongkaiYin,TianjinUniv.(China);MengWang,XiaoliLiu,ShenzhenUniv.(China);XiangPeng,ShenzhenUniv.(China)andTianjinUniv.(China). . . . . . . . . . . . [8499-63]
Error correction of the perspective projection of circles center with concentric circles,DongHe,ShenzhenUniv.(China);YongkaiYin,TianjinUniv.(China);XiaoliLiu,ShenzhenUniv.(China);XiangPeng,ShenzhenUniv.(China)andTianjinUniv.(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8499-64]
142 spie.org/opadvance · TEL:+13606763290 · help@spie.org
A comparison of performance of automatic cloud coverage assessment algorithm for Formosat-2 image using clustering-based and spatial thresholding methods,Kuo-HsienHsu,Shih-ChiehChou,NationalSpaceOrganization(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8499-65]
Automatic registration of range images combined with the system calibration and global ICP,XiaoliLiu,XinhuaHeD.V.M.,ZeyiLiu,DongHe,WenqiHe,XiangPeng,ShenzhenUniv.(China). . . . . . . . . . . . . . . . . . [8499-66]
Utilization of Solar Dynamics Observatory space weather digital image data for comparative analysis with application to Baryon oscillation spectroscopic survey,GeorgeTremberger,Jr.,PaulJ.Marchese,RaulArmendariz,TakD.Cheung,QueensboroughCommunityCollege(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8499-67]
Face recognition and tracking using unconstrained nonlinear composite filters,AngelJ.González-Fraga,EverardoSantiago-Ramírez,SixtoLázaro-Martínez,Univ.AutónomadeBajaCalifornia(Mexico). . . . . . . . . . . . . [8499-68]
Autonomous techniques for multispectral image analysis and classification,JuanCarlosValdiviezo-Navarro,Univ.PolitécnicadeTulancingo(Mexico);GonzaloUrcid,InstitutoNacionaldeAstrofísica,ÓpticayElectrónica(Mexico);CarinaToxqui-Quitl,AlfonsoPadilla-Vivanco,Univ.PolitécnicadeTulancingo(Mexico). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8499-69]
Multifocus image fusion using moment functions,CarinaToxqui-Quitl,AlfonsoPadilla-Vivanco,JuanCarlosValdiviezo-Navarro,CésarSantiago-Tepantlán,Univ.PolitécnicadeTulancingo(Mexico). . . . . . . . . . . . . . [8499-70]
Graphical user interface (GUIDE) for the control of two methods of recovery profiles for tridimensional objects,MarcoA.Canchola,EstelaLópez-Olazagasti,GustavoRamírez-Zavaleta,JorgeM.IbarraGalitzia,EduardoTepichin-Rodriguez,InstitutoNacionaldeAstrofísica,ÓpticayElectrónica(Mexico). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8499-71]
Study of the effect of stereoscopic TV system configuration on subjective perception of video stream,StanislavVítek,CzechTechnicalUniv.inPrague(CzechRepublic). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8499-72]
Speech emotion recognition using associative memories,JoséFranciscoSolís,JuanCarlosValdiviezo-Navarro,CarinaToxqui-Quitl,AlfonsoPadilla-Vivanco,Univ.PolitécnicadeTulancingo(Mexico). . . . . . . . . . . . . . . . [8499-73]
Sign language recognition based on wavelets and neural networks,JoséSolís,CarinaToxqui-Quitl,AlfonsoPadilla-Vivanco,CesarSantiago-Tepantlán,Univ.PolitécnicadeTulancingo(Mexico). . . . . . . . . . . . . . . . . . . . . . . [8499-74]
Wiener filtering in the process of dark current suppression,JanSvihlik,InstituteofChemicalTechnology(CzechRepublic);KarelFliegel,PetrPata,StanislavVitek,CzechTechnicalUniv.inPrague(CzechRepublic);PavelKoten,AstronomicalInstituteoftheASCR,v.v.i.(CzechRepublic). . . . . . . . . [8499-75]
A study on astigmatism of sunglasses automatic measurement system,Chun-LiChang,InstrumentTechnologyResearchCtr.(Taiwan). . . . . [8499-76]
A fast-matching algorithm based on local gradient histograms,DanielMiramontes-Jaramillo,VitalyI.Kober,Ctr.deInvestigaciónCientíficaydeEducaciónSuperiordeEnsenada(Mexico) . . . . . . . . . . . . . . . . . . . . . [8499-77]
Face recognition in real, uncontrolled environment with correlation filters,SusanaGarduño-Massieu,VitalyKober,Ctr.deInvestigaciónCientíficaydeEducaciónSuperiordeEnsenada(Mexico) . . . . . . . . . . . . . . . . . . . . . [8499-78]
Comparison of consumer stereoscopic technologies in various configuration scenarios,KarelFliegel,PetrPáta,MilosKlíma,CzechTechnicalUniv.inPrague(CzechRepublic). . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8499-79]
Reconstruction of tridimensional objects with two different textures using gaussian model,LuisDavidLara-Rodriguez,ElizabethLopez-Melendez,JorgeIbarra-Galitzia,EstelaLópez-Olazagasti,EduardoTepichin-Rodriguez,InstitutoNacionaldeAstrofísica,ÓpticayElectrónica(Mexico). . . . . . . . . . . . . [8499-80]
Recognition and threat level estimation of FOD based on image content features and experiment analysis,YuLi,GangXiao,ShanghaiJiaoTongUniv.(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8499-81]
Analysis of temporal changes in stress of plastic films subjected to deformation using similarity metrics,JuanC.Briñez,InstitutoTecnlógicoMetropolitano(Colombia);AlejandroRestrepo-Martínez,FranciscoE.López,InstitutoTecnológicoMetropolitano(Colombia). . . . . . . . . . . . . . . . . . [8499-82]
Application of real-time, single-camera SLAM technology for image-guided targeting in neurosurgery,Yau-ZenChang,Jung-FuHou,YiHsiangTsao,ChangGungUniv.(Taiwan);Shih-TsengLee,ChangGungMemorialHospital(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8499-83]
Image processing, space reduction, and clustering techniques applied to urban atmospheric visibility images,AlejandroRestrepo-Martínez,CristianGuarnizo,InstitutoTecnológicoMetropolitano(Colombia). . . . . . . . . . [8499-84]
Vessel classification in overhead satellite imagery using learned dictionaries,KatieRainey,JohnStastny,ShibinParameswaran,SpaceandNavalWarfareSystemsCtr.Pacific(UnitedStates). . . . . . . . . . . . . . . [8499-85]
Elasticity image analysis of optical-based tactile system used for early detection of breast cancer,Jong-HaLee,SamsungAdvancedInstituteofTechnology(Korea,Republicof);Chang-HeeWon,TempleUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8499-86]
Tuesday 14 AugustSESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . Tues. 8:00 to 10:00 am
Distributed Video CodingSession Chair: Peter Schelkens, VrijeUniv.Brussel(Belgium)
Side information improvement in transform-domain distributed video coding,AbdalbassirAbou-Elailah,TelecomParisTech(France);JoumanaFarah,Holy-SpiritUniv.ofKaslik(Lebanon);MarcoCagnazzo,BéatricePesquet-Popescu,FredericDufaux,TelecomParisTech(France) . . . . . . . . . . . [8499-19]
Refining WZ rate estimation in DVC with feedback channel constraints,JürgenSlowack,Univ.Gent(Belgium);NikosDeligiannis,AdrianMunteanu,VrijeUniv.Brussel(Belgium);RikVandeWalle,Univ.Gent(Belgium). . . . . [8499-20]
Adaptive distributed video coding with correlation estimation using expectation propagation,LijuanCui,TheUniv.ofOklahoma-Tulsa(UnitedStates);ShuangWang,Univ.ofCalifornia,SanDiego(UnitedStates);SamuelCheng,TheUniv.ofOklahoma-Tulsa(UnitedStates)............. [8499-21]
Exploiting the error-correcting capabilities of low-density parity check codes in distributed video coding using optical flow,LarsL.Rakêt,Univ.ofCopenhagen(Denmark);JacobSøgaard,MatteoSalmistraro,HuynhV.Luong,SørenForchhammer,TechnicalUniv.ofDenmark(Denmark) . . . . . . . [8499-22]
Feedback channel suppression in hash-based distributed video coding,FrederikVerbist,NikosDeligiannis,AdrianMunteanu,PeterSchelkens,VrijeUniv.Brussel(Belgium). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8499-23]
Stereo side information generation in low-delay distributed stereo video coding,MatteoSalmistraro,SørenForchhammer,TechnicalUniv.ofDenmark(Denmark) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8499-24]
SESSION 4 . . . . . . . . . . . . . . . . . . . . Tues. 10:30 am to 12:10 pm
HEVC: An Emerging Video Standard ISession Chairs: Gary J. Sullivan, MicrosoftCorp.(UnitedStates);
Touradj Ebrahimi, EcolePolytechniqueFédéraledeLausanne(Switzerland)
Large and various shapes block processing in HEVC,JungHyeMin,Il-KooKim,TammyLee,SAMSUNGElectronicsCo.,Ltd.(Korea,Republicof);Woo-JinHan,GachonUniv.(Korea,Republicof);JeongHoonPark,SAMSUNGElectronicsCo.,Ltd.(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . [8499-25]
Block merging for quadtree-based partitioning in HEVC,SimonOudin,PhilippHelle,DetlevMarpe,ThomasWiegand,Fraunhofer-InstitutfürNachrichtentechnikHeinrich-Hertz-Institut(Germany). . . . . . . . . . . . . [8499-26]
Transform coding techniques in HEVC,TungNguyen,PhilippHelle,MartinWinken,DetlevMarpe,HeikoSchwarz,ThomasWiegand,Fraunhofer-InstitutfürNachrichtentechnikHeinrich-Hertz-Institut(Germany). . . . . . . . . . . . . [8499-27]
High order integer transform design for high-efficiency video coding,JieDong,YanYe,InterDigital,Inc.(UnitedStates)................... [8499-28]
New fast DCT algorithms based on Loeffler’s factorization,YoonMiHong,Il-KooKim,TammyLee,Min-SuCheon,ElenaAlshina,SAMSUNGElectronicsCo.,Ltd.(Korea,Republicof);Woo-JinHan,GachonUniv.(Korea,Republicof);JeongHoonPark,SAMSUNGElectronicsCo.,Ltd.(Korea,Republicof)[8499-29]
Lunch/Exhibition Break.............................. 12:10to1:40pm
Conference 8499
spie.org/opadvance · TEL:+13606763290 · help@spie.org 143
SESSION 5 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 1:40 to 5:10 pm
HEVC: An Emerging Video Standard IISession Chairs: Gary J. Sullivan, MicrosoftCorp.(UnitedStates);
Touradj Ebrahimi, EcolePolytechniqueFédéraledeLausanne(Switzerland)
Subjective quality evaluation of the upcoming HEVC video compression standard,TouradjEbrahimi,FrancescaDeSimone,MartinRerabek,EcolePolytechniqueFédéraledeLausanne(Switzerland). . . . . . . . . . . . . . . [8499-30]
Informal subjective quality comparison of compression performance of HEVC with H.264/AVC high profile,MichaelJ.Horowitz,eBriskVideo,Inc.(Canada)andMicrosoftCorp.(UnitedStates)andUniv.ofScienceandTechnologyofChina(China);FaouziKossentini,ShilinXu,eBriskVideo,Inc.(Canada);GaryJ.Sullivan,MicrosoftCorp.(UnitedStates);BinLi,Univ.ofScienceandTechnologyofChina(China);JizhengXu,MicrosoftResearchAsia(China);NaderMahdi,HsanGuermazi,eBriskVideo,Inc.(Canada) . . [8499-31]
Study of decoder complexity for HEVC and AVC standards based on tool-by-tool comparison,Woo-JinHan,GachonUniv.(Korea,Republicof)[8499-32]
Analysis of 3D and multiview extensions of the emerging HEVC standard,AnthonyVetro,DongTian,MitsubishiElectricResearchLabs(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8499-33]
DCT-derived interpolation filter for motion compensation in HEVC,AlexanderAlshin,ElenaAlshina,SAMSUNGElectronicsCo.,Ltd.(Korea,Republicof);Woo-JinHan,GachonUniv.(Korea,Republicof);JeongHoonPark,SAMSUNGElectronicsCo.,Ltd.(Korea,Republicof) . . . . . . . . . . . . . [8499-34]
Parallel tools in HEVC for high-throughput processing,MinhuaZhou,VivienneSze,MadhukarBudagavi,TexasInstrumentsInc.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8499-35]
Techniques for increasing throughput in HEVC transform coefficient coding,JianleChen,JoelSole,Wei-JungChien,RajanL.Joshi,MartaKarczewicz,QualcommInc.(UnitedStates). . . . . . . . . . . . . . . . . . . . . [8499-36]
HEVC deblocking filtering and decisions,AndreyNorkin,KennethAndersson,EricssonAB(Sweden);ArildFuldseth,GisleBjontegaard,CiscoSystems,Inc.(Norway) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8499-37]
The adaptive loop filter in the HEVC standard,Ching-YehChen,Chia-YangTsai,MediTek,Inc.(Taiwan);Chih-MingFu,MediaTek,Inc.(Taiwan);InSukChong,MartaKarczewicz,QualcommInc.(UnitedStates);TomooYamakage,TakashiWatanabe,TakeshiChujoh,ToshibaCorp.(Japan) . . . . . . . . [8499-38]
Wednesday 15 AugustSESSION 6 . . . . . . . . . . . . . . . . . . . . . Wed. 8:30 am to 12:00 pm
Low Complexity and Highly Parallel Image CodingSession Chair: Thomas Richter, Univ.Stuttgart(Germany)
Parallel hardware architecture for JPEG-LS based on domain decomposition,SilviaAhmed,MichaelKlaiber,Univ.Stuttgart(Germany);SimeonWahl,RobertBoschGmbH(Germany);MarekWroblewski,SvenSimon,Univ.Stuttgart(Germany). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8499-39]
Towards high-speed, low-complexity image coding: variants and modification of JPEG 2000,ThomasRichter,Univ.Stuttgart(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8499-40]
GPU-specific reformulations of image compression algorithms,JiriMatela,MasarykUniv.(CzechRepublic);PetrHolub,MasarykUniv.(CzechRepublic)andCESNET(CzechRepublic);MartinJirman,MartinSrom,CESNET(CzechRepublic). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8499-41]
Optimization of the motion estimation for parallel embedded systems in the context of new video standards,OlivierDéforges,Jean-FrancoisNezan,InstitutNationaldesSciencesAppliquéesdeRennes(France);FabriceUrban,TechnicolorS.A.(France) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8499-42]
Multi-modal, low-cost mobile indoor surveillance system on the robust artificial intelligence-based defense electro robot (RAIDER),BinuM.Nair,YakovDiskin,VijayanK.Asari,Univ.ofDayton(UnitedStates). . . . . . [8499-43]
Computer aided diagnosis of cervical cancer histology,GolshahA.Naghdy,RahmaRahmadwati,MontserratRoss,Univ.ofWollongong(Australia);CatherineA.Todd,Univ.ofWollongonginDubai(UnitedArabEmirates) . . . . . . [8499-44]
Automatic and robust extrinsic camera calibration for high-accuracy mobile mapping,WernerGoeman,GrontmijBelgiumNV(Belgium);KoenDouterloigne,SidhartaGautama,Univ.Gent(Belgium) . . . . . . . . . . . . . . . . . . . . . . . [8499-45]
Adaptive noise suppression technique for dense 3D point cloud reconstruction from monocular vision,YakovDiskin,VijayanK.Asari,Univ.ofDayton(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8499-46]
Image denoising based on integer wavelet transform of 2D orientation-adaptive prediction,Li-BaoZhang,Xian-ChuanYu,BeijingNormalUniv.(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8499-47]
Lunch/Exhibition Break.............................. 12:00to1:30pm
SESSION 7 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 1:30 to 4:40 pm
Computer Vision Techniques and ApplicationsSession Chair: Yuriy A. Reznik, InterDigital,Inc.(UnitedStates)
Rotation invariant fast features for large-scale recognition,GabrielTakacs,NokiaResearchCtr.(UnitedStates);VijayR.Chandrasekhar,DavidM.Chen,SamS.Tsai,StanfordUniv.(UnitedStates);RadekGrzeszczuk,NokiaResearchCtr.(UnitedStates);BerndGirod,StanfordUniv.(UnitedStates) . . . . [8499-48]
Improved coding for image feature location information,SamS.Tsai,DavidM.Chen,VijayR.Chandasekhar,GabrielTakacs,MinaMakar,StanfordUniv.(UnitedStates);RadekGrzeszczuk,NokiaResearchCtr.(UnitedStates);BerndGirod,StanfordUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . [8499-49]
On coding of images and SIFT feature descriptors,YuriyA.Reznik,InterDigital,Inc.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8499-50]
Using scene structure for dictionary-based video compression,GeorgiosGeorgiadis,AvinashRavichandran,StefanoSoatto,Univ.ofCalifornia,LosAngeles(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8499-51]
An automated, real-time identification and monitoring system for coral reef fish,JosephWilder,Rutgers,TheStateUniv.ofNewJersey(UnitedStates);GarethJ.Russell,NewJerseyInstituteofTechnology(UnitedStates);ChetanTonde,GaneshSundar,NingHuang,LevBarinov,JigeshBaxi,JamesBibby,Rutgers,TheStateUniv.ofNewJersey(UnitedStates);EriGarcia,FelixMateo,UnionCityHighSchool(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . [8499-52]
Enhancement of optical character recognition through neighbor embedding,DavidC.Smith,NationalSecurityAgency(UnitedStates)[8499-53]
Characterization and identification of smoke plume for early forest fire detection,JohnA.Saghri,CaliforniaPolytechnicStateUniv.,SanLuisObispo(UnitedStates);JohnT.Jacobs,RaytheonCo.(UnitedStates);DanielKohler,TimothyDavenport,GeorgesMoussa,CaliforniaPolytechnicStateUniv.,SanLuisObispo(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8499-54]
Onboard pattern recognition for autonomous UAV landing,Chen-KoSung,FlorianSegor,Fraunhofer-InstitutfürOptronik,SystemtechnikundBildauswertung(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8499-55]
Thursday 16 AugustSESSION 8 . . . . . . . . . . . . . . . . . . . . . . . Thurs. 8:30 to 10:30 am
Mobile Video and ApplicationSession Chair: Vasudev Bhaskaran, QualcommInc.(UnitedStates)
Adapting video delivery based on motion triggered visual attention,HariKalva,VeliborAdzic,FloridaAtlanticUniv.(UnitedStates). . . . . . . . . . [8499-56]
Content adaptive enhancement of video images,VladimirLachine,QualcommInc.(UnitedStates);LouieLee,SiliconOptix(Canada)............. [8499-57]
Error-resilient video coding for wireless video telephony applications,RahulVanam,YuriyA.Reznik,InterDigital,Inc.(UnitedStates). . . . . . . . . . . [8499-58]
A new context-model for the pseudo-distance technique in lossless compression of color-mapped images,BasarKoc,ZiyaArnavut,SUNYFredonia(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8499-59]
A novel convergence control method for toed-in stereo camera systems,Ja-WonSeo,ChangickKim,KAIST(Korea,Republicof). . . . . . . . . . . [8499-60]
Design of rate control for wireless video telephony applications,ZhifengChen,YuriyA.Reznik,InterDigital,Inc.(UnitedStates) . . . . . . . . . . . . [8499-61]
Conference 8499
144 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Conference 8500Tuesday-Wednesday 14-15 August 2012 • Proceedings of SPIE Vol. 8500
Image Reconstruction from Incomplete Data VIIConference Chairs:Philip J. Bones, Univ.ofCanterbury(NewZealand);Michael A. Fiddy, TheUniv.ofNorthCarolinaatCharlotte(UnitedStates);Rick P. Millane, Univ.ofCanterbury(NewZealand)
Program Committee:Mark A. Anastasio, WashingtonUniv.inSt.Louis(UnitedStates);David J. Brady, DukeUniv.(UnitedStates);Emmanuel J. Candes, StanfordUniv.(UnitedStates);Julian C. Christou, GeminiObservatory(UnitedStates);Timothy J. Cornwell, CommonwealthScientificandIndustrialResearchOrganisation(Australia);Peter C. Doerschuk, CornellUniv.(UnitedStates);Veit Elser, CornellUniv.(UnitedStates);James Fienup, Univ.ofRochester(UnitedStates);Andrew J. Lambert, TheUniv.ofNewSouthWales(Australia);Julian Maclaren, StanfordUniv.(UnitedStates);Charles L. Matson, AirForceResearchLab.(UnitedStates);Sudhakar Prasad, TheUniv.ofNewMexico(UnitedStates);Markus E. Testorf, DartmouthCollege(UnitedStates);Kevin J. Webb, PurdueUniv.(UnitedStates);Jong Chul Ye, KAIST(Korea,Republicof);Chunhong Yoon, EuropeanXFELGmbH(Germany)
Sunday 12 AugustSymposium-Wide Plenary Session . . . . . . . . . . . . . . . . . . . . Sun. 6:00 to 7:25 pm6:00pm: Introduction and Opening Remarks
6:05pm: The Exciting Science of Light with Metamaterials, VladimirM.Shalaev,PurdueUniv.(USA)
6:45pm:Future of Optics and Photonics, BahaaE.A.Saleh,CREOL,TheCollegeofOpitcsandPhotonicsattheUniv.ofCentralFlorida(USA)
Tuesday 14 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . Tues. 9:00 to 10:30 am
Compressive Sensing and SamplingSession Chair: Michael A. Fiddy, TheUniv.ofNorthCarolinaat
Charlotte(UnitedStates)
Optical motion tracking to improve image quality in MRI of the brain (Invited Paper),JulianMaclaren,StanfordUniv.(UnitedStates). . . . . . . . . . . . [8500-01]
MR images from fewer data,PhilipJ.Bones,BaharehVafadar,Univ.ofCanterbury(NewZealand). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8500-02]
Phase-space analysis of sparse signals and compressive sensing,MarkusE.Testorf,DartmouthCollege(UnitedStates) . . . . . . . . . . . . . . . . . . . [8500-03]
Compressive sampling methods for superresolution imaging,Yi-ChenChuang,NanyangTechnologicalUniv.(Singapore);RichardDudley,MichaelA.Fiddy,TheUniv.ofNorthCarolinaatCharlotte(UnitedStates). . . . . . [8500-04]
SESSION 2 . . . . . . . . . . . . . . . . . . . . Tues. 11:00 am to 12:30 pm
Inverse ProblemsSession Chair: Rick P. Millane, Univ.ofCanterbury(NewZealand)
A Gibbs sampler for conductivity imaging and other inverse problems (Invited Paper),ColinFox,Univ.ofOtago(NewZealand). . . . . . . . . . . [8500-05]
Imaging from scattered fields: limited data and degrees of freedom,RichardS.Ritter,PerigonInternational,Inc.(UnitedStates);MichaelA.Fiddy,TheUniv.ofNorthCarolinaatCharlotte(UnitedStates).................... [8500-06]
Joint time-frequency analysis of EEG signals based on a phase-space interpretation of the recording process,MarkusE.Testorf,DartmouthCollege(UnitedStates);BarbaraC.JobstM.D.,JonathanK.Kleen,AliTitiz,DartmouthHitchcockMedicalCtr.(UnitedStates);SeanGuillory,DartmouthCollege(UnitedStates);RodneyScottM.D.,Dartmouth-HitchcockMedicalCtr.(UnitedStates);KrisA.BujarskiM.D.,DavidW.RobertsM.D.,GregoryL.HolmesM.D.,Pierre-PascalLenck-Santini,DartmouthHitchcockMedicalCtr.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8500-07]
Superresolved image reconstruction from incomplete data,Yi-ChenChuang,NanyangTechnologicalUniv.(Singapore);RichardDudley,MichaelA.Fiddy,TheUniv.ofNorthCarolinaatCharlotte(UnitedStates). . . . . . . . . . . . . . . [8500-08]
Lunch/Exhibition Break.............................. 12:30to2:00pm
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 2:00 to 3:20 pm
Information from Projections and MicroscopySession Chair: Philip J. Bones, Univ.ofCanterbury(NewZealand)
Tomographic imaging of living cells using digital holographic microscopy,Xin-JiLai,Yu-ChihLin,NationalTaiwanNormalUniv.(Taiwan);Han-YenTu,ChineseCultureUniv.(Taiwan);Chau-JernCheng,NationalTaiwanNormalUniv.(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8500-09]
Multi-axial CT reconstruction from few view projections,SajibSaha,MuratTahtali,AndrewJ.Lambert,MarkR.Pickering,UNSW@ADFA(Australia). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8500-10]
Using inverse fringe projection to speed up the detection of local and global geometry defects on free-form surfaces,AndreasPösch,TarasVynnyk,EduardReithmeier,LeibnizUniv.Hannover(Germany) . . . . . . . . . . . . [8500-11]
Study of optical microscanning reconstruction,Xun-JieZhao,ChengjinLi,SoochowUniv.(China) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8500-12]
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 3:50 to 5:10 pm
Phase Retrieval and DeconvolutionSession Chair: Chunhong Yoon, EuropeanXFELGmbH(Germany)
Phase problems,RickP.Millane,Univ.ofCanterbury(NewZealand) [8500-13]
Support estimation for phase retrieval image reconstruction from sparse-aperture interferometry data,ZacharyJ.DeSantis,JamesR.Fienup,Univ.ofRochester(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8500-14]
Single-image, two-layered, out-of-focus blur removal,StanleyH.Chan,HarvardUniv.(UnitedStates);TruongQ.Nguyen,Univ.ofCalifornia,SanDiego(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8500-15]
Adaptive binary material classification of an unknown object using polarimetric images degraded by atmospheric turbulence,MuJ.Kim,MiloW.HydeIV,AirForceInstituteofTechnology(UnitedStates). . . . . . . [8500-16]
Wednesday 15 AugustSESSION 5 . . . . . . . . . . . . . . . . . . . . . . . . .Wed. 9:00 to 10:30 am
Coherent Diffraction ImagingSession Chair: Timothy J. Cornwell, CommonwealthScientificand
IndustrialResearchOrganisation(Australia)
Coherent diffraction imaging using XFELs (Invited Paper),ChunhongYoon,EuropeanXFELGmbH(Germany). . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8500-17]
Effects of extraneous noise in cryptotomography: reconstructions from random, unoriented tomograms,Ne-TeD.Loh,SLACNationalAcceleratorLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8500-18]
Ptychography and quantum state tomography,PierreThibault,TechnischeUniv.München(Germany);AndreasMenzel,PaulScherrerInstitut(Switzerland) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8500-19]
Phase retrieval in nanocrystallography,JoeChen,RickP.Millane,Univ.ofCanterbury(NewZealand). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8500-20]
spie.org/opadvance · TEL:+13606763290 · help@spie.org 145
SESSION 6 . . . . . . . . . . . . . . . . . . . . Wed. 11:00 am to 12:30 pm
InterferometrySession Chair: Colin Fox, Univ.ofOtago(NewZealand)
Wide-field imaging for the square kilometre array (Invited Paper),TimothyJ.Cornwell,CommonwealthScientificandIndustrialResearchOrganisation(Australia). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8500-21]
High-dynamic range interferometric astronomical imaging in the presence of direction dependent effects,SanjayBhatnagar,NationalRadioAstronomyObservatory(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8500-22]
Radio-interferometric imaging of spatial structure that varies with time and frequency,UrvashiRau,NationalRadioAstronomyObservatory(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8500-23]
Maximum subarray algorithms for optical and radio astronomy,StephenJ.Weddell,TadaoTakaoka,TristanRead,RobinCandy,Univ.ofCanterbury(NewZealand). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8500-24]
Lunch/Exhibition Break.............................. 12:30to2:00pm
SESSION 7 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 2:00 to 3:20 pm
Compressive Sensing and ImagingSession Chair: Julian Maclaren, StanfordUniv.(UnitedStates)
Tomographic compressive holographic reconstruction of 3D phase objects,GeorgesT.Nehmetallah,LoganA.Williams,ParthaBanerjee,Univ.ofDayton(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8500-25]
Fast three-dimensional phase unwrapping,MiguelA.NavarroRodriguez,JulioC.Estrada-Rico,ManuelServin,Ctr.deInvestigacionesenÓptica,A.C.(Mexico). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8500-26]
Compress a linear system via eliminating equations,XitengLiu,YorkUniv.(Canada) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8500-27]
Image reconstruction through geometric super-resolution of indoor-target using a mask,IhtshamU.Haq,AsloobA.Mudassar,PakistanInstituteofEngineeringandAppliedSciences(Pakistan). . . . . . . . . . . . . . . . . . . . [8500-28]
SESSION 8 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 3:50 to 4:50 pm
Remote SensingSession Chair: Markus E. Testorf, DartmouthCollege(UnitedStates)
Determining wind fields in atmospheric mountain waves using sailplane flight data,NiZhang,RickP.Millane,Univ.ofCanterbury(NewZealand). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8500-29]
Kepler mission exoplanet transit data analysis using fractal imaging,GeorgeTremberger,Jr.,ToddHolden,DavidLieberman,TakD.Cheung,QueensboroughCommunityCollege(UnitedStates). . . . . . . . . . . . . . [8500-30]
A high-resolution lightfield camera with dual-mask design,ZhiminXu,EdmundY.Lam,TheUniv.ofHongKong(HongKong,China). . . . . . [8500-31]
Conference 8500
146 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Conference 8501Sunday 12 August 2012 • Proceedings of SPIE Vol. 8501
Advances in Metrology for X-Ray and EUV Optics IVConference Chairs:Lahsen Assoufid, ArgonneNationalLab.(UnitedStates);Peter Z. Takacs, BrookhavenNationalLab.(UnitedStates);Anand Krishna Asundi, NanyangTechnologicalUniv.(Singapore)
Program Committee:Andrius Baltuska, TechnischeUniv.Wien(Austria);Daniele Cocco, SLACNationalAcceleratorLab.(UnitedStates);Leslie L. Deck, ZygoCorporation(UnitedStates);Ralf D. Geckeler, Physikalisch-TechnischeBundesanstalt(Germany);Kenneth A. Goldberg, LawrenceBerkeleyNationalLab.(UnitedStates);Mikhail V. Gubarev, NASAMarshallSpaceFlightCtr.(UnitedStates);Mourad Idir, BrookhavenNationalLab.(UnitedStates);Wayne R. McKinney, LawrenceBerkeleyNationalLab.(UnitedStates);Hidekazu Mimura, TheUniv.ofTokyo(Japan);Haruhiko Ohashi, RIKEN(Japan);François A. Polack, SynchrotronSOLEIL(France);Seungyu Rah, PohangUniv.ofScienceandTechnology(Korea,Republicof);Rajdeep Singh Rawat, NationalInstituteofEducation(Singapore);Amparo Vivo Rommeveaux, EuropeanSynchrotronRadiationFacility(France);Mark D. Roper, DaresburyLab.(UnitedKingdom);Kawal J. Sawhney, DiamondLightSourceLtd.(UnitedKingdom);Ajay Kumar Saxena, IndianInstituteofAstrophysics(India);Frank Siewert, Helmholtz-ZentrumBerlinfürMaterialienundEnergieGmbH(Germany);Regina Soufli, LawrenceLivermoreNationalLab.(UnitedStates);Zhanshan Wang, TongjiUniv.(China);Kazuto Yamauchi, OsakaUniv.(Japan);Valeriy V. Yashchuk, LawrenceBerkeleyNationalLab.(UnitedStates);Brian W. Yates, CanadianLightSourceInc.(Canada)
Sunday 12 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 8:30 to 10:20 am
MeasurementsSession Chair: Lahsen Assoufid, ArgonneNationalLab.(UnitedStates)
Review of surface metrology and polishing techniques for current and future-generation EUV/x-ray optics (Invited Paper),ReginaSoufli,SherryL.Baker,EberhardA.Spiller,TomJ.McCarville,JeffreyC.Robinson,MónicaFernández-Perea,MichaelJ.Pivovaroff,LawrenceLivermoreNationalLab.(UnitedStates);EricM.Gullikson,LawrenceBerkeleyNationalLab.(UnitedStates);DennisS.Martinez-Galarce,LockheedMartinAdvancedTechnologyCtr.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8501-01]
Development of surface profile measurement method for spheroidal x-ray mirror using phase retrieval,TakahiroSaitou,YoshinoriTakei,HidekazuMimura,TheUniv.ofTokyo(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . [8501-02]
Measurement of groove density of varied line-space grating for high-resolution soft x-ray monochromator by long trace profiler,YasunoriSenba,HikaruKishimoto,TakanoriMiura,HaruhikoOhashi,ShunjiGoto,JASRISPring-8(Japan);TetsuyaIshikawa,RIKEN(Japan). . . . . . . . . . . . . . . [8501-03]
Cross comparison of surface slope and height optical metrology with a super-polished plane Si mirror,NikolayA.Artemiev,LawrenceBerkeleyNationalLab.(UnitedStates);DanieleCocco,NicholasKelez,SLACNationalAcceleratorLab.(UnitedStates);ThomasJ.McCarville,MichaelJ.Pivovaroff,LawrenceLivermoreNationalLab.(UnitedStates);DavidW.Rich,JamesL.Turner,SLACNationalAcceleratorLab.(UnitedStates);ValeriyV.Yashchuk,LawrenceBerkeleyNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . [8501-04]
Using MountainsMap (Digital Surf) surface analysis software as an analysis tool for x-ray mirror optical metrology data,AlanM.Duffy,BrianYates,CanadianLightSourceInc.(Canada). . . . . . . . . . . . . . . . . . . . . . . . . . [8501-05]
SESSION 2 . . . . . . . . . . . . . . . . . . . . . . . . Sun. 10:50 to 11:50 am
BendersSession Chair: Mikhail V. Gubarev, NASAMarshallSpaceFlightCtr.
(UnitedStates)
Optimal setting of bendable optics based on FEA calculations,NikolayA.Artemiev,DanieleLaCivita,Yi-DeChuang,WayneR.McKinney,ValeriyV.Yashchuk,LawrenceBerkeleyNationalLab.(UnitedStates). . . . . . . . [8501-06]
Methodology for optimal in situ alignment and setting of bendable optics for diffraction-limited focusing of soft x-rays,DanielJ.Merthe,KennethA.Goldberg,MartinKunz,NobumichiTamura,WayneR.McKinney,RichardS.Celestre,GregoryY.Morrison,ErikAnderson,BrianV.Smith,EdwardE.Domning,HowardPadmore,LawrenceBerkeleyNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8501-07]
Ex situ tuning of bendable x-ray mirrors for optimal beamline performance,WayneR.McKinney,ValeriyV.Yashchuk,DanielJ.Merthe,NikolayA.Artemiev,KennethA.Goldberg,LawrenceBerkeleyNationalLab.(UnitedStates)[8501-08]
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11:50amto1:30pm
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 1:30 to 2:50 pm
ProfilersSession Chair: Wayne R. McKinney, LawrenceBerkeleyNationalLab.
(UnitedStates)
Development of a high-speed nanoprofiler using normal vector tracing,TakaoKitayama,HirokiMatsumura,KojiUsuki,TakuyaKojima,JunichiUchikoshi,OsakaUniv.(Japan);YasuoHigashi,HighEnergyAcceleratorResearchOrganization(Japan);KatsuyoshiEndo,OsakaUniv.(Japan)[8501-09]
Progress of multi-beam long trace-profiler development,MikhailV.Gubarev,NASAMarshallSpaceFlightCtr.(UnitedStates);DanielJ.Merthe,LawrenceBerkeleyNationalLab.(UnitedStates);KiranmayeeKilaru,ThomasJ.Kester,NASAMarshallSpaceFlightCtr.(UnitedStates);WayneR.Mckinney,LawrenceBerkeleyNationalLab.(UnitedStates);PeterZ.Takacs,BrookhavenNationalLab.(UnitedStates);ValeriyV.Yashchuk,LawrenceBerkeleyNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8501-10]
EPICS based data acquisition for the APS slope measuring profiler,JosephSullivan,LahsenAssoufid,JunQian,PeterR.Jemian,KurtGoetze,R.Sluiter,ArgonneNationalLab.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . [8501-11]
Dynamic surface roughness profiler,BradleyT.Kimbrough,JamesMillerd,NealBrock,4DTechnologyCorp.(UnitedStates). . . . . . . . . . . . . . . . [8501-12]
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 3:20 to 4:30 pm
ScatterSession Chair: Regina Soufli, LawrenceLivermoreNationalLab.(United
States)
Photoluminescence-based detection of particle contamination on EUV reticle (Invited Paper),AnGao,FOMInstituteDIFFER(Netherlands);PedroR.Diago,LuigiScaccabarozzi,ASMLNetherlandsB.V.(Netherlands);ChrisJ.Lee,FOMInstituteDIFFER(Netherlands);VadimBanine,GEResearchASML,DeRun6501,5504DRVeldhoven(Netherlands);FredBijkerk,FOMInstituteDIFFER(Netherlands)andMESA+InstituteforNanotechnology(Netherlands) [8501-13]
Roughness characterization of EUV multilayer coatings and substrates by light scattering,MarcusTrost,FraunhoferInstituteforAppliedOpticsandPrecisionEngineering(Germany)andFriedrich-Schiller-Univ.InstituteofAppliedPhysics(Germany);SvenSchröder,TorstenFeigl,AngelaDuparré,FraunhoferInstituteforAppliedOpticsandPrecisionEngineering(Germany);AndreasTünnermann,FraunhoferInstituteforAppliedOpticsandPrecisionEngineering(Germany)andFriedrich-Schiller-Univ.InstituteofAppliedPhysics(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8501-14]
Mg/Co multilayer interface and barrier layer characterization using x-ray scattering technique,JingtaoZhu,ZhanshanWang,HaochuanLi,XiaoqiangWang,TongjiUniv.(China) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8501-15]
spie.org/opadvance · TEL:+13606763290 · help@spie.org 147
Symposium-Wide Plenary Session . . . . . . . . . . . . . . . . . . . . Sun. 6:00 to 7:25 pm6:00pm: Introduction and Opening Remarks
6:05pm: The Exciting Science of Light with Metamaterials, VladimirM.Shalaev,PurdueUniv.(USA)
6:45pm:Future of Optics and Photonics, BahaaE.A.Saleh,CREOL,TheCollegeofOpitcsandPhotonicsattheUniv.ofCentralFlorida(USA)
SESSION 5 . . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 4:30 to 5:30 pm
Calibration and Multilayers MetrologySession Chair: Jingtao Zhu, TongjiUniv.(China)
Multilayers and metrology,NathalieBouet,RaymondConley,Jr.,JuanZhou,HanfeiYan,YongS.Chu,BrookhavenNationalLab.(UnitedStates) . [8501-16]
Microroughness measurements and EUV calibration of the Solar Ultraviolet Imager multilayer coated mirrors,DennisS.Martinez-Galarce,LockheedMartinSpaceSystemsCo.(UnitedStates);ReginaSoufli,LawrenceLivermoreNationalLab.(UnitedStates);DavidL.Windt,ReflectiveX-RayOpticsLLC(UnitedStates);MarilynE.Bruner,BermarScience&TechnologyLLC(UnitedStates);EricM.Gullikson,LawrenceBerkeleyNationalLab.(UnitedStates);ShaynaS.Khatri,L-3CommunicationsTinsleyLabs.Inc.(UnitedStates);JeffreyC.Robinson,SherryL.Baker,LawrenceLivermoreNationalLab.(UnitedStates);EvanPrast,ResearchElectro-Optics(UnitedStates). . . . . . . . . . . . . . [8501-17]
Development of grating-based hard x-ray Talbot interferometry for optics and beam wavefront characterization at the Advanced Photon Source,LahsenAssoufid,S.Marathe,AlbertT.Macrander,N.Kujala,MichaelJ.Wojcik,ArgonneNationalLab.(UnitedStates);AlexanderRack,EuropeanSynchrotronRadiationFacility(France);AliKhounsary,RaluDivan,DerrickC.Mancini,ArgonneNationalLab.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . [8501-18]
Conference 8501
Books of Related InterestVisittheonsiteBookstoreororderonlinetoday:spie.org/publications
Image Acquisition and Preprocessing for Machine Vision SystemsbyP. K. SinhaVol.PM197
Signal and Image Restoration: Information-Theoretic ApproachesbyJoseph Noonan and Prabahan BasuVol.PM213
Field Guide to Probability, Random Processes, and Random Data AnalysisbyLarry C. Andrews and Ronald L. PhillipsVol.FG22
Hyperspectral Remote SensingbyMichael T. EismannVol.PM210
Field Guide to Optomechanical Design and AnalysisbyKatie Schwertz and Jim BurgeVol.FG26
148 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Conference 8502Monday 13 August 2012 • Proceedings of SPIE Vol. 8502
Advances in X-Ray/EUV Optics and Components VIIConference Chairs:Shunji Goto, JapanSynchrotronRadiationResearchInstitute(Japan);Christian Morawe, EuropeanSynchrotronRadiationFacility(France);Ali M. Khounsary, ArgonneNationalLab.(UnitedStates)
Program Committee:Lucia Alianelli, DiamondLightSourceLtd.(UnitedKingdom);Lahsen Assoufid, ArgonneNationalLab.(UnitedStates);Stefan Braun, Fraunhofer-InstitutfürWerkstoff-undStrahltechnik(Germany);Shih-Lin Chang, NationalTsingHuaUniv.(Taiwan);Raymond Conley, Jr., BrookhavenNationalLab.(UnitedStates);Sultan B. Dabagov, IstitutoNazionalediFisicaNucleare(Italy);Christian David, PaulScherrerInstitut(Switzerland);Hans M. Hertz, RoyalInstituteofTechnology(Sweden);Keiichi Hirano, KEK-HighEnergyAcceleratorResearchOrganization(Japan);Werner H. Jark, SincrotroneTriesteS.C.p.A.(Italy);Yasushi Kagoshima, Univ.ofHyogo(Japan);George A. Kyrala, LosAlamosNationalLab.(UnitedStates);Carolyn A. MacDonald, Univ.atAlbany(UnitedStates);Howard A. Padmore, LawrenceBerkeleyNationalLab.(UnitedStates);Ladislav Pina, CzechTechnicalUniv.inPrague(CzechRepublic);Yuriy Ya. Platonov, RigakuInnovativeTechnologies,Inc.(UnitedStates);Seungyu Rah, PohangUniv.ofScienceandTechnology(Korea,Republicof);Peter Revesz, CornellUniv.(UnitedStates);Wa’el Salah, SESAME(Jordan);Horst Schulte-Schrepping, DeutschesElektronen-Synchrotron(Germany);Regina Soufli, LawrenceLivermoreNationalLab.(UnitedStates);Stanislav Stoupin, ArgonneNationalLab.(UnitedStates);Joerg Wiesmann, IncoatecGmbH(Germany);Stephen W. Wilkins, CommonwealthScientificandIndustrialResearchOrganisation(Australia);Makina Yabashi, JapanSynchrotronRadiationResearchInstitute(Japan)andRIKEN(Japan);Kazuto Yamauchi, OsakaUniv.(Japan);Brian W. Yates, CanadianLightSourceInc.(Canada)
Monday 13 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . .Mon. 8:20 to 10:00 am
Multilayer OpticsSession Chairs: Christian Morawe, EuropeanSynchrotronRadiationFacility(France);Regina Soufli, LawrenceLivermoreNationalLab.
(UnitedStates)
Advanced multilayer Laue lens fabrication at NSLS-II,RaymondConley,Jr.,NathalieBouet,JuanZhou,HanfeiYan,YongS.Chu,BrookhavenNationalLab.(UnitedStates);RaluDivan,NimaJahedi,ArgonneNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8502-01]
Multilayer Laue lenses fabrication by reactive ion etching in combination with focused ion beam,NathalieBouet,RaymondConley,Jr.,BrookhavenNationalLab.(UnitedStates);RaluDivan,ArgonneNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8502-02]
Aperiodic multilayer mirrors for attosecond soft x-ray pulses,UlfKleineberg,Ludwig-Maximilians-Univ.München(Germany);AlexanderGuggenmos,MichaelHofstetter,RomanRauhut,BertNickel,Ludwig-Maximilians-UnivMünchen(Germany);EricM.Gullikson,LawrenceBerkeleyNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8502-03]
Improvement in performance of EUV and soft x-ray diffraction gratings via multilayer growth control,DmitriyL.Voronov,ErikH.Anderson,LawrenceBerkeleyNationalLab.(UnitedStates);PeterGawlitza,FraunhoferIWSDresden(Germany);EricM.Gullikson,FarhadH.Salmassi,TonyWarwick,ValeriyV.Yashchuk,HowardA.Padmore,LawrenceBerkeleyNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8502-04]
Multilayer optics for novel sources in x-ray analytics,AndreasKleine,PaulRadcliffe,JenssN.Schmidt-May,BerndHasse,JürgenGraf,JörgWiesmann,CarstenMichaelsen,IncoatecGmbH(Germany). . . . . . . . . . . . . . . . . [8502-05]
SESSION 2 . . . . . . . . . . . . . . . . . . . . . . . Mon. 10:30 to 11:30 pm
Simulations and CodesSession Chairs: Shunji Goto, JapanSynchrotronRadiationResearch
Institute(Japan);Carolyn A. MacDonald, Univ.atAlbany(UnitedStates)
Beam propagation methods in x-ray optics simulations,JacekKrzywinski,SLACNationalAcceleratorLab.(UnitedStates). . . . . . . . . . . . . . . . . . [8502-06]
Application of wave optical simulations to x-ray multilayers,MarkusOsterhoff,Georg-August-Univ.Göttingen(Germany);ChristianMorawe,EuropeanSynchrotronRadiationFacility(France) . . . . . . . . . . . . . . . . [8502-07]
Simulation of fuel sprays imaging by x-ray using polycapillary lenses,LucaMarchitto,LuigiAllocca,IstitutoMotoriCNR(Italy);SultanB.Dabagov,IstitutoNazionalediFisicaNucleare(Italy)andP.N.LebedevPhysicalInstitute(RussianFederation) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8502-08]
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11:30amto1:00pm
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 1:00 to 3:00 pm
Mirrors and MonochromatorsSession Chairs: Kazuto Yamauchi, OsakaUniv.(Japan);Ladislav Pina,
CzechTechnicalUniv.inPrague(CzechRepublic)
Diamond double-crystal monochromator at SPring-8,ShunjiGoto,JapanSynchrotronRadiationResearchInstitute(Japan). . . . . . . . . . . . . . . . [8502-09]
Parameterizing the deformation of LN 2-cooled silicon monochromator crystals with linear power density,RongHuang,DonaldH.Bilderback,CornellUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8502-10]
On the limitations of liquid nitrogen cooling of high heat load x-ray monochromators,AliKhounsary,ArgonneNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8502-11]
Novel design of large x-ray optical system for astrophysical application,LadislavPína,RenéHudec,VladimírTich?,CzechTechnicalUniv.inPrague(CzechRepublic);AdolfJ.Inneman,JiříMar?ík,VeronikaMar?íková,RigakuInnovativeTechnologiesEurope(CzechRepublic);WebsterCash,AnnF.Shipley,BenGreer,Univ.ofColoradoatBoulder(UnitedStates). . . . [8502-12]
Minimizing the mirror distortion for subarcsecond imaging in the Hi-C EUV telescope,WilliamA.Podgorski,DavidCaldwell,KennethMcCracken,MarkP.Ordway,PeterN.Cheimets,KellyKorreck,LeonGolub,Harvard-SmithsonianCtr.forAstrophysics(UnitedStates);JonathanCirtain,NASAMarshallSpaceFlightCtr.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8502-13]
Automated finishing of diamond turned dies for hard x-ray and EUV optics replication.,AnthonyT.Beaucamp,ChubuUniv.(Japan)andZeekoLtd.(UnitedKingdom);YoshiharuNamba,ChubuUniv.(Japan);RichardR.Freeman,ZeekoLtd.(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8502-14]
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 3:30 to 5:35 pm
Beamlines and InstrumentationSession Chairs: Ali Khounsary, ArgonneNationalLab.(UnitedStates);
Stanislav Stoupin, ArgonneNationalLab.(UnitedStates)
Video-based beam position monitoring at CHESS (Invited Paper),PeterRevesz,AlanPauling,ThomasKrawczyk,CornellUniv.(UnitedStates)[8502-15]
Temporal modulation of synchrotron x-rays using torsional MEMS mirrors,DonaldA.Walko,Il-WoongJung,DanielLopez,DeepkishoreMukhopadhyay,GopalK.Shenoy,JinWang,ArgonneNationalLab.(UnitedStates). . [8502-16]
Recent tests of x-ray spectrometers using polycapillary optics,SteveM.Heald,ArgonneNationalLab.(UnitedStates);GeraldT.Seidler,DevonMortensen,BrianMattern,Univ.ofWashington(UnitedStates) . . . . . [8502-17]
Enhanced angular dispersion rate in multi-crystal x-ray optics and x-ray spectrographs with resolving power beyond 10^{-8},YuriShvyd’ko,ArgonneNationalLab.(UnitedStates)................................. [8502-18]
3D x-ray fluorescence microscopy with 1.7 micron resolution using lithographically fabricated micro-channel arrays,ArthurR.Woll,DavidAgyeman-Budu,MarkPfeifer,ThomasSzebenyi,TiaPlautz,GavrielleUntracht,DarrenDale,AlexanderY.Kazimirov,DonaldH.Bilderback,CornellUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8502-19]
spie.org/opadvance · TEL:+13606763290 · help@spie.org 149
Addressable flat-panel x-ray sources for medical, security, and industrial applications,FelixJ.Rangel,MarkA.Evans,BenHollister,KristinSchmiedehausen,RadiusDiagnosticsResearch,Inc.(UnitedStates);GilTravish,Univ.ofCalifornia,LosAngeles(UnitedStates). . . . . . . . . . . . . . . . . . [8502-20]
Posters-Monday . . . . . . . . . . . . . . . . . . . . Mon. 5:30 to 7:30 pmConference attendees are invited to attend the poster session on Monday
evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
Achieving optimal flatness and surface roughness properties for novel x-ray optic structures formed by a dicing saw,MichaelWieczorek,XianrongHuang,ArgonneNationalLab.(UnitedStates);RobertH.Smith,AdvancedDicingTechnologiesLtd.(UnitedStates);KenichiIwasaki,DiscoHi-TecAmerica,Inc.(UnitedStates);SuzanneMiller,JunQian,LahsenAssoufid,ArgonneNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8502-21]
Research on the monochromatic x-ray imaging with spherically bent crystal,ShaliXiao,ChongqingUniv.(China) . . . . . . . . . . . . . . . . . . . . [8502-22]
Thermo-mechanical properties of beryllium, silicon, germanium, and diamond for high heat load X-ray optics applications,SeyyedAliHedayatMofidi,FarzadMashayek,Univ.ofIllinoisatChicago(UnitedStates);AliKhounsary,ArgonneNationalLab.(UnitedStates). . . . . . . . . . . . . . . . [8502-23]
Interface interaction in Mo/CrB2/Si multilayer x-ray mirrors,YuriyP.Pershin,KharkivPolytechnicalInstitute(Ukraine);EricM.Gullikson,LawrenceBerkeleyNationalLab.(UnitedStates);IgorA.Artyukov,P.N.LebedevPhysicalInstitute(RussianFederation);ValeriyV.Kondratenko,KharkivPolytechnicalInstitute(Ukraine);DmitriyL.Voronov,LawrenceBerkeleyNationalLab.(UnitedStates);EvgeniyN.Zubarev,VictoriyaA.Sevryukova,KharkivPolytechnicalInstitute(Ukraine);AlexanderV.Vinogradov,P.N.LebedevPhysicalInstitute(RussianFederation) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8502-24]
A soft x-ray beam-splitting multilayer optic for the NASA GEMS Bragg Reflection Polarimeter,RyanAllured,TheUniv.ofIowa(UnitedStates);MónicaFernández-Perea,ReginaSoufli,JenniferB.Alameda,MichaelJ.Pivovaroff,EricM.Gullikson,LawrenceLivermoreNationalLab.(UnitedStates);PhilipE.Kaaret,TheUniv.ofIowa(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8502-25]
Upgrade of the ARPES Beamline 10.0.1 at the Advanced Light Source,ZulfiqarAli,DavidKilcoyne,Sung-KwanMo,AlejandroAguilar,Yi-DeChuang,ZahidHussain,LawrenceBerkeleyNationalLab.(UnitedStates) . . . . [8502-26]
Zone plate system for high efficiency and resolution hard x-ray optics,DavidA.Kuyumchyan,ArmenV.Kuyumchyan,LevonA.Haroutunyan,KarapetG.Trouni,CaliforniaStateUniv.,Northridge(UnitedStates) . . . . . . . . [8502-27]
Tuesday 14 AugustWorkshop on X-Ray Mirrors . . . . . . . . Tues. 8:15 to 9:15 pm
Chair: Ali M. Khounsary,ArgonneNationalLab.(UnitedStates)
TheX-rayMirrorWorkingGroupprovidesaninformalsettingfortheinterestedengineersandscientiststomeetanddiscussissuesrelatedtothedesign,analysis,cooling,fabrication,andmetrologyofx-raymirrors.Topicsfordiscussioncanbee-mailedtotheorganizer,Dr.AliKhounsary(amk@aps.anl.gov),priortothemeeting.
Conference 8502
150 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Conference 8503Tuesday 14 August 2012 • Proceedings of SPIE Vol. 8503
Adaptive X-Ray Optics IIConference Chairs:Ali M. Khounsary, ArgonneNationalLab.(UnitedStates);Stephen L. O’Dell, NASAMarshallSpaceFlightCtr.(UnitedStates);Thomas G. Bifano, BostonUniv.(UnitedStates)andBostonMicromachinesCorp.(UnitedStates)
Conference Co-Chairs:Sergio R. Restaino, U.S.NavalResearchLab.(UnitedStates);Stuart B. Shaklan, JetPropulsionLab.(UnitedStates);Kazuto Yamauchi, OsakaUniv.(Japan)
Program Committee:Klaus Attenkofer, BrookhavenNationalLab.(UnitedStates);Kevin L. Baker, LawrenceLivermoreNationalLab.(UnitedStates);Raymond Barrett, EuropeanSynchrotronRadiationFacility(France);Daniele Cocco, SLACNationalAcceleratorLab.(UnitedStates);Michael Hart, HartScientificConsultingInternationalL.L.C.(UnitedStates);Michael A. Helmbrecht, IrisAO,Inc.(UnitedStates);Mourad Idir, BrookhavenNationalLab.(UnitedStates);Daniel Lopez, ArgonneNationalLab.(UnitedStates);Carolyn A. MacDonald, Univ.atAlbany(UnitedStates);Derrick C. Mancini, ArgonneNationalLab.(UnitedStates);Michael J. Pivovaroff, LawrenceLivermoreNationalLab.(UnitedStates);Michael C. Roggemann, MichiganTechnologicalUniv.(UnitedStates);Kawal J. Sawhney, DiamondLightSourceLtd.(UnitedKingdom);Daniel A. Schwartz, Harvard-SmithsonianCtr.forAstrophysics(UnitedStates);Riccardo Signorato, BrukerASCGmbH(Germany);Robert K. Tyson, TheUniv.ofNorthCarolinaatCharlotte(UnitedStates);Melville P. Ulmer, NorthwesternUniv.(UnitedStates);Richard Willingale, Univ.ofLeicester(UnitedKingdom)
Tuesday 14 AugustWelcome and Opening Remarks . . . . . . . Tues. 8:30 to 8:40 am
Stephen L. O’Dell,NASAMarshallSpaceFlightCtr.(UnitedStates)
SESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . Tues. 8:40 to 10:20 am
Light-Source ApplicationsSession Chairs: Ali Khounsary, ArgonneNationalLab.(UnitedStates);
Daniele Cocco, SLACNationalAcceleratorLab.(UnitedStates)
An active optics system for EUV/soft x-ray beam shaping,CristianSvetina,SincrotroneTriesteS.C.p.A.(Italy);DanieleCocco,SLACNationalAcceleratorLab.(UnitedStates);ClaudioFava,SimoneGerusina,RiccardoGobessi,NicolaMahne,LorenzoRaimondi,LucaRumiz,RudiSergo,GiovanniSostero,SincrotroneTriesteS.C.p.A.(Italy);DanieleSpiga,INAF-OsservatorioAstronomicodiBrera(Italy);MarcoZangrando,SincrotroneTriesteS.C.p.A.(Italy) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8503-01]
Development of piezoelectric adaptive mirror for hard x-ray nanofocusing,SatoshiMatsuyama,OsakaUniv.(Japan);TakashiKimura,HokkaidoUniv.(Japan);HirokiNakamori,ShoutaImai,HikaruYokoyama,JangwooKim,RyosukeFukui,OsakaUniv.(Japan);HidekazuMimura,TheUniv.ofTokyo(Japan);YasuhisaSano,OsakaUniv.(Japan);YoshikiKohmura,KenjiTamasaku,MakinaYabashi,TetsuyaIshikawa,SPring-8/RIKEN(Japan);KazutoYamauchi,OsakaUniv.(Japan) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8503-02]
Design of a grazing incidence x-ray deformable mirror using voice-coil actuators,MichaelHart,JohananL.Codona,RobertCodona,TheUniv.ofArizona(UnitedStates);S.MarkAmmons,BruceA.Macintosh,ThomasMcCarville,TommasoPardini,MichaelJ.Pivovaroff,LisaA.Poyneer,LawrenceLivermoreNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . [8503-03]
X-ray pulse manipulation using MEMS micromirrors,DeepkishoreMukhopadhyay,DonA.Walko,IlWoongJung,GopalK.Shenoy,JinWang,DanielLopez,ArgonneNationalLab.(UnitedStates). . . . . . . . . . . . . . [8503-04]
Micro-electro-mechanical systems: a new tool for adaptive x-ray optics,KlausAttenkofer,BrookhavenNationalLab.(UnitedStates);DanielO.Lopez,SteveK.Ross,StefanVogt,ArgonneNationalLab.(UnitedStates) . . [8503-05]
SESSION 2 . . . . . . . . . . . . . . . . . . . . . . . Tues. 10:50 to 11:50 am
Astronomical ApplicationsSession Chairs: Daniel A. Schwartz, Harvard-SmithsonianCtr.for
Astrophysics(UnitedStates);Michael Hart, HartScientificConsultingInternationalL.L.C.(UnitedStates)
The Gemini Planet Imager: near-IR adaptive optics with nanometer precision,BruceA.Macintosh,LawrenceLivermoreNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8503-06]
Toward active x-ray telescopes II,StephenL.O’Dell,NASAMarshallSpaceFlightCtr.(UnitedStates);CarolynAtkins,Univ.ofAlabama,Huntsville(UnitedStates);TimothyW.Button,TheUniv.ofBirmingham(UnitedKingdom);VincenzoCotroneo,WilliamN.Davis,Harvard-SmithsonianCtr.forAstrophysics(UnitedStates);PeterDoel,Univ.CollegeLondon(UnitedKingdom);CharlotteH.Feldman,Univ.ofLeicester(UnitedKingdom);MarkD.Freeman,Harvard-SmithsonianCtr.forAstrophysics(UnitedStates);MikhailV.Gubarev,NASAMarshallSpaceFlightCtr.(UnitedStates);RaeganL.Johnson-Wilke,PennsylvaniaStateUniv.(UnitedStates);JefferyJ.Kolodziejczak,NASAMarshallSpaceFlightCtr.(UnitedStates);AlanG.Michette,King’sCollegeLondon(UnitedKingdom);BrianD.Ramsey,NASAMarshallSpaceFlightCtr.(UnitedStates);PaulB.Reid,Harvard-SmithsonianCtr.forAstrophysics(UnitedStates);DanielRodriguezSanmartin,Univ.ofBrighton(UnitedKingdom);TimoT.Saha,NASAGoddardSpaceFlightCtr.(UnitedStates);DanielA.Schwartz,Harvard-SmithsonianCtr.forAstrophysics(UnitedStates);SusanE.Trolier-McKinstry,ThePennsylvaniaStateUniv.(UnitedStates);RudegerH.T.Wilke,GrinnellCollege(UnitedStates);RichardWillingale,Univ.ofLeicester(UnitedKingdom);WilliamW.Zhang,NASAGoddardSpaceFlightCtr.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8503-07]
The square meter arc-second resolution x-ray telescope: SMART-X,DanielA.Schwartz,AlexeyVikhlinin,PaulB.Reid,JayBookbinder,VincenzoCotroneo,WilliamN.Davis,MarkFreeman,WilliamR.Forman,StuartMcMuldroch,HarveyD.Tananbaum,Harvard-SmithsonianCtr.forAstrophysics(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8503-08]
Lunch/Exhibition Break........................... 11:50amto1:30pm
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 1:30 to 3:10 pm
Device DevelopmentSession Chairs: Thomas G. Bifano, BostonUniv.(UnitedStates);Kevin
L. Baker, LawrenceLivermoreNationalLab.(UnitedStates)
Adjustable grazing incidence x-ray optics based on thin PZT films,VincenzoCotroneo,WilliamN.Davis,Harvard-SmithsonianCtr.forAstrophysics(UnitedStates);RaeganL.Johnson-Wilke,ThePennsylvaniaStateUniv.(UnitedStates);VanessaMarquez,PaulB.Reid,DanielA.Schwartz,Harvard-SmithsonianCtr.forAstrophysics(UnitedStates);SusanE.Trolier-McKinstry,ThePennsylvaniaStateUniv.(UnitedStates);RudegerH.T.Wilke,GrinnellCollege(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8503-09]
PZT piezoelectric films on glass for gen-x imaging systems,RaeganJohnson-Wilke,ThePennsylvaniaStateUniv.(UnitedStates);RudegerH.T.Wilke,GrinnellCollege(UnitedStates);DanielSchwartz,VincenzoCotroneo,PaulReid,Harvard-SmithsonianCtr.forAstrophysics(UnitedStates);SusanTrolier-McKinstry,ThePennsylvaniaStateUniv.(UnitedStates). . . . . [8503-10]
Adaptive x-ray optics development at AOA-Xinetics,CharlesF.Lillie,DavidD.Pearson,JeffreyL.Cavaco,JohnA.Wellman,AOA-Xinetics,NorthropGrummanAerospaceSystems(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . [8503-11]
Applying magneto-strictive sputtered thin films to modify the shape of a x-ray telescope mirror,MelvilleP.Ulmer,BridgetBellavia,XiaoliWang,LienHoffmann,JianCao,JuliaSavoie,MichaelGraham,SemyonVaynman,NorthwesternUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . [8503-12]
Comparing theory with experimental data in studying the deformation of magnetically smart films deposited on nickel and glass substrates,XiaoliWang,JianCao,MelvilleP.Ulmer,MichaelE.Graham,SemyonVaynman,JuliaSavoie,LienHoffmann,BridgetBellavia,NorthwesternUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8503-13]
spie.org/opadvance · TEL:+13606763290 · help@spie.org 151
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 3:40 to 5:20 pm
Simulation and CharacterizationSession Chairs: Melville P. Ulmer, NorthwesternUniv.(UnitedStates);
Klaus Attenkofer, BrookhavenNationalLab.(UnitedStates)
Piezoelectric actuation of a thin Wolter-1 shell in a rigid mounting scheme,CharlotteH.Feldman,RichardWillingale,Univ.ofLeicester(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8503-14]
Simulating correction of adjustable optics for an x-ray telescope,TomAldcroft,DanielA.Schwartz,PaulReid,VincenzoCotroneo,WilliamDavis,Harvard-SmithsonianCtr.forAstrophysics(UnitedStates). . . . . . . . . [8503-15]
X-ray wavefront characterization with two-dimensional wavefront sensors: shearing interferometers and Hartmann wavefront sensors,KevinL.Baker,LawrenceLivermoreNationalLab.(UnitedStates). . . . . . . . . . . . . . . . [8503-16]
Simulating wavefront correction via deformable mirrors at x-ray beam lines,TommasoPardini,LisaA.Poyneer,LawrenceLivermoreNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8503-17]
Aliasing in a Hartmann wavefront sensor at x-ray wavelengths,LisaA.Poyneer,LawrenceLivermoreNationalLab.(UnitedStates). . . . . . . . [8503-18]
Discussion and Conclusion . . . . . . . . . . . Tues. 5:20 to 5:30 pm
Ali M. Khounsary, ArgonneNationalLab.(UnitedStates); Stephen L. O’Dell,NASAMarshallSpaceFlightCtr.(UnitedStates); Thomas G.
Bifano, BostonUniv.(UnitedStates)
Workshop on X-Ray Mirrors . . . . . . . . Tues. 8:15 to 9:15 pm
Chair: Ali M. Khounsary, ArgonneNationalLab.(UnitedStates)
TheX-rayMirrorWorkingGroupprovidesaninformalsettingfortheinterestedengineersandscientiststomeetanddiscussissuesrelatedtothedesign,analysis,cooling,fabrication,andmetrologyofx-raymirrors.Topicsfordiscussioncanbee-mailedtotheorganizer,Dr.AliKhounsary(amk@aps.anl.gov),priortothemeeting.
Conference 8503
Formation of a Digital Image: The Imaging Chain SimplifiedbyRobert D. FieteVol.PM218
Field Guide to Adaptive Optics, Second EditionbyRobert K. Tyson and Benjamin W. FrazierVol.FG24
Books of Related InterestVisittheonsiteBookstoreororderonlinetoday:spie.org/publications
Field Guide to Image ProcessingbyKhan M. Iftekharuddin and Abdul A. AwwalVol.FG25
Field Guide to RadiometrybyBarbara G. GrantVol.FG23
152 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Conference 8504 · NEWMonday-Thursday 13-16 August 2012 • Proceedings of SPIE Vol. 8504
X-Ray Free-Electron Lasers: Beam Diagnostics, Beamline Instrumentation, and ApplicationsConference Chairs:Stefan P. Hau-Riege, LawrenceLivermoreNationalLab.(UnitedStates);Stefan P. Moeller, SLACNationalAcceleratorLab.(UnitedStates);Makina Yabashi, SPring-8/RIKEN(Japan)
Program Committee:Henry N. Chapman, DeutschesElektronen-Synchrotron(Germany);Christian David, PaulScherrerInstitut(Switzerland);Alan R. Fry, SLACNationalAcceleratorLab.(UnitedStates);Gerhard Gruebel, DeutschesElektronen-Synchrotron(Germany);Nina Rohringer, Max-Planck-ArbeitsgruppenfürstrukturelleMolekularbiologie(Germany);Harald Sinn, EuropeanXFELGmbH(Germany);Kai Tiedtke, DeutschesElektronen-Synchrotron(Germany);Niels van Bakel, Nationaalinstituutvoorsubatomairefysica(Netherlands)
Monday 13 AugustPosters-Monday . . . . . . . . . . . . . . . . . . . . Mon. 5:30 to 7:30 pm
Conference attendees are invited to attend the poster session on Monday evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
Ultra-thin Bragg crystals for LCLS beam-sharing operation,YipingFeng,DilingZhu,DavidM.Fritz,AymericRobert,HenrikT.Lemke,JanM.Feldkamp,StefanP.Moeller,JeromeB.Hastings,SLACNationalAcceleratorLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8504-31]
Following dissociating N2 molecules by probing them with femtosecond-range XFEL pulses,LiFang,TimurOsipov,BrendanMurphy,WesternMichiganUniv.(UnitedStates);EdwinKukk,Univ.ofTurku(Finland);NoraBerrah,WesternMichiganUniv.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8504-32]
Initial evaluation of the European XFEL undulator commissioning spectrometer with a single channel-cut crystal,WolfgangFreund,CigdemOzkan,JensBuck,JanGruenert,EuropeanXFELGmbH(Germany);JensRehanek,FranzSchaefers,AlexeiErko,Helmholtz-ZentrumBerlinfürMaterialienundEnergieGmbH(Germany);SergueiMolodtsov,EuropeanXFELGmbH(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8504-33]
Hard x-ray delay line for x-ray photon correlation spectroscopy and jitter-free pump-probe experiments at LCLS,WojciechRoseker,DeutschesElektronen-Synchrotron(Germany);SooheyongLee,SLACNationalAcceleratorLab.(UnitedStates);HermannFranz,HorstSchulte-Schrepping,MichaelWalther,DeutschesElektronen-Synchrotron(Germany);RobertAymeric,SLACNationalAcceleratorLab.(UnitedStates);GerhardGrübel,DeutschesElektronen-Synchrotron(Germany). . . . . . . . . . . . . . . . . . . . . . . . . . . . [8504-34]
Spatial properties of LCLS beam: experimental results vs. theoretical predictions,JacekKrzywinski,YuantaoDing,JuhaoWu,YipingFeng,SebastienBoutet,DavidM.Fritz,SLACNationalAcceleratorLab.(UnitedStates);StefanP.Hau-Riege,LawrenceLivermoreNationalLab.(UnitedStates);HenrikT.Lemke,MarcMesserschmidt,JamesL.Turner,GarthJ.Williams,SLACNationalAcceleratorLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8504-35]
Tuesday 14 AugustWorkshop on X-Ray Mirrors . . . . . . . . Tues. 8:15 to 9:15 pm
Chair: Ali M. Khounsary, ArgonneNationalLab.(UnitedStates)
TheX-rayMirrorWorkingGroupprovidesaninformalsettingfortheinterestedengineersandscientiststomeetanddiscussissuesrelatedtothedesign,analysis,cooling,fabrication,andmetrologyofx-raymirrors.Topicsfordiscussioncanbee-mailedtotheorganizer,Dr.AliKhounsary(amk@aps.anl.gov),priortothemeeting.
Wednesday 15 AugustWelcome and Opening Remarks . . . . . . . .Wed. 8:20 to 8:30 am
Stefan P. Moeller,SLACNationalAcceleratorLab.(UnitedStates)
SESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . .Wed. 8:30 to 10:20 am
Diagnostics IStatus and future of SACLA (Invited Paper),MakinaYabashi,SPring-8/RIKEN(Japan);KensukeTono,TadashiTogashi,JapanSynchrotronRadiationResearchInstitute(Japan);YuichiInubushi,TakahiroSato,SPring-8/RIKEN(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8504-01]
The photon beam transport and diagnostics system at FERMI@Elettra - the Italian seeded FEL source: commissioning experience and most recent results,MarcoZangrando,SincrotroneTriesteS.C.p.A.(Italy)andIOM-CNRLaobratorioTASC(Italy);AlessandroAbrami,SincrotroneTriesteS.C.p.A.(Italy);DanieleCocco,SLACNationalAcceleratorLab.(UnitedStates);ClaudioFava,SimoneGerusina,RiccardoGobessi,SincrotroneTriesteS.C.p.A.(Italy);NicolaMahne,Lab.NazionaleTASC(Italy);EricMazzucco,SincrotroneTriesteS.C.p.A.(Italy);LorenzoRaimondi,INAF-OsservatorioAstronomicodiBrera(Italy);LucaRumiz,CristianSvetina,SincrotroneTriesteS.C.p.A.(Italy). . . . . . . . . [8504-02]
X-ray imaging and imaging spectroscopy of fusion plasmas and light-source experiments with spherical optics and pixel array detectors,KennethW.Hill,ManfredL.Bitter,LuisF.Delgado-Aparicio,NovimirA.Pablant,PrincetonPlasmaPhysicsLab.(UnitedStates);PeterBeiersdorfer,LawrenceLivermoreNationalLab.(UnitedStates);ManuelSanchezdelRio,EuropeanSynchrotronRadiationFacility(France);LingZhang,HefeiInstitutesofPhysicalScience(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8504-03]
Profiling structured beams using injected aerosols,Ne-TeD.Loh,ChristinaY.Hampton,SLACNationalAcceleratorLab.(UnitedStates);AndrewV.Martin,DeutschesElektronen-Synchrotron(Germany);DmitriStarodub,RaymondG.Sierra,SLACNationalAcceleratorLab.(UnitedStates);AntonBarty,DeutschesElektronen-Synchrotron(Germany);AndrewAquila,JoachimSchulz,EuropeanXFELGmbH(Germany);LukasLomb,JanSteinbrener,RobertL.Shoeman,StephanKassemeyer,Max-Planck-InstitutfürmedizinischeForschung(Germany);ChristophBostedt,SLACNationalAcceleratorLab.(UnitedStates);JohnBozek,SLACNationalAcceleratorLab.(Germany);SaschaW.Epp,BenjaminErk,Max-Planck-ArbeitsgruppenfürstrukturelleMolekularbiologie(Germany);RobertHartmann,PNSensorGmbH(Germany);DanielRolles,ArtemRudenko,BenediktRudek,LutzFoucar,Max-Planck-ArbeitsgruppenfürstrukturelleMolekularbiologie(Germany);NilsJ.Kimmel,GeorgWeidenspointner,GüntherHauser,Max-Planck-InstitutHalbleiterlabor(Germany);PeterHoll,PNSensorGmbH(Germany);EmanuelePedersoli,SincrotroneTriesteS.C.p.A.(Italy);MengNingLiang,DeutschesElektronen-Synchrotron(Germany);MarkHunter,LawrenceLivermoreNationalLab.(UnitedStates);LarsGumprecht,DeutschesElektronen-Synchrotron(Germany);NicolaCoppola,EuropeanXFELGmbH(Germany);CorneliaB.Wunderer,HeinzGraafsman,DESY(Germany);FilipeR.N.C.Maia,LawrenceBerkeleyNationalLab.(UnitedStates);TomasEkeberg,MaxHantke,UppsalaUniv.(Sweden);HolgerFleckenstein,Deutsch. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8504-04]
Development of x-ray spectrometers at SACLA,YuichiInubushi,SPring-8/RIKEN(Japan);KensukeTono,TadashiTogashi,JapanSynchrotronRadiationResearchInstitute(Japan);TakahiroSato,MakinaYabashi,SPring-8/RIKEN(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8504-05]
SESSION 2 . . . . . . . . . . . . . . . . . . . . Wed. 10:50 am to 12:00 pm
Optics IAn x-ray split- and delay-unit for the European XFEL (Invited Paper),SebastianRoling,S.Eppenhoff,B.Siemer,F.Wahlert,M.Wöstmann,HelmutZacharias,WestfälischeWilhelms-Univ.Münster(Germany). . . . . . . . [8504-06]
Diamond crystal optics for synchrotrons and XFELs,YuriShvyd’ko,ArgonneNationalLab.(UnitedStates)................................. [8504-07]
Mirror-based soft x-ray split-and-delay system for femtosecond pump-probe experiments at LCLS,BrendanMurphy,WesternMichiganUniv.(UnitedStates)andSLACNationalAcceleratorLaboratory(UnitedStates);JohnBozek,Jean-CharlesCastagna,SLACNationalAcceleratorLab.(UnitedStates);NoraBerrah,WesternMichiganUniv.(UnitedStates). . . . . . . . . . . . . . . . . . [8504-08]
Lunch/Exhibition Break.............................. 12:00to1:40pm
spie.org/opadvance · TEL:+13606763290 · help@spie.org 153
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 1:40 to 3:00 pm
DetectorsSoft x-ray detectors for FELs,PeterDenes,LawrenceBerkeleyNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8504-09]
pnCCDs and DSSC active pixel sensors as high-speed imagers for x-ray and electron imaging and spectroscopy in x-ray FEL experiments,LotharStrüder,Max-Planck-InstitutHalbleiterlabor(Germany). . . . . . . . . . . . [8504-10]
The CSpad megapixel x-ray camera at LCLS,PhilipHart,GuntherHaller,RyanHerbst,SvenHerrmann,ChrisJ.Kenney,JackPines,GarthJ.Williams,SLACNationalAcceleratorLab.(UnitedStates);JohnMorse,EuropeanSynchrotronRadiationFacility(France);SolM.Gruner,HughT.Philipp,MarkW.Tate,MarianneHromalik,CornellUniv.(UnitedStates). . . . . . . . . . . . . . . . . [8504-11]
Bunch by bunch beam monitoring in 3rd- and 4th-generation synchrotrons by means of single crystal diamond detectors and quantum well devices,MatiasAntonelli,MicheleDiFraia,Univ.degliStudidiTrieste(Italy);AlexandreTallaire,JocelynAchard,Univ.Paris13(France);SergioCarrato,Univ.degliStudidiTrieste(Italy);RalfH.Menk,GiuseppeCautero,DarioGiuressi,WernerH.Jark,SincrotroneTriesteS.C.p.A.(Italy);GiorgioBiasiol,Lab.NazionaleTASC(Italy);KevinOliver,DiamondDetectors,Ltd.(UnitedKingdom);AntonioDeSio,EmanuelePace,Univ.degliStudidiFirenze(Italy). . . . . . . . . . . . . . . . [8504-12]
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 3:30 to 5:10 pm
ApplicationsUltrafast magnetic domain dynamics studied by magnetic resonant scattering at X-FEL sources,ChristineBoeglin,VictorLopez-Flores,InstitutdePhysiqueetChimiedesMatériauxdeStrasbourg(France);StefanSchaffert,TechnischeUniv.Berlin(Germany). . . . . . . . . . . . . . . . . . . . . . . . . . . . [8504-13]
High-resolution imaging of shock waves in matter,AndreasSchropp,SLACNationalAcceleratorLab.(UnitedStates);ChristianG.Schroer,JensPatommel,FrankSeiboth,RobertHoppe,TechnischeUniv.Dresden(Germany);RichardW.Lee,SLACNationalAcceleratorLab.(Germany);HaeJaLee,BobNagler,JanM.Feldkamp,JeromeB.Hastings,SLACNationalAcceleratorLab.(UnitedStates);DamienG.Hicks,LawrenceLivermoreNationalLab.(UnitedStates). [8504-14]
Ultrafast magnetic domain dynamics studied by magnetic resonant scattering at X-FEL sources,VictorLopez-Flores,InstitutdePhysiqueetChimiedesMatériauxdeStrasbourg(France);StefanSchaffert,TechnischeUniv.Berlin(Germany);NicolasJaouen,SynchrotronSOLEIL(France);TianhanWang,SLACNationalAcceleratorLab.(UnitedStates);JanGeihulfe,TechnischeUniv.Berlin(Germany);CatherineGraves,BennyWu,SLACNationalAcceleratorLab.(UnitedStates);FaustoSirotti,MaurizioSacchi,SynchrotronSOLEIL(France);ChristianGunther,MichaelSchneider,TechnischeUniv.Berlin(Germany);FranckFortuna,Ctr.NationaldelaRechercheScientifique(France);RichardMattana,V.Cross,UnitéMixtedePhysiqueCNRS/Thales(France);EricBeaurepaire,InstitutdePhysiqueetChimiedesMatériauxdeStrasbourg(France);MarcMesserschmidt,LinacCoherentLightSource(UnitedStates);JoshuaJ.Turner,WilliamF.Schlotter,OlegKrupin,AndreasScherz,SLACNationalAcceleratorLab.(UnitedStates);JanLuning,Univ.PierreetMarieCurie(France);StefanEisebitt,TechnischeUniv.Berlin(Germany);ChristineBoeglin,InstitutedePhysiqueetChimiedesMatériauxdeStrasbourg(France)[8504-15]
Resonant soft x-ray scattering endstation for time-resolved pump-probe measurements at LCLS,Yi-DeChuang,DionisioDoering,NordAndresen,KenP.Chow,DevisContarato,CurtisL.Cummings,EdwardE.Domning,JohnM.Joseph,JohnPepper,BrianV.Smith,GeorgeZizka,LawrenceBerkeleyNationalLab.(UnitedStates);ChristopherFord,MattWeaver,Wei-ShengLee,SLACNationalAcceleratorLab.(UnitedStates);LucPatthey,PaulScherrerInstitut(Switzerland);JohnWeizeowick,ArgonneNationalLab.(UnitedStates);PeterDenes,ZahidHussain,LawrenceBerkeleyNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8504-16]
Modeling XFEL induced ionization and atomic displacement in protein nanocrystals,CarlCaleman,DeutschesElektronen-Synchrotron(Germany);NicusorTimneanu,UppsalaUniv.(Sweden);AndrewAquila,EuropeanXFELGmbH(Germany);AntonBarty,AndrewV.Martin,ThomasA.White,DeutschesElektronen-Synchrotron(Germany);HenryN.Chapman,DeutschesElektronen-Synchrotron(Germany)andUniv.Hamburg(Germany). . . . . . . . . . . . [8504-17]
Thursday 16 AugustSESSION 5 . . . . . . . . . . . . . . . . . . . . . . . Thurs. 8:00 to 10:30 am
LasersSimultaneous measurement of pulse profile and arrival-time at free-electron lasers (Invited Paper),AdrianL.Cavalieri,MPSD/UHH/CFEL(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8504-18]
Ultrafast x-ray experiments using terahertz excitation (Invited Paper),MatthiasC.Hoffmann,SLACNationalAcceleratorLab.(UnitedStates)[8504-19]
Pump-probe laser development for the European X-Ray Free-Electron Laser facility (Invited Paper),MaxJ.Lederer,MikhailPergament,MartinKellert,EuropeanXFELGmbH(Germany);CruzMendez,Univ.deSalamanca(Spain)andEuropeanXFELFacilityGmbH(Germany). . . . . . . . . . . . . . . . . . . [8504-20]
Spectral encoding based measurement of x-ray/optical relative delay to ~10 fs RMS,MinaR.Bionta,SLACNationalAcceleratorLab.(UnitedStates);DougFrench,SLACNationalAcceleratorLab.(UnitedStates)andThePennsylvaniaStateUniv.(UnitedStates);JamesP.Cryan,JamesM.Glownia,SLACNationalAcceleratorLab.(UnitedStates)andStanfordUniv.(UnitedStates)andThePULSEInstituteforUltrafastEnergyScience(UnitedStates);NickHartmann,ChristophBostedt,SLACNationalAcceleratorLab.(UnitedStates);MarcoCammarrata,Univ.deRennes1(France);MattieuChollet,YuntaoDing,DavidM.Fritz,SLACNationalAcceleratorLab.(UnitedStates);SteveM.Durvin,PurdueUniv.(UnitedStates);YipingFeng,SLACNationalAcceleratorLab.(UnitedStates);MarionHarmand,DeutschesElektronen-Synchrotron(Germany);AlanR.Fry,SLACNationalAcceleratorLab.(UnitedStates);DanielJ.Kane,MesaPhotonics,LLC(UnitedStates);JacekKrzywinski,HenrikT.Lemke,MarcMesserschmidt,AdiNatan,DanielF.Ratner,SebastianSchorb,SLACNationalAcceleratorLab.(UnitedStates);SvenToleikis,DeutschesElektronen-Synchrotron(Germany);MarianoTrigo,DilingZhu,WilliamE.White,RyanN.Coffee,SLACNationalAcceleratorLab.(UnitedStates) . . . . . . . . . . . [8504-21]
On some techniques for improvement of pump-probe experiment accuracy at seeded FEL facilities,MiltchoB.Danailov,PaoloCinquegrana,AlexanderA.Demidovich,RosenIvanov,IvayloNikolov,PaoloSigalotti,SincrotroneTriesteS.C.p.A.(Italy). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8504-22]
Applying field mapping refractive beam shapers to improve irradiation of photocathode of FEL,AlexanderV.Laskin,VadimLaskin,AdlOpticaOpticalSystemsGmbH(Germany). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8504-23]
SESSION 6 . . . . . . . . . . . . . . . . . . . Thurs. 11:00 am to 12:10 pm
Optics IIDiffractive optics for hard X-FEL radiation (Invited Paper),ChristianDavid,SimonRutishauser,SergeyGorelick,VitaliyA.Guzenko,OliverBunk,PaulScherrerInstitut(Switzerland);JanGrünert,LiubovSamoylova,HaraldSinn,EuropeanXFELGmbH(Germany);JacekKrzywinski,MarcoCammarata,DavidM.Fritz,SLACNationalAcceleratorLab.(UnitedStates). . . . . . . . . . . [8504-24]
Nanofocusing optics for hard x-ray free electron laser,KazutoYamauchi,OsakaUniv.(Japan) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8504-25]
Multidimensional trapping of hard x-ray photons in crystalline resonator under conditions of grazing-angle incidence x-ray backscattering diffraction,HakobP.Bezirganyan,X-ROM,Inc.(UnitedStates)andVGroup,Inc.(UnitedStates);SiranushE.Bezirganyan,RobertH.Bezirganyan,Jr.,BellevueCommunityCollege(UnitedStates). . . . . . . . . . . . . . . . . . . . [8504-26]
Lunch/Exhibition Break.............................. 12:10to1:40pm
SESSION 7 . . . . . . . . . . . . . . . . . . . . . . . . Thurs. 1:40 to 3:00 pm
Diagnostics IIX-ray photon diagnostics devices for the European XFEL,JanGruenert,JensBuck,CigdemOzkan,WolfgangFreund,BinLi,SergueiMolodtsov,EuropeanXFELGmbH(Germany). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8504-27]
A hard x-ray single-shot spectrometer for free-electron lasers,YipingFeng,DilingZhu,DavidM.Fritz,JanM.Feldkamp,HenrikT.Lemke,JeromeB.Hastings,AymericRobert,JamesL.Turner,SLACNationalAcceleratorLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8504-28]
Statistical analysis of the spectral properties of hard x-ray LCLS FEL,JacekKrzywinski,AlbertoLutman,YipingFeng,DilingZhu,YuantaoDing,DavidM.Fritz,JanM.Feldkamp,JeromeB.Hastings,ZhirongHuang,HenrikT.Lemke,JuhaoWu,SLACNationalAcceleratorLab.(UnitedStates). . . . . . . . . [8504-29]
Time-of-flight photoemission spectroscopy from rare gases for non-invasive pulse-to-pulse x-ray photon diagnostics at XFEL EU,JensBuck,EuropeanXFELGmbH(Germany);JensViefhaus,DeutschesElektronen-Synchrotron(Germany);JanGruenert,EuropeanXFELGmbH(Germany);LeifGlaser,FrankScholz,MarkusIlchen,PeterWalter,SaschaDeinert,JoernSeltmann,DeutschesElektronen-Synchrotron(Germany);CigdemOzkan,WolfgangFreund,SergueiMolodtsov,EuropeanXFELGmbH(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8504-30]
Conference 8504
154 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Conference 8505 · NEWTuesday 14 August 2012 • Proceedings of SPIE Vol. 8505
Target Diagnostics Physics and Engineering for Inertial Confinement FusionConference Chairs:Perry Bell, LawrenceLivermoreNationalLab.(UnitedStates);Gary P. Grim, LosAlamosNationalLab.(UnitedStates)
Program Committee:W. Jack Armstrong, Univ.ofRochester(UnitedStates);David K. Bradley, LawrenceLivermoreNationalLab.(UnitedStates);John Dzenitis, LawrenceLivermoreNationalLab.(UnitedStates);Frank Merrill, LosAlamosNationalLab.(UnitedStates);John A. Oertel, LosAlamosNationalLab.(UnitedStates);T. Craig Sangster, Univ.ofRochester(UnitedStates)
Tuesday 14 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . Tues. 8:00 to 10:20 am
Diagnostic SystemsSession Chair: Perry M. Bell, LawrenceLivermoreNationalLab.(United
States)
Optical picosecond MCPI-based imagers,RobertA.Buckles,RobertL.Guyton,PatrickW.Ross,NationalSecurityTechnologies,LLC(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8505-01]
Time-resolved hard x-ray spectroscopy using FFLEX (filter fluorescer) at NIF,GregA.LaCaille,LawrenceLivermoreNationalLab.(UnitedStates)andNationalSecurityTechnologies,LLC(UnitedStates);EdwardDewald,LawrenceLivermoreNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . [8505-02]
A compact UV timing fiducial system for use with x-ray streak cameras at the NIF,DougC.Homoelle,DonaldBrowning,LawrencePelz,GaylenErbert,ScottBurns,JamesHaley,ErnestoPadilla,MarkW.Bowers,ThomasSpinka,NathanPalmer,NanWong,ThomasMcCarville,BradGolick,LawrenceLivermoreNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . [8505-03]
Measuring x-ray burn history with the Streaked Polar Instrumentation for Diagnosing Energetic Radiation (SPIDER) in the National Ignition Facility (NIF),JohnR.Celeste,LawrenceLivermoreNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8505-04]
Performance improvements of PCDs for measuring x-ray bang time,JosephKimbrough,AndrewMacPhee,PerryBell,LawrenceLivermoreNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8505-05]
Mach-Zehnder modulator performance using the Comet laser facility and implications for use on NIF,BartBeeman,LawrenceLivermoreNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8505-06]
Calibrating NIF x-ray diagnostics and their components at the higher x-ray spectral energies: 8 keV to 115 keV,MichaelJ.Haugh,JoshuaJ.Lee,MichaelCharest,EdwardRomano,PeterTorres,NationalSecurityTechnologies,LLC(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8505-07]
SESSION 2 . . . . . . . . . . . . . . . . . . . . Tues. 10:50 am to 12:00 pm
Diagnostic Alignment SystemsSession Chair: John Dzenitis, LawrenceLivermoreNationalLab.
(UnitedStates)
An overview of target and diagnostic alignment at NIF (Invited Paper),DanKalantar,LawrenceLivermoreNationalLab.(UnitedStates). . . . . . . . [8505-08]
Alignment of an x-ray imager line of sight in the National Ignition Facility (NIF) target chamber using a Diagnostic Instrument Manipulator (DIM) and Opposed Port Alignment System (OPAS),NickShingleton,DanKalantar,RegWood,TomMcCarville,JeffKlingmann,AnastaciaManuel,LawrenceLivermoreNationalLab.(UnitedStates)................................. [8505-09]
Beam and target alignment at the National Ignition Facility using the Target Alignment Sensor (TAS),PascaleDiNicola,DanielH.Kalantar,ThomasJ.Mccarville,JeffL.Klingmann,SharonS.Alvarez,PamM.Danforth,LawrenceLivermoreNationalLab.(UnitedStates);PhilipS.Datte,LawrenceBerkeleyNationalLab.(UnitedStates);Jean-MichelG.DiNicola,JohnL.Jackson,JaniceK.Lawson,RogerR.Lowe-Webb,StacieM.Manuel,MarilynB.Schneider,RussellJ.Wallace,LawrenceLivermoreNationalLab.(UnitedStates) [8505-10]
Lunch/Exhibition Break.............................. 12:00to1:30pm
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 1:30 to 2:50 pm
Sensor DevelopmentSession Chair: John Dzenitis, LawrenceLivermoreNationalLab.
(UnitedStates)
Testing of CMOS devices in NIF’s harsh neutron environment,AlanT.Teruya,PerryM.Bell,JamesD.Moody,LawrenceLivermoreNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8505-11]
Design and testing of a mega pixel CMOS charge dump and read camera,JosephKimbrough,PerryBell,JamesMoody,LawrenceLivermoreNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8505-12]
Performance of CID camera x-ray imagers at NIF in a harsh neutron environment,NathanE.Palmer,MarilynB.Schneider,LawrenceLivermoreNationalLab.(UnitedStates);MichaelJ.Haugh,NationalSecurityTechnologies,LLC(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8505-13]
Performance of a 512 x 512 gated CMOS imager with a 250 ps exposure time,AlanTeruya,StephenP.Vernon,JamesD.Moody,LawrenceLivermoreNationalLab.(UnitedStates);ChristopherG.Brown,AndrewS.Mead,PeterTorres,NationalSecurityTechnologies,LLC(UnitedStates). . . . . . . . [8505-14]
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 3:20 to 6:00 pm
Diagnostic Imaging SystemsSession Chair: Gary P. Grim, LosAlamosNationalLab.(UnitedStates)
Versatile hard x-ray high-resolution microscopes designed for ICF research,DavidDennetiere,EcolePolytechnique(France);PhilippeTroussel,Commissariatàl’ÉnergieAtomique(France);PeterHoghoj,SébastienHedacq,Xenocs(France);PatrickAudebert,EcolePolytechnique(France). . . . [8505-15]
DIXI (Dilation X-ray Imager) performance measurements using the Comet laser facility,SabrinaR.Nagel,PerryM.Bell,DavidK.Bradley,MariaA.Barrios,JamesA.Emig,JamesR.Hunter,GilbertW.Collins,LawrenceLivermoreNationalLab.(UnitedStates);TeranceJ.Hilsabeck,JosephD.Kilkenny,T.Chung,BrianS.Sammuli,GeneralAtomics(UnitedStates);JonathanD.Hares,TonyK.L.Dymoke-Bradshaw,KentechInstrumentsLtd.(UnitedKingdom). . . .[8505-16]
Measurement of cathode luminescence efficiency of phosphors for micro-channel plate based x-ray framing camera,NobuhikoIzumi,JamesEmig,C.Middeleton,JamesMoody,JoeHolder,StevenGlenn,DavidK.Bradley,PerryM.Bell,LawrenceLivermoreNationalLab.(UnitedStates). . . . . . . . . [8505-17]
Design and implementation of high magnification framing camera for NIF “ARIANE Light”,MarionJ.Ayers,LawrenceLivermoreNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8505-18]
A new gated x-ray detector for the Orion laser facility,JohnA.Oertel,DavidClark,TomArchuleta,RobertAragonez,ValerieFatherley,AlbertHsu,JustinJorgenson,DanielleMares,LosAlamosNationalLab.(UnitedStates) [8505-19]
Soft x-ray backlighting of direct-drive implosions using a spherical crystal imager,C.Mileham,ChristianStoeckl,J.A.Delletrez,G.Fiksel,D.Guy,R.Junquist,P.M.Nilson,T.CraigSangster,MiltonJ.ShoupIII,W.Theobald,Univ.ofRochester(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8505-20]
A new multiple monochromatic x-ray 2D imager for NIF,GeorgeA.Kyrala,MarkJ.Schmitt,ScottHsu,IanTrigillis,DrewMartinson,ThomasMurphy,FrankLopez,GeorgeSandoval,RahulShah,PaulPolk,LosAlamosNationalLab.(UnitedStates);MikeRichardson,JeffreyKoch,LawrenceLivermoreNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8505-21]
spie.org/opadvance · TEL:+13606763290 · help@spie.org 155
Performance of the Neutron Imaging Camera System at NIF,CarlH.Wilde,ChrisR.Danly,ValerieFatherley,GaryP.Grim,NevzatGuler,FrankMerrill,GeorgeL.Morgan,JohnA.Oertel,PetrL.Volegov,DouglasC.Wilson,LosAlamosNationalLab.(UnitedStates);DanE.Bower,OwenB.Drury,DavidN.Fittinghoff,PaulWeiss,LawrenceLivermoreNationalLab.(UnitedStates);RobertA.Buckles,JeraldR.Cradick,AlbertJ.Traille,NationalSecurityTechnologies,LLC(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . [8505-22]
Workshop on X-Ray Mirrors . . . . . . . . Tues. 8:15 to 9:15 pm
Chair: Ali M. Khounsary, ArgonneNationalLab.(UnitedStates)
TheX-rayMirrorWorkingGroupprovidesaninformalsettingfortheinterestedengineersandscientiststomeetanddiscussissuesrelatedtothedesign,analysis,cooling,fabrication,andmetrologyofx-raymirrors.Topicsfordiscussioncanbee-mailedtotheorganizer,Dr.AliKhounsary(amk@aps.anl.gov),priortothemeeting.
Conference 8505
TuneintotheopticsandphotonicscommunityViewmorethan200videosfromSPIEincludingrelevanttechnicalinterviews,features,presentations,andSPIEconferencecoverage.
spie.org/spietv
Applying photonics to Infrared,ISR,Optics,Lasers,Sensors,HomelandSecurity,Robotics,UAVsystems,andOptoelectronics
156 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Conference 8506Monday-Wednesday 13-15 August 2012 • Proceedings of SPIE Vol. 8506
Developments in X-Ray Tomography VIIIConference Chair:Stuart R. Stock, NorthwesternUniv.(UnitedStates)
Program Committee:Felix Beckmann, Helmholtz-ZentrumGeesthacht(Germany);Graham R. Davis, QueenMary,Univ.ofLondon(UnitedKingdom);Atsushi Momose, TheUniv.ofTokyo(Japan);Bert Müller, Univ.Basel(Switzerland);Andrew G. Peele, AustralianSynchrotron(Australia)andLaTrobeUniv.(Australia);Erik Leo Ritman, MayoClinic(UnitedStates);Mark L. Rivers, TheUniv.ofChicago(UnitedStates);Ge Wang, VirginiaPolytechnicInstituteandStateUniv.(UnitedStates)
Monday 13 AugustWelcome and Opening Remarks . . . . . . . .Mon. 8:30 to 8:50 am
Stuart R. Stock,NorthwesternUniv.(UnitedStates)
Trends in the micro- and nano-CT: 2010-2012,StuartR.Stock,NorthwesternUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8506-01]
SESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . .Mon. 8:50 to 10:20 am
Phase ContrastSession Chair: Stuart R. Stock, NorthwesternUniv.(UnitedStates)
Recent progress in four-dimensional phase tomography with grating interferometry (Invited Paper),AtsushiMomose,SebastienHarasse,ShunsukeKibayashi,MargieP.Olbinado,WataruYashiro,TheUniv.ofTokyo(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8506-02]
Added value of multimodal imaging the human cerebellum: a combined grating-based phase contrast x-ray tomography, three-dimensional magnetic resonance microscopy, and histology study (Invited Paper),GeorgSchulz,Univ.Basel(Switzerland);TimmWeitkamp,SynchrotronSOLEIL(France);IreneZanette,FranzPfeiffer,TechnischeUniv.München(Germany);ConnyWaschkies,MarkusRudin,ETHZürich(Switzerland);MagdalenaMüller-Gerbl,BertMüller,Univ.Basel(Switzerland) . . . . . . . . . . . . . . . . . . . . [8506-03]
Quantitative grating-based x-ray phase contrast tomography at 82 keV,MarianWillner,MartinBech,JuliaHerzen,DieterHahn,TechnischeUniv.München(Germany);JohannesKenntner,JürgenMohr,KarlsruherInstitutfürTechnologie(Germany);IreneZanette,TechnischeUniv.München(Germany);AlexanderRack,EuropeanSynchrotronRadiationFacility(France);TimmWeitkamp,SynchrotronSOLEIL(France);FranzPfeiffer,TechnischeUniv.München(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8506-04]
Commissioning results from a first preclinical x-ray phase-contrast CT scanner,ArneTapfer,AstridVelroyen,MartinBech,TechnischeUniv.München(Germany);BartPauwels,PeterBruyndonckx,XuanLiu,AlexanderSasov,SkyScanN.V.(Belgium);FranzPfeiffer,TechnischeUniv.München(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8506-05]
SESSION 2 . . . . . . . . . . . . . . . . . . . . Mon. 10:50 am to 12:15 pm
Studying Damaged StructuresSession Chair: Erik Leo Ritman, MayoClinic(UnitedStates)
Comparing the micro-vascular structure of cancerous and healthy tissues (Invited Paper),BertMüller,SabrinaLang,BaselUniv.Hospital(Switzerland);FelixBeckmann,Helmholtz-ZentrumGeesthacht(Germany);MarcoDominietto,MarkusRudin,ETHZurich(Switzerland);IreneZanette,EuropeanSynchrotronRadiationFacility(France);TimmWeitkamp,SynchrotronSOLEIL(France);AlexanderRack,EuropeanSynchrotronRadiationFacility(France);SimoneE.Hieber,BaselUniv.Hospital(Switzerland) . . . . . . . . . . . . . . . . . . . . . . [8506-06]
Improved diagnostics of human breast cancer by grating-based x-ray phase contrast,JuliaHerzen,MarianWillner,DieterHahn,TechnischeUniv.München(Germany);AnikóSztrókay,SusanneLiebhardt,DorisMayr,FabianBamberg,Ludwig-Maximilians-Univ.München(Germany);IreneZanette,TechnischeUniv.München(Germany);TimmWeitkamp,SynchrotronSOLEIL(France);FranzPfeiffer,TechnischeUniv.München(Germany). . . . . . [8506-07]
Morphology of atherosclerotic human coronary arteries,MargaretHolme,GeorgSchulz,HansDeyhle,BaselUniv.Hospital(Switzerland);TimmWeitkamp,SynchrotronSOLEIL(France);FelixBeckmann,Helmholtz-ZentrumGeesthacht(Germany);JohannesA.Lobrinus,Univ.HospitalofGeneva(Switzerland);AndreasZumbuehl,Univ.ofGeneva(Switzerland);TillSaxer,Univ.HospitalofGeneva(Switzerland);BertMüller,Univ.Basel(Switzerland). . . . . . . . [8506-08]
Revealing the unreadable: the Apocalypto project,DavidMills,QueenMary,Univ.ofLondon(UnitedKingdom);OksanaSamko,CardiffUniv.(UnitedKingdom);AnthonyEvershed,QueenMary,Univ.ofLondon(UnitedKingdom);KateThomas,TimWess,CardiffUniv.(UnitedKingdom);GrahamR.Davis,QueenMary,Univ.ofLondon(UnitedKingdom) . . . . . . . . . . . . . . . . . [8506-09]
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:15to1:30pm
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 1:30 to 3:00 pm
Engineering ApplicationsSession Chair: Atsushi Momose, TheUniv.ofTokyo(Japan)
Development of diffraction-amalgamated grain-boundary tracking technique and its application to polycrystalline metals (Invited Paper),HiroyukiToda,DarrenLeclere,ToyohashiUniv.ofTechnology(Japan);YoshioSuzuki,AkihisaTakeuchi,KentaroUesugi,JapanSynchrotronResearchInstitute(Japan);MasakazuKobayashi,ToyohashiUniv.ofTechnology(Japan)[8506-10]
X-ray microcomputed tomography for the durability characterization of aggregates,HaniH.Titi,Univ.ofWisconsin-Milwaukee(UnitedStates)[8506-11]
Analysis of wood microstructure by synchrotron radiation-based x-ray microtomography (SRμCT),SilkeLautner,Univ.Hamburg(Germany);FelixBeckmann,Helmholtz-ZentrumGeesthacht(Germany). . . . . . . . . . . . [8506-12]
Recent developments in the MuCAT microtomography facility (Invited Paper),GrahamR.Davis,AnthonyEvershed,DavidMills,QueenMary,Univ.ofLondon(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8506-13]
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 3:30 to 5:20 pm
Imaging Dynamic SystemsSession Chair: Mark L. Rivers, TheUniv.ofChicago(UnitedStates)
In vivo tomographic velocimetry of the lung for the detailed study of lung disease and its treatments (Invited Paper),AndreasFouras,StephenDubsky,StuartB.Hooper,KarenK.W.Siu,MonashUniv.(Australia). . . . . . . . [8506-14]
Quantifying cardiogenic oscillations using synchrotron based phase contrast CT imaging,JordanThurgood,StephenDubsky,KarenK.W.Siu,MeganWallace,MelissaSiew,StuartHooper,AndreasFouras,MonashUniv.(Australia). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8506-15]
Development of fast tomography using CMOS image detector at SPring-8,KentaroUesugi,MasatoHoshino,AkihisaTakeuchi,YoshioSuzuki,NaotoYagi,JapanSynchrotronRadiationResearchInstitute(Japan). . . . . . . . . . . [8506-16]
First phase-contrast small-animal in-vivo micro-CT scanner,BartPauwels,PeterBruyndonckx,XuanLiu,SkyScanN.V.(Belgium);ArneTapfer,AstridVelroyen,MartinBech,FranzPfeiffer,TechnischeUniv.München(Germany);AlexanderSasov,SkyScanN.V.(Belgium). . . . . . . . . . . . . . . . . . . . . . [8506-17]
X-ray fast tomography and its applications in dynamical phenomena studies in geoscience at APS (Invited Paper),XianghuiXiao,ArgonneNationalLab.(UnitedStates);FlorianFusseis,Ruhr-Univ.Bochum(Germany);FrancescoDeCarlo,ArgonneNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . [8506-18]
Posters-Monday . . . . . . . . . . . . . . . . . . . . Mon. 5:30 to 7:30 pmConference attendees are invited to attend the poster session on Monday
evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
Self-calibration for a multi-segment straight-line trajectory CT using invariant moment,XiyunLi,ZhiqiangChen,YuxiangXing,TsinghuaUniv.(China)andKeyLaboratoryofParticle&RadiationImaging(TsinghuaUniversity),MinistryofEducation(China) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8506-55]
spie.org/opadvance · TEL:+13606763290 · help@spie.org 157
A geometrical correction method for radioactive intensity image reconstruction in tomographic gamma scanning,ZheLiu,LiZhang,TsinghuaUniv.(China)andKeyLaboratoryofParticle&RadiationImaging(TsinghuaUniversity),MinistryofEducation(China). . . . . . . . . . . . . . . . . . . . . . . [8506-56]
A noise variance estimation approach for CT,LeShen,YuxiangXing,TsinghuaUniv.(China)andDepartmentofEngineeringPhysics,TsinghuaUniversity(China).......................................... [8506-57]
Multi-species beam hardening calibration device for x-ray microtomography,AnthonyN.Z.Evershed,DavidMills,GrahamR.Davis,QueenMary,Univ.ofLondon(UnitedKingdom) . . . . . . . . . . . . . . . . . [8506-58]
An iterative reconstruction method for high-pitch helical luggage CT,HuiXue,LiZhang,ZhiqiangChen,TsinghuaUniv.(China). . . . . . . . . . . . . [8506-59]
A fast imaging method for grating-based x-ray CT,YanXi,JunZhao,ShanghaiJiaoTongUniv.(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8506-60]
Imaging properties of circular and helical interlaced source-detector array CT,YiChen,YanXi,JunZhao,ShanghaiJiaoTongUniv.(China) . . . [8506-61]
Evaluation of oral scanning in comparison to impression using three-dimensional registration,Yur-ChungBrogle-Kim,KurtJäger,HansDeyhle,GeorgSchulz,ThereseBormann,SimoneE.Hieber,BaselUniv.Hospital(Switzerland);FelixBeckmann,Helmholtz-ZentrumGeesthacht(Germany);BertMüller,BaselUniv.Hospital(Switzerland). . . . . . . . . . . . . . . . . . . . . . . [8506-62]
Measuring denture models to quantitatively compare optical surface scanning with impressions,ChristophVögtlin,BaselUniv.Hospital(Switzerland);GeorgSchulz,Univ.Basel(Switzerland);HansDeyhle,BaselUniv.Hospital(Switzerland);ThomasLiebrich,ETHZürich(Switzerland);SaschaWeikert,ETHZurich(Switzerland);KurtJäger,BertMüller,BaselUniv.Hospital(Switzerland) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8506-63]
MicroCT of fiber optic implant position in the cochlea,StuartR.Stock,SuhrudM.Rajguru,Claus-PeterRichter,NorthwesternUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8506-64]
Large area medipix3 detector for energy-resolved phase-contrast imaging,FranzM.Epple,guillaumepotdevin,TechnischeUniv.München(Germany);DavidPennicard,DESY(Germany);DieterRenker,TechnischeUniv.München(Germany);HeinzGraafsma,DESY(Germany);FranzPfeiffer,TechnischeUniv.München(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8506-65]
Unified dual-modality image reconstruction,YangLu,TiangeZhuang,ShanghaiJiaoTongUniv.(China);GeWang,VirginiaPolytechnicInstituteandStateUniv.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8506-66]
Radiation dose analysis of the triple-source CT based on a Monte Carlo method,ZhenyuYang,YangLu,JunZhao,ShanghaiJiaoTongUniv.(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8506-67]
Stereo-imaging towards spectrography for 3D analysis from a single spectral view,YanXi,ShanghaiJiaoTongUniv.(China);GeWang,VirginiaPolytechnicInstituteandStateUniv.(UnitedStates);HengyongYu,WakeForestUniv.SchoolofMedicine(UnitedStates);YuxinWang,ArgonneNationalLab.(UnitedStates);JunZhao,ShanghaiJiaoTongUniv.(China) . . . . . . . [8506-68]
Spectrography: 3D reconstruction from 1 or 2 spectral views,HengyongYu,WakeForestUniv.SchoolofMedicine(UnitedStates);GeWang,VirginiaPolytechnicInstituteandStateUniv.(UnitedStates). . . . . . . . . . . . . . [8506-69]
Tuesday 14 AugustSESSION 5 . . . . . . . . . . . . . . . . . . . . . . . . Tues. 8:30 to 10:15 am
Porous SystemsSession Chair: Erik Leo Ritman, MayoClinic(UnitedStates)
Synchrotron radiation CT from the micro to nanoscale for the investigation of bone tissue (Invited Paper),FrancoisePeyrin,PeiDong,AlexandraPacureanu,MariaA.Zuluaga,CécileOlivier,MaxLanger,CREATIS-LRMNINSA(France);PeterCloetens,EuropeanSynchrotronRadiationFacility(France). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8506-19]
Combined micro computed tomography and histology study of bone augmentation and distraction osteogenesis,BerndIlgenstein,HansDeyhle,ChristophKunz,ClaudeJaquiery,GernotJundt,Univ.Basel(Switzerland);BrigittevonRechenberg,Univ.ofZürich(Switzerland);ArnaudScherberich,Univ.Basel(Switzerland);IvanMartin,BaselUniv.Hospital(Switzerland);FelixBeckmann,Helmholtz-ZentrumsGeesthacht(Germany);BertMüller,SimoneE.Hieber,BaselUniv.Hospital(Switzerland) . . . . . . . . . . . . . . . . . . . . . . [8506-20]
Morphology of human molars investigated by synchrotron radiation-based micro computed tomography and small-angle x-ray scattering,HansDeyhle,BaselUniv.Hospital(Switzerland);OliverBunk,PaulScherrerInstitut(Switzerland);FelixBeckmann,Helmholtz-ZentrumGeesthacht(Germany);BertMüller,BaselUniv.Hospital(Switzerland). . . . . . . . . . . . . . . . . . . . . . . [8506-21]
Data analysis approach for region of interest tomography of porous rock structures,StevenVanBoxel,AishaAlHajri,CathyHollis,TheUniv.ofManchester(UnitedKingdom);NghiaT.Vo,NationalUniv.ofSingapore(Singapore);PhilipJ.Withers,TheUniv.ofManchester(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8506-22]
Ground-truth verification of dynamic x-ray micro-tomography images of fluid displacement,GlennR.Myers,TrondK.Varslot,AndrewM.Kingston,AdrianP.Sheppard,TheAustralianNationalUniv.(Australia) . . . . . . . [8506-23]
SESSION 6 . . . . . . . . . . . . . . . . . . . . Tues. 10:45 am to 12:10 pm
Systems ISession Chair: Mark L. Rivers, TheUniv.ofChicago(UnitedStates)
Tomography at Diamond Light Source with a focus on high-energy applications (Invited Paper),MichaelDrakopoulos,RobertAtwood,ThomasConnolley,ChristinaReinhard,LeighConnor,DiamondLightSourceLtd.(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8506-24]
In situ x-ray nano-CT and chemical speciation technique development at the APS transmission x-ray microscopy facility,SteveWang,ArgonneNationalLab.(UnitedStates)................................. [8506-25]
Status of the PETRA III Imaging Beamline P05,FabianWilde,MalteOgurreck,Helmholtz-ZentrumGeesthacht(Germany);JuliaHerzen,TechnischeUniv.München(Germany);FelixBeckmann,Helmholtz-ZentrumGeesthacht(Germany);AstridHaibel,BeuthHochschulefürTechnikBerlin(Germany);MartinMüller,AndreasSchreyer,Helmholtz-ZentrumGeesthacht(Germany) [8506-26]
An attempt to overcome diffraction limit in detectors for x-ray nanotomography,AlexanderSasov,SkyScanN.V.(Belgium) . . . . . . [8506-27]
Lunch/Exhibition Break.............................. 12:10to1:40pm
SESSION 7 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 1:40 to 3:15 pm
Work Flow and AnalysisSession Chair: Graham R. Davis, QueenMary,Univ.ofLondon(United
Kingdom)
High-speed reconstruction on workstations using multi-threading and GPUs (Invited Paper),MarkL.Rivers,TheUniv.ofChicago(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8506-28]
Improving the workflow of tomography studies for the polymer additives industry,LeslieG.Butler,KyungminHam,LouisianaStateUniv.(UnitedStates);KimberlyWhite,LarryS.Simeral,AlbermarleCorp.(UnitedStates). . . [8506-29]
A new protocol for absorption-contrast and phase-contrast microtomography using synchrotron radiation at DESY (Invited Paper),FelixBeckmann,Helmholtz-ZentrumGeesthacht(Germany);FabianWilde,DESY(Germany);LarsLottermoser,IgorKhokhriakov,MalteOgurreck,MartinMüller,AndreasSchreyer,Helmholtz-ZentrumGeesthacht(Germany). . . . . . [8506-30]
Drishti: volume exploration and presentation tool (Invited Paper),AjayLimaye,TheAustralianNationalUniv.(Australia). . . . . . . . . . . . . . . . . . . . . . . . [8506-31]
SESSION 8 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 3:45 to 5:30 pm
Algorithms ISession Chair: Ge Wang, VirginiaPolytechnicInstituteandStateUniv.
(UnitedStates)
PRISM: a divide-and-conquer matrix decomposition model with low-rank coherence and sparse variation (Invited Paper),HaoGao,Univ.ofCalifornia,LosAngeles(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8506-32]
An interaction based CT reconstruction algorithm for blocked projection data in a dynamic ICT system,MingChang,YongshunXiao,ZhiqiangChen,TsinghuaUniv.(China)andKeyLaboratoryofParticle&RadiationImaging(TsinghuaUniversity),MinistryofEducation(China). . . . . . . . . . . . . . . [8506-33]
A CS-based evaluation method for candidate next-generation cardiac CT architectures,BaodongLiu,WakeForestUniv.SchoolofMedicine(UnitedStates);HengyongYu,WakeForestUniv.(UnitedStates);GeWang,VirginiaPolytechnicInstituteandStateUniv.(UnitedStates). . . . . . . . . . . . . . [8506-34]
Orthogonal-rotating tetrahedral scanning for cone-beam CT,IvanB.Ye,VirginiaPolytechnicInstituteandStateUniv.(UnitedStates)andIowaCityWestHighSchool(UnitedStates);GeWang,VirginiaPolytechnicInstituteandStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8506-35]
Conference 8506
158 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Spatial-frequency-based multi-scale image fusion for x-ray grating-based differential phase-contrast mammography,XiaoleiJiang,TsinghuaUniv.(China)andKeyLaboratoryofParticle&RadiationImaging(TsinghuaUniversity),MinistryofEducation,Beijing(China);ZhentianWang,PaulScherrerInstitut(Switzerland);LiZhang,RanZhang,YuepingHan,TsinghuaUniv.(China)andKeyLaboratoryofParticle&RadiationImaging(TsinghuaUniversity),MinistryofEducation,Beijing(China);MarcoStampanoni,PaulScherrerInstitut(Switzerland)andInstituteforBiomedicalEngineering,UniversityandETHZürich,Zürich,Switzerland(Switzerland) . . . . . . . . . . . . . . . . . . . . . . . [8506-36]
Penetrating Radiation Technical Event . . . . . . . . . . . . . . . . . . Tues. 8:00 to 10:00 pm
Chair: James E. Baciak, PacificNorthwestNationalLabs.(UnitedStates)
Thiseventbringstogethertechnologistsandscientistswithinterestsinneutron,x-andgamma-raydetection,spectroscopy,andimagingforallapplications.Speakertobeannounced.
Workshop on X-Ray Mirrors . . . . . . . . Tues. 8:15 to 9:15 pm
Chair: Ali M. Khounsary, ArgonneNationalLab.(UnitedStates)
TheX-rayMirrorWorkingGroupprovidesaninformalsettingfortheinterestedengineersandscientiststomeetanddiscussissuesrelatedtothedesign,analysis,cooling,fabrication,andmetrologyofx-raymirrors.Topicsfordiscussioncanbee-mailedtotheorganizer,Dr.AliKhounsary(amk@aps.anl.gov),priortothemeeting.
Wednesday 15 AugustSESSION 9 . . . . . . . . . . . . . . . . . . . . . . . . .Wed. 8:30 to 10:15 am
Systems IISession Chair: Bert Müller, Univ.Basel(Switzerland)
A new CT architecture with stationary CNT x-ray sources (Invited Paper),GuohuaCao,VirginiaPolytechnicInstitute&StateUniv.(UnitedStates);BaodongLiu,HengyongYu,WakeForestUniv.SchoolofMedicine(UnitedStates);GeWang,VirginiaPolytechnicInstituteandStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8506-37]
Considerations for high-magnification high-cone-angle helical micro-CT,TrondK.Varslot,AndrewKingston,GlennMyers,AdrianSheppard,TheAustralianNationalUniv.(Australia) . . . . . . . . . . . . . . . . . . . . . . . . . . . [8506-38]
Calibration of a combined laboratory microCT/microXRF system,XuanLiu,PeterBruyndonckx,AlexanderSasov,SkyScanN.V.(Belgium). . . . . . [8506-39]
Energy-resolved scatter estimation for CT,AlexM.T.Opie,Univ.ofCanterbury(NewZealand);AnthonyP.H.Butler,Univ.ofOtago(NewZealand);PhilipJ.Bones,Univ.ofCanterbury(NewZealand). . . . . . . . . . . . . . . [8506-40]
Frontiers of high-resolution and high-speed CT in industry and research,Ch.Fella,Julius-Maximilians-Univ.Würzburg(Germany);SimonZabler,Julius-Maximilians-Univ.Würzburg(Germany)andFraunhofer-InstitutfürIntegrierteSchaltungen(Germany);F.Nachtrab,Fraunhofer-InstitutfürIntegrierteSchaltungen(Germany)andFriedrich-Alexander-Univ.Erlangen-Nürnberg(Germany);AndreDietrich,Fraunhofer-InstitutfürIntegrierteSchaltungen(Germany);Th.Ebensperger,Julius-Maximilians-Univ.Würzburg(Germany);NormanUhlmann,Fraunhofer-InstitutfürIntegrierteSchaltungen(Germany);RandolfHanke,Julius-Maximilians-Univ.Würzburg(Germany)andFraunhofer-InstitutfürIntegrierteSchaltungen(Germany) . . . . . . . . . . . . . . . . . . . [8506-41]
SESSION 10 . . . . . . . . . . . . . . . . . . . Wed. 10:45 am to 12:05 pm
Systems IIISession Chair: Felix Beckmann, Helmholtz-ZentrumGeesthacht
(Germany)
X-ray micro-tomography at the Advanced Light Source,AlastairA.MacDowell,DulaY.Parkinson,AbdelHaboub,EricSchaible,JamesNasiatka,HrishiA.Bale,RobertO.Ritchie,JohnathonB.Ajo-Franklin,LawrenceBerkeleyNationalLab.(UnitedStates)................................. [8506-42]
Advances in x-ray dark field imaging and tomography,AndreasMalecki,ThomasBiernath,GuillaumePotdevin,TechnischeUniv.München(Germany);MartinBech,TechnischeUniv.München(Germany)andLundUniversity(Sweden);FranzPfeiffer,TechnischeUniv.München(Germany). . . . . [8506-43]
The x-ray tomography instrument at Diamond Beamline I12-JEEP,RobertC.Atwood,DiamondLightSourceLtd.(UnitedKingdom);ValeriyTitarenko,TheUniv.ofManchester(UnitedKingdom);MichaelDrakopoulos,ThomasConnolley,ChristinaReinhard,MichaelHart,UlrikPedersen,PeterLeicester,MarkBasham,FajinYuan,RaviSomayaji,DiamondLightSourceLtd.(UnitedKingdom);RobertJ.Cernik,PhilipJ.Withers,TheUniv.ofManchester(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8506-44]
Lunch/Exhibition Break........................... 11:45amto1:30pm
SESSION 11 . . . . . . . . . . . . . . . . . . . . . . . . Wed. 1:30 to 2:55 pm
Algorithms IISession Chair: Ge Wang, VirginiaPolytechnicInstituteandStateUniv.
(UnitedStates)
Higher-order total variation method for interior tomography (Invited Paper),JianshengYang,PekingUniv.(China);HengyongYu,WakeForestUniv.SchoolofMedicine(UnitedStates);WenxiangCong,VirginiaPolytechnicInstitute&StateUniv.(UnitedStates);MingJiang,PekingUniversity(China);GeWang,VirginiaPolytechnicInstitute&StateUniv.(UnitedStates).......... [8506-46]
Anisotropic total variation minimization method for limited-angle CT reconstruction,XinJin,LiangLi,ZhiqiangChen,LiZhang,YuxiangXing,TsinghuaUniv.(China)andKeylaboratoryofParticle&RadiationImaging(TsinghuaUniversity),MinistryofEducation,Beijing(China) . . . . . . . . [8506-47]
X-ray beam hardening correction by minimizing reprojection distance,AndrewKingston,GlennMyers,TrondVarslot,TheAustralianNationalUniv.(Australia). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8506-48]
Improved total variation based CT reconstruction algorithm with noise estimation,XinJin,LiangLi,ZhiqiangChen,TsinghuaUniv.(China)andKeylaboratoryofParticle&RadiationImaging(TsinghuaUniversity),MinistryofEducation,Beijing(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8506-49]
SESSION 12 . . . . . . . . . . . . . . . . . . . . . . . . Wed. 3:30 to 5:15 pm
Water, Water EverywhereSession Chair: Stuart R. Stock, NorthwesternUniv.(UnitedStates)
High-density resolution synchrotron radiation based x-ray microtomography data for quantitative volumetrics and 3D-morphometrics in zoological functional morphology and developmental studies (Invited Paper),JörgU.Hammel,Friedrich-Schiller-Univ.Jena(Germany)andUniversityofAmsterdam(Netherlands);HenryJahn,Friedrich-Schiller-Univ.Jena(Germany);JuliaHerzen,TechnischeUniv.München(Germany);FabianWilde,FelixBeckmann,Helmholtz-ZentrumGeesthacht(Germany);JaapKaandorp,Univ.vanAmsterdam(Netherlands);MichaelNickel,Friedrich-Schiller-Univ.Jena(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8506-50]
A comprehensive analysis of the macrostructure of sea urchin teeth,AlexanderZiegler,HarvardUniv.(UnitedStates);StuartR.Stock,NorthwesternUniv.(UnitedStates);BjörnMenze,ETHZurich(Switzerland);AndrewB.Smith,TheNaturalHistoryMuseum(UnitedKingdom). . . . . . . . . . . . . . . . . . [8506-51]
Investigating biofilm structure using x-ray microtomography and gratings-based phase contrast,ErinA.Miller,MatthewMarshall,PacificNorthwestNationalLab.(UnitedStates);XianghuiXiao,ArgonneNationalLab.(UnitedStates);TimothyA.White,EricHill,MathewThomas,JamesCarson,PaulKeller,MicahMiller,PacificNorthwestNationalLab.(UnitedStates). . . . . . . [8506-52]
Application of a novel diffraction-based tomography method to the zebrafish (Danio rerio) embryo,ChamindaR.Samarage,IanSmyth,RobertBryson-Richardson,AndreasFouras,MonashUniv.(Australia). . . . . . [8506-53]
Unusual structures in sea urchin teeth studied with synchrotron microCT,StuartR.Stock,NorthwesternUniv.(UnitedStates);XianghuiXiao,ArgonneNationalLab.(UnitedStates);AlexanderZiegler,HarvardUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8506-54]
Conference 8506
spie.org/opadvance · TEL:+13606763290 · help@spie.org 159
Conference 8507Monday-Wednesday 13-15 August 2012 • Proceedings of SPIE Vol. 8507
Hard X-Ray, Gamma-Ray, and Neutron Detector Physics XIVConference Chairs:Ralph B. James, BrookhavenNationalLab.(UnitedStates);Arnold Burger, FiskUniv.(UnitedStates);Larry A. Franks, Consultant(UnitedStates);Michael Fiederle, Albert-Ludwigs-Univ.Freiburg(Germany)
Program Committee:Toru Aoki, ShizuokaUniv.(Japan);Fikri Aqariden, EPIRTechnologies,Inc.(UnitedStates);Jim E. Baciak, Jr., PacificNorthwestNationalLab.(UnitedStates);Zane W. Bell, OakRidgeNationalLab.(UnitedStates);Lynn A. Boatner, OakRidgeNationalLab.(UnitedStates);Aleksey E. Bolotnikov, BrookhavenNationalLab.(UnitedStates);Bill Cardoso, CreativeElectron(UnitedStates);Henry Chen, RedlenTechnologies(Canada);Nerine J. Cherepy, LawrenceLivermoreNationalLab.(UnitedStates);Jeffrey J. Derby, Univ.ofMinnesota,TwinCities(UnitedStates);Martine C. Duff, SavannahRiverNationalLab.(UnitedStates);Petro Mykhajlovych Fochuk, YuriyFedkovychChernivtsiNationalUniv.(Ukraine);Jan Franc, CharlesUniv.inPrague(CzechRepublic);Fei Gao, PacificNorthwestNationalLab.(UnitedStates);Yoshinori Hatanaka, AichiUniv.ofTechnology(Japan);Zhong He, Univ.ofMichigan(UnitedStates);Keitaro Hitomi, TohokuUniv.(Japan);Alan Janos, U.S.Dept.ofHomelandSecurity(UnitedStates);Warnick J. Kernan, PacificNorthwestNationalLab.(UnitedStates);Henric Krawczynski, WashingtonUniv.inSt.Louis(UnitedStates);Kelvin G. Lynn, WashingtonStateUniv.(UnitedStates);Krishna C. Mandal, Univ.ofSouthCarolina(UnitedStates);Douglas Scott McGregor, KansasStateUniv.(UnitedStates);Robert D. McLaren, Consultant(UnitedStates);Shariar Motakef, CapeSym,Inc.(UnitedStates);Sanjoy Mukhopadhyay, NationalSecurityTechnologies,LLC(UnitedStates);Stephen A. Payne, LawrenceLivermoreNationalLab.(UnitedStates);Utpal N. Roy, ICxTechnologies,Inc.(UnitedStates);Carolyn E. Seifert, PacificNorthwestNationalLab.(UnitedStates);Paul J. Sellin, Univ.ofSurrey(UnitedKingdom);Narsingh B. Singh, SMS&T(UnitedStates);Michael R. Squillante, RadiationMonitoringDevices,Inc.(UnitedStates);Ashley C. Stowe, Y-12NationalSecurityComplex(UnitedStates);Csaba Szeles, EIDetection&ImagingSystems(UnitedStates);Tumay O. Tumer, NovaR&D,Inc.(UnitedStates);Sergey E. Ulin, NationalResearchNuclearUniv.MEPhI(RussianFederation);Lodewijk van den Berg, ConstellationTechnologyCorp.(UnitedStates);Peter E. Vanier, BrookhavenNationalLab.(UnitedStates)
Monday 13 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . .Mon. 8:00 to 10:20 am
Scintillators ISession Chair: Ralph B. James, BrookhavenNationalLab.(United
States)
Scintillators for active interrogation and radiography applications (Invited Paper),NerineJ.Cherepy,ZacharyM.Seeley,RobertD.Sanner,BenjaminW.Sturm,ThomasM.Tillotson,StephenA.Payne,DanielJ.Schneberk,RogerL.Perry,KeithE.Lewis,DennisR.Slaughter,LawrenceLivermoreNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8507-01]
New activator for strontium iodide and other scintillator crystals (Invited Paper),ArnoldBurger,FiskUniv.(UnitedStates). . . . . . . . . . . . . . . . . [8507-02]
Development of the next-generation solid-state photomultipliers for scintillation-based radiation detection applications,Xiao-JieChen,ErikB.Johnson,ChristopherJ.Stapels,ChadWhitney,EricChapman,JamesF.Christian,RadiationMonitoringDevices,Inc.(UnitedStates) . . . . . . . [8507-03]
Electronic structure, energy transport, and optical properties of halide scintillators,DavidJ.Singh,Mao-HuaDu,KoushikBiswas,OakRidgeNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8507-04]
NEST: a comprehensive model for scintillation and ionization yields in noble elements,MatthewM.Szydagis,Univ.ofCalifornia,Davis(UnitedStates)andLawrenceLivermoreNationalLaboratory(UnitedStates) . . . . . . . . . . [8507-05]
Electron cascades, intrinsic properties, and scintillation processes in scintillator materials,FeiGao,SebastienN.Kerist,YulongXie,ZhiguoWang,LukeW.Campbell,ReneeM.VanGinhoven,MicahP.Prange,PacificNorthwestNationalLab.(UnitedStates)................................. [8507-06]
SESSION 2 . . . . . . . . . . . . . . . . . . . . Mon. 10:50 am to 12:30 pm
CZT IImproving the growth of CZT crystals for radiation detectors: a modeling perspective (Invited Paper),JeffreyJ.Derby,AndrewYeckel,NanZhang,Univ.ofMinnesota,TwinCities(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . [8507-07]
The current state of the art for materials development in multi tube physical vapour transport (MTPVT) grown CZT will be reviewed and detector results presented (Invited Paper),IanRadley,Kromek(UnitedKingdom). . . . [8507-08]
Results from testing large-volume CdZnTe pixel detectors using a readout system based on 3D ASIC,AlekseyE.Bolotnikov,GiuseppeS.Camarda,YanggangCui,GianluigiDeGeronimo,JackFried,RubyGull,AnwarHossain,GeYang,EmersonVernon,RalphJames,BrookhavenNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8507-09]
Growth and characterization of THM-grown CdTe crystals,MichaelFiederle,FreiburgerMaterialforschungszentrum(Germany);MalgorzataSowinska,EuroradS.A.(France);AlexFauler,JohannesFeyrer,MarkusDambacher,FreiburgerMaterialforschungszentrum(Germany);PaulSiffert,EuroradS.A.(France). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8507-10]
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:30to1:30pm
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 1:30 to 3:30 pm
Detector Materials ISession Chair: Michael Fiederle, Albert-Ludwigs-Univ.Freiburg
(Germany)
Study of TlBr gamma-ray detectors using digitized pulse waveforms (Invited Paper),ZhongHe,CrystalThrall,Univ.ofMichigan(UnitedStates);HadongKim,LeonardJ.Cirignano,KanaiS.Shah,RadiationMonitoringDevices,Inc.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8507-11]
Assessment of 4H-SiC epitaxial layers and high resistivity bulk crystals for radiation detectors (Invited Paper),KrishnaC.Mandal,PeterG.Muzykov,SandeepK.Chaudhuri,RameshM.Krishna,Univ.ofSouthCarolina(UnitedStates);J.RusselTerry,LosAlamosNationalLab.(UnitedStates). . . [8507-12]
GaN based semiconductor neutron detector,ToruAoki,AkifumiKoike,ShizuokaUniv.(Japan)andANSeeNInc.(Japan);TakahiroNishioka,ShizuokaUniv.(Japan);HisashiMorii,ShizuokaUniv.(Japan)andANSeeNInc.(Japan);HisashiKaneko,KatsuhiroAtsumi,TakayukiNakano,HidenoriMimura,ShizuokaUniv.(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8507-13]
Thick TlBr detectors for gamma-ray spectroscopy,KeitaroHitomi,TsutomuTada,Seong-YunKim,YuanlaiXu,TohokuUniv.(Japan);ToshiyukiOnodera,TadayoshiShoji,TohokuInstituteofTechnology(Japan);HiromichiYamazaki,KeizoIshii,TohokuUniv.(Japan) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8507-14]
Mercury and antimony chalcohalide semiconductors as new candidates for radiation detection applications at room temperature,MercouriG.Kanatzidis,ChristosD.Malliakas,NorthwesternUniv.(UnitedStates)andArgonneNationalLab.(UnitedStates);AriefC.Wibowo,Duck-YoungChung,ArgonneNationalLab.(UnitedStates);ZhifuLiu,JohnA.Peters,MariaSebastian,BruceW.Wessels,HosubJin,ArthurJ.Freeman,NorthwesternUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8507-15]
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 4:00 to 5:30 pm
CZT IISession Chair: Jan Franc, CharlesUniv.inPrague(CzechRepublic)
Surface and metal semiconductor interface studies of CdZnTe detectors (Invited Paper),HenryChen,RedlenTechnologies(Canada). . . . . . . . [8507-16]
High-energy gamma-ray detection using CZT detectors with virtual Frisch grid,SandeepK.Chaudhuri,RameshM.Krishna,PeterG.Muzykov,KrishnaC.Mandal,Univ.ofSouthCarolina(UnitedStates). . . . . . . . . . . . . . . . . . [8507-17]
Influence of surface preparation of bar-shaped crystals on detector performance,GiuseppeS.Camarda,AlekseyE.Bolotnikov,YonggangCui,AnwarHossain,KiHyunKim,GeYang,RalphB.James,BrookhavenNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8507-18]
High-fidelity molecular dynamics simulations of dislocations in CZT crystals,XiaowangZhou,DonaldK.Ward,BryanM.Wong,F.PatrickDoty,SandiaNationalLabs.,California(UnitedStates). . . . . . . . . . . . . . . . . [8507-19]
160 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Posters-Monday . . . . . . . . . . . . . . . . . . . . Mon. 5:30 to 7:30 pmConference attendees are invited to attend the poster session on Monday
evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
Correlation of dark current in the bulk of pixelated CdZnTe detectors with the bulk defects,StephenBabalola,AlabamaA&MUniv.(UnitedStates);AnwarHossain,BrookhavenNationalLab.(UnitedStates);CoreySolomon,AlabamaA&MUniv.(UnitedStates);AlekseyE.Bolotnikov,BrookhavenNationalLab.(UnitedStates);TrentMontgomery,AlabamaA&MUniv.(UnitedStates);RalphB.James,BrookhavenNationalLab.(UnitedStates). . . . . . . . . . . . . . [8507-52]
Compact digital spectroscopic system with coplanar grid (Cd,Zn)Te detectors for homeland security applications,MarkusDambacher,AndreasZwerger,AlexFauler,ChristianDisch,FreiburgerMaterialforschungszentrum(Germany);WilderichEickhoff,BundesamtfürStrahlenschutz(Germany);UlrichStöhlker,CTBTOPreparatoryCommission(Austria);MichaelFiederle,FreiburgerMaterialforschungszentrum(Germany). . . . . . . . . . . . . . . . . . . . . . . . . [8507-53]
Transport properties and spectrometric performances of CdZnTe gamma-ray detectors,AlexandrA.Zakharchenko,AleksandrV.Rybka,VladimirE.Kutny,AnnaI.Skrypnyk,ManapA.Khazhmuradov,NationalScienceCtr.KharkovInstituteofPhysicsandTechnology(Ukraine);PetroM.Fochuk,YuriyFedkovychChernivtsiNationalUniv.(Ukraine);AlekseyE.Bolotnikov,RalphB.James,BrookhavenNationalLab.(UnitedStates). . . . . . . . . . . . . . . . [8507-54]
Structural characteristics of Zn 1-xMn xTe polycrystalline films,DenysKurbatov,OlexiyKlymov,AnatoliyOpanasyuk,SergiyDanilchenko,OlexandrPonomarev,SumyStateUniv.(Ukraine);PetroFochuk,BrookhavenNationalLab.(UnitedStates)andYuriyFedkovychChernivtsiNationalUniversity(Ukraine) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8507-55]
Some structural and optical properties of thin and thick CdTe and Cd xMn
1-xTe films,VolodymyrV.Kosyak,TheUniv.ofUtah(UnitedStates);AnatoliyS.Opanasyuk,PavloKoval,SumyStateUniv.(Ukraine);PetroFochuk,YuriyFedkovychChernivtsiNationalUniv.(Ukraine);AlekseyBolotnikov,RalphJames,BrookhavenNationalLab.(UnitedStates);MikeScarpulla,TheUniv.ofUtah(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8507-56]
High-temperature treatment of CZT crystals,PetroFochuk,IgorNakonechnyi,OlehKopach,YevgeniyaVerzhak,OlehPanchuk,YuriyFedkovychChernivtsiNationalUniv.(Ukraine);AlexandrRybka,NationalScienceCtr.KharkovInstituteofPhysicsandTechnology(Ukraine);VitaliyKomar,InstituteforSingleCrystals(Ukraine);AlekseyBolotnikov,GiuseppeCamarda,AnwarHossain,KiHyunKim,GeYang,RalphJames,BrookhavenNationalLab.(UnitedStates). . . [8507-57]
MOHOS capacity device for gamma-ray nonvolatile dosimeter,Wen-ChingHsieh,MinghsinUniv.ofScienceandTechnology(Taiwan)andNationalNanoDeviceLabs.(Taiwan)andETOMSElectronicsCorp(Taiwan);DaweiHeh,NationalNanoDeviceLabs.(Taiwan);Hao-TienD.Lee,ETOMSElectronicsCorp(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8507-58]
Registration of high intensity electron and gamma-ray fields with CVD-diamond detectors,LeonidN.Davydov,AlexanderRybka,AndreiVerevkin,StanislavDudnik,VasyliGritsyna,VladimirKutny,OlegOpalev,ValentinShevchenko,IlliaShlyahov,VladimirStrelnitsky,AliTenishev,VyacheslavUvarov,NationalScienceCtr.KharkovInstituteofPhysicsandTechnology(Ukraine);RalphJames,AlekseyBolotnikov,BrookhavenNationalLab.(UnitedStates);PetroFochuk,YuriyFedkovychChernivtsiNationalUniv.(Ukraine). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8507-59]
Synthesis and characterization of Cs 2LiCeCl 6 elpasolite as a gamma-ray and thermal neutron scintillator,JeremyKingma,KelvinLynn,WashingtonStateUniv.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8507-60]
Defects equilibrium and chemical diffusion in donor-doped CdTe,LukasSedivy,EduardBelas,RomanGrill,MarekBugar,JanFranc,CharlesUniv.inPrague(CzechRepublic). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8507-61]
Diffusion profile of contact metals and feature of etched surfaces of CdZnTe detector crystals,AnwarM.Hossain,AlekseyE.Bolotnikov,GiuseppeS.Camarda,YonggangCui,RubiGul,KiHyunKim,GeYang,RalphB.James,BrookhavenNationalLab.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . [8507-62]
Nanoparticle enhancement of scintillation,JamesR.Tinsley,NationalSecurityTechnologies,LLC(UnitedStates);LarryFranks,KeystoneInternational,Inc.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8507-63]
The image reconstruction of neutron-induced high-energy gamma-rays using 4π FOV Compton camera,DokunYoun,WonhoLee,KoreaUniv.(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8507-64]
Surface processing of CdZnTe crystals,VolodymyrA.Gnatyuk,V.LashkaryovInstituteofSemiconductorPhysics(Ukraine)andResearchInstituteofElectronics,ShizuokaUniversity(Japan);OleksandrI.Vlasenko,SergiyN.Levytskyi,V.LashkaryovInstituteofSemiconductorPhysics(Ukraine);ErnestoDieguez,JeromeCrocco,HakimaBensalah,Univ.AutónomadeMadrid(Spain);MichaelFiederle,AlexFauler,FreiburgerMaterialforschungszentrum(Germany);ToruAoki,ShizuokaUniv.(Japan)............................. [8507-65]
Scintillation detector prototype for thermal neutrons with wavelength shifting fiber readout,RalfEngels,UweClemens,ForschungszentrumJülichGmbH(Germany);MichaelFiederle,FreiburgerMaterialforschungszentrum(Germany);AndreasHouben,RWTHAachen(Germany);GuenterKemmerling,StefanMüskes,WernerSchweika,JakobSchelten,ForschungszentrumJülichGmbH(Germany).......................................... [8507-66]
Photoluminescence and absorption properties of the surface functional layer of CdTe crystals,DmytroV.Gnatyuk,LeonidV.Poperenko,IrynaV.Yurgelevych,OleksandrI.Dacenko,NationalTarasShevchenkoUniv.ofKyiv(Ukraine);ToruAoki,ManatoKimura,ShizuokaUniv.(Japan). . . . . . . [8507-67]
Efficient plastic scintillators,H.PaulMartinez,IwonaA.Pawelczak,NataliaP.Zaitseva,AndrewM.Glenn,M.LeslieCarman,StephenA.Payne,LawrenceLivermoreNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . [8507-68]
Tuesday 14 AugustSESSION 5 . . . . . . . . . . . . . . . . . . . . . . . . Tues. 8:00 to 10:20 am
Detector Materials IISession Chair: Aleksey E. Bolotnikov, BrookhavenNationalLab.
(UnitedStates)
Solid state chemistry approach to new hard radiation detection materials (Invited Paper),MercouriG.Kanatzidis,HaoLi,SandyNguyen,JohnAndroulakis,ChristosMalliakas,JohnPeters,ZhifuLiu,HosubJin,ArthurFreeman,BruceWessels,NorthwesternUniv.(UnitedStates). . . . . . . [8507-20]
Search and development of radiation detectors (Invited Paper),EdithBourretCourchesne,LawrenceBerkeleyNationalLab.(UnitedStates). . . . . . [8507-21]
Resistivity, carrier trapping, and polarization phenomenon in semiconductor radiation detection materials,Mao-HuaDu,KoushikBiswas,DavidJ.Singh,OakRidgeNationalLab.(UnitedStates). . . . . . . . . . . [8507-22]
Control of the polytypes and line defects in radiation detector materials,WalterM.Duval,NASAGlennResearchCtr.(UnitedStates);NarsinghB.Singh,Univ.ofMaryland,BaltimoreCounty(UnitedStates). . . . . . . . . . . . . . [8507-23]
Characterization of thallium-based ternary semiconductor compounds for radiation detection,ZhifuLiu,JohnPeters,MariaSebastian,BruceWessels,SandyNguyen,ShichaoWang,MercouriKanatzidis,HosubJin,ArthurFreeman,NorthwesternUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . [8507-24]
Synthesis and characterization of amorphous selenium alloys for radiation detector applications,KrishnaC.Mandal,RameshM.Krishna,Univ.ofSouthCarolina(UnitedStates);SandeepK.Chaudhuri,Univ.ofSouthCarolina(Afghanistan);PeterG.Muzykov,Univ.ofSouthCarolina(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8507-25]
SESSION 6 . . . . . . . . . . . . . . . . . . . . Tues. 10:50 am to 12:10 pm
Neutron DetectorsSession Chair: Robert D. McLaren, Consultant(UnitedStates)
Development of the new generation of glass-based neutron detection materials,GeorgyA.Dosovitskiy,AlexeyDosovitskiy,MikhailKorjik,NeoScintLLC(RussianFederation) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8507-26]
Hexagonal boron nitride epitaxial layers as neutron detector materials,JingLi,SashikanthMajety,MatthewD.Holman,JingyuLin,HongxingJiang,TexasTechUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8507-27]
Direction sensitive neutron detector in near-field measurements,SanjoyMukhopadhyay,NationalSecurityTechnologies,LLC(UnitedStates). [8507-28]
Optimization of a novel semiconducting neutron detection material,AshleyC.Stowe,Y-12NationalSecurityComplex(UnitedStates);MartinWilliamson,Y12NationalSecurityComplex(UnitedStates);PijushBhattacharya,ArnoldBurger,FiskUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8507-29]
Lunch/Exhibition Break.............................. 12:10to1:10pm
Conference 8507
spie.org/opadvance · TEL:+13606763290 · help@spie.org 161
SESSION 7 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 1:10 to 3:30 pm
CZT IIISession Chair: Arnold Burger, FiskUniv.(UnitedStates)
In-situ bandgap engineering of CdZnTe (Invited Paper),Ki-HyunKim,AleskseyE.Bolotnikov,GiuseppeS.Camarda,RyanTappero,AnwarHossain,YonggangCui,GeYang,BrookhavenNationalLab.(UnitedStates);AndreaZappettini,ConsiglioNazionaledelleRicerche(Italy);JanFranc,CharlesUniv.inPrague(CzechRepublic);RalphB.James,BrookhavenNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8507-30]
Growth of CdZnTe by the detached Bridgman method (Invited Paper),ShariarMotakef,PiotrBecla,StacySwider,KrzysztofBecla,JohnFiala,MatthewR.Overholt,CapeSym,Inc.(UnitedStates)........................ [8507-31]
Polarization in high-resistivity CdZnTe,JanFranc,VáclavDědič,CharlesUniv.inPrague(CzechRepublic);PaulSellin,Univ.ofSurrey(CzechRepublic);JakubZázvorka,RomanGrill,CharlesUniv.inPrague(CzechRepublic). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8507-32]
Growth of CZT using additionally zone-refined raw materials,DavidJ.Knuteson,N.B.Singh,AndreBerghmans,DavidKahler,BrianWagner,MatthewKing,SeanMclaughlin,NorthropGrummanElectronicSystems(UnitedStates);AlekseyBolotnikov,RalphJames,BrookhavenNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8507-33]
Post-growth annealing investigation of CdZnTe crystals for room-temperature radiation detector applications,GeYang,AlekseyE.Bolotnikov,BrookhavenNationalLab.(UnitedStates);PetroFochuk,YuriyFedkovychChernivtsiNationalUniv.(Ukraine);YonggangCui,GiuseppeS.Camarda,AnwarHossain,KiHyunKim,RubiGul,RalphB.James,BrookhavenNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8507-34]
The electrical properties of SI-CdZnTe and its effects on the performance of CdZnTe detectors,GangqiangZha,TaoWang,YadongXu,WanqiJie,NorthwesternPolytechnicalUniv.(China). . . . . . . . . . . . . . . . . . . . . . . [8507-35]
SESSION 8 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 4:00 to 6:00 pm
CZT IVSession Chair: Arnold Burger, FiskUniv.(UnitedStates)
Enrichment of dislocations surrounding Te inclusions in CdZnTe crystal,YadongXu,YihuiHe,LingyanXu,TaoWang,WanqiJie,NorthwesternPolytechnicalUniv.(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8507-36]
Preliminary results on Bridgman grown CdZnTe detector crystals assisted by ampoule rotation,AmlanDatta,SantoshSwain,SachinBhaladhare,KelvinG.Lynn,WashingtonStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . [8507-37]
Spectral features of high-energy beam hardening as a scatter assay,RobertLevine,XueminJin,DavidReiss,SpectralSciences,Inc.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8507-38]
Structural and electronic properties of polished CdZnTe surfaces for radiation detector applications,SuleymanTari,FikriAqariden,YongChang,ChristophH.Grein,SivananthanLabs.,Inc.(UnitedStates);JinLi,NicholasKioussis,CaliforniaStateUniv.,Northridge(UnitedStates). . . . . . . . . [8507-39]
Effect of crucible rotation on the uniformity of CdZnTe crystals grown by vertical Bridgman method,TaoWang,YuanyuanDu,YihuiHe,LingyanXu,PengfeiYu,LiyingYin,XiChen,YadongXu,GangqiangZha,WanqiJie,NorthwesternPolytechnicalUniv.(China). . . . . . . . . . . . . . . . . . . . . . . [8507-40]
Reduced leakage currents of CdZnTe radiation detectors with HgTe/HgCdTe superlattice contacts,YongChang,CharlesR.Becker,ChristophH.Grein,SivalingamSivananthan,J.Huang,S.Ghosh,Univ.ofIllinoisatChicago(UnitedStates);FikriAqariden,SivananthanLabs.,Inc.(UnitedStates)[8507-41]
Penetrating Radiation Technical Event . . . . . . . . . . . . . . . Tues. 8:00 to 10:00 pm
Chair: James E. Baciak, PacificNorthwestNationalLabs.(UnitedStates)
Thiseventbringstogethertechnologistsandscientistswithinterestsinneutron,x-andgamma-raydetection,spectroscopy,andimagingforallapplications.Speakertobeannounced.
Wednesday 15 AugustSESSION 9 . . . . . . . . . . . . . . . . . . . . . . . . .Wed. 8:00 to 10:10 am
Scintillators IISession Chair: Warnick J. Kernan, PacificNorthwestNationalLab.
(UnitedStates)
Latest advances in large diameter SrI:Eu and CLYC:Ce scintillators for isotope identification (Invited Paper),RastgoH.Hawrami,RadiationMonitoringDevices,Inc.(UnitedStates)andLawrenceLivermoreNationalLab.(UnitedStates)andFiskUniv.(UnitedStates);C.Hines,ImadAbselem,V.Biteman,J.Vaghini,JarekGlodo,WilliamM.Higgins,PatrickO’Dougherty,KanaiS.Shah,RadiationMonitoringDevices,Inc.(UnitedStates);NerineCherepy,StephenA.Payne,LawrenceLivermoreNationalLab.(UnitedStates);ArnoldBurger,FiskUniv.(UnitedStates);LynnA.Boatner,OakRidgeNationalLab.(UnitedStates)[8507-42]
Transparent garnet ceramic scintillators for gamma-ray detection,YiminWang,GaryBaldoni,RadiationMonitoringDevices,Inc.(UnitedStates);WilliamH.Rhodes,CharlesBrecher,ALEMAssociates(UnitedStates);UrmilaShirwadkar,JarekGlodo,RadiationMonitoringDevices,Inc.(UnitedStates);NerineJ.Cherepy,StephenA.Payne,LawrenceLivermoreNationalLab.(UnitedStates);KanaiS.Shah,RadiationMonitoringDevices,Inc.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8507-43]
Fundamental limits on materials properties for semiconducting radiation detection materials,KimF.Ferris,PacificNorthwestNationalLab.(UnitedStates);DumontM.Jones,ProximateTechnologies,LLC(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8507-44]
CXBN: a blueprint for an improved measurement of the cosmic x-ray background,LanceM.Simms,LawrenceLivermoreNationalLab.(UnitedStates);JesseG.Jernigan,LittleH-BarRanch(UnitedStates);JohnP.Doty,MatthewWampler-Doty,NoqsiAerospace,Ltd.(UnitedStates);BenjaminMalphrus,TylerRose,RogerMcNeil,KevinBrown,MoreheadStateUniv.(UnitedStates);StevenE.Anderson,SonomaStateUniv.(UnitedStates);HyoungSupLim,MoreheadStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . [8507-45]
Pulse shape discrimination properties of solid-state organic scintillators,IwonaA.Pawelczak,AndrewM.Glenn,NataliaP.Zaitseva,H.PaulMartinez,BenjaminL.Rupert,M.LeslieCarman,StephenA.Payne,LawrenceLivermoreNationalLab.(UnitedStates)................................. [8507-46]
Medical isotope identification with large mobile detection systems,SanjoyMukhopadhyay,NationalSecurityTechnologies,LLC(UnitedStates). [8507-47]
SESSION 10 . . . . . . . . . . . . . . . . . . . Wed. 10:40 am to 12:20 pm
CZT VSession Chair: Zhong He, Univ.ofMichigan(UnitedStates)
First-principles calculations of defects in Cd(Zn)Te and TlBr (Invited Paper),VincenzoLordi,LawrenceLivermoreNationalLab.(UnitedStates). . . [8507-48]
The hard x-ray polarimeter X-Calibur: astrophysical motivation and performance (Invited Paper),MatthiasBeilicke,HenricKrawczynski,BobBinns,MartinIsrael,RamanathCowsik,JamesBuckley,QingzhenGuo,KuenLee,PaulDowkontt,WashingtonUniv.inSt.Louis(UnitedStates);JackTueller,ScottBarthelmy,TakashiOkajima,JeremySchnittman,NASAGoddardSpaceFlightCtr.(UnitedStates);MatthewBaring,RiceUniv.(UnitedStates);HideyoKunieda,HironoriMatsumoto,YoshitoHaba,KeisukeTamura,TakuyaMiyazawa,NagoyaUniv.(Japan);AlfredGarson,WashingtonUniv.inSt.Louis(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8507-49]
Ab initio thermodynamic studies of the reconstructions of the CdTe (111) surface,JinLi,CaliforniaStateUniv.,Northridge(UnitedStates);SuleymanTari,ChristophH.Grein,FikriAqariden,SivananthanLabs.,Inc.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8507-50]
Evaluation of CdZnTe crystals grown by the Traveling Heater Method,UtpalN.Roy,StephenWeiler,JuergenStein,FLIRSystems,Inc.(UnitedStates);MichaelGroza,YunlongCui,ArnoldBurger,FiskUniv.(UnitedStates);AlekseyBolotnikov,GiuseppeS.Camarda,AnwarHossain,RubiGul,GeYang,RalphJames,BrookhavenNationalLab.(UnitedStates). . . . . . . . . . . . . . . . [8507-51]
Conference 8507
162 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Conference 8508Thursday 16 August 2012 • Proceedings of SPIE Vol. 8508
Medical Applications of Radiation Detectors IIConference Chairs:H. Bradford Barber, ArizonaHealthSciencesCtr.,TheUniv.ofArizona(UnitedStates);Hans Roehrig, ArizonaHealthSciencesCtr.,TheUniv.ofArizona(UnitedStates)
Program Committee:Yonggang Cui, BrookhavenNationalLab.(UnitedStates);F. Patrick Doty, SandiaNationalLabs.,California(UnitedStates);Geoffrey Harding, MorphoDetection(Germany);Ralph B. James, BrookhavenNationalLab.(UnitedStates);Denny L. Lee, DirectXRayDigitalImagingTechnologyLLC(UnitedStates);Rex A. Moats, Children’sHospitalLosAngeles(UnitedStates)andTheUniv.ofSouthernCalifornia(UnitedStates);Vivek V. Nagarkar, RadiationMonitoringDevices,Inc.(UnitedStates);Eiichi Sato, IwateMedicalUniv.(Japan);Michael R. Squillante, RadiationMonitoringDevices,Inc.(UnitedStates)
Monday 13 AugustPosters-Monday . . . . . . . . . . . . . . . . . . . . Mon. 5:30 to 7:30 pm
Conference attendees are invited to attend the poster session on Monday evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
Depth of interaction determination in novel scintillators,GeorgeT.L.Chac,H.BradfordBarber,BrianW.Miller,TheUniv.ofArizona(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8508-16]
Diagnostics of gastric pathology by means of laser fluorescence,ArtemO.Karachevtsev,YuriyFedkovychChernivtsiNationalUniv.(Ukraine) . . [8508-17]
Tuesday 14 AugustPenetrating Radiation Technical Event . . . . . . . . . . . . . . . . . . Tues. 8:00 to 10:00 pm
Chair:James E. Baciak, PacificNorthwestNationalLabs.(UnitedStates)
Thiseventbringstogethertechnologistsandscientistswithinterestsinneutron,x-andgamma-raydetection,spectroscopy,andimagingforallapplications.Speakertobeannounced.
Thursday 16 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . . . Thurs. 8:30 to 10:20 am
Semiconductor Detectors and SystemsSession Chair: H. Bradford Barber, ArizonaHealthSciencesCtr.,The
Univ.ofArizona(UnitedStates)
Status of pixel detectors with Medipix3 readout-electronics for medical applications (Invited Paper),MichaelFiederle,AlexFauler,SimonProcz,M.Pichotka,AndreasZwerger,M.Mix,Albert-Ludwigs-Univ.Freiburg(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8508-01]
Application of TlBr to nuclear medicine imaging (Invited Paper),HadongKim,LeonardJ.Cirignano,AlirezaKargar,AlexeiV.Churilov,GuidoCiampi,WilliamM.Higgins,SuyoungKim,RadiationMonitoringDevices,Inc.(UnitedStates);FredOlschner,Cremat,Inc.(UnitedStates);KanaiS.Shah,RadiationMonitoringDevices,Inc.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8508-02]
Preclinical applications of a new CdZnTe-based gamma camera,YonggangCui,BrookhavenNationalLab.(UnitedStates);TerryLall,HybridyneImagingTechnologies,Inc.(UnitedStates);MarkPeterson,AnimalEndocrineClinic(UnitedStates);AlekseyE.Bolotnikov,GiuseppeS.Camarda,AnwarHossain,KiHyunKim,GeYang,RubiGul,RalphB.James,BrookhavenNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8508-03]
Endorectal probe for imaging prostate cancer using CdZnTe multi-pixel arrays,YonggangCui,BrookhavenNationalLab.(UnitedStates);TerryLall,HybridyneImagingTechnologies,Inc.(Canada);GeorgeMahler,GeorgeMeinken,PaulVaska,AlekseyBolotnikov,GianluigiDeGeronimo,PaulO’Connor,GiuseppeCamarda,AnwarHossain,KiHyunKim,GeYang,RubiGul,BrookhavenNationalLab.(UnitedStates);BenjaminFrancM.D.,RadiologicalAssiciatesofSacramento(UnitedStates);TammieJohnson,RadiologicalAssociatesofSacramento(UnitedStates);YounghoSeo,Univ.ofCalifornia,SanFrancisco(UnitedStates);AndrewRittenboch,BenTsui,TheJohnsHopkinsOutpatientCtr.(UnitedStates);MartinPomperM.D.,TheJohnsHopkinsHospital(UnitedStates);SteveCho,JohnsHopkinsMedicalInstitutions(UnitedStates);KennethWeisman,MidstateHospital(UnitedStates);RalphB.James,BrookhavenNationalLab.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . [8508-04]
SESSION 2 . . . . . . . . . . . . . . . . . . . Thurs. 10:40 am to 12:10 pm
Digital Radiography and CTSession Chair: Lars R. Furenlid, CollegeofOpticalSciences,TheUniv.
ofArizona(UnitedStates)
Optimizing Si detectors and ASIC readouts for high-resolution energy-resolved x-ray imaging (Invited Paper),WilliamC.Barber,DxRay,Inc.(UnitedStates);EinarNygard,JanC.Wessel,NailMalakhov,InteronAS(Norway);NealE.Hartsough,ThulasiGandhi,DxRayInc.(UnitedStates);GregorWawrzyniak,InteronAS(Norway);JanS.Iwanczyk,DxRayInc.(UnitedStates) . . . [8508-05]
Dark-count-less photon-counting x-ray computed tomography system using a YAP-MPPC detector (Invited Paper),EiichiSato,YuichSato,AbulajiangAbudurexiti,IwateMedicalUniv.(Japan);OsahikoHagiwara,HiroshiMatsukiyo,AkihiroOsawa,ToshiyukiEnomoto,ManabuWatanabe,ShinyaKusachi,TheTohoUniv.(Japan);ShigehiroSato,AkiraOgawa,IwateMedicalUniv.(Japan);JunOnagawa,TohokuGakuinUniv.(Japan) . . . . . . . . . . . . . . . . . . . . [8508-06]
High-sensitive computed tomography system using a silicon x-ray diode,EiichiSato,YuichSato,AbulajiangAbudurexiti,IwateMedicalUniv.(Japan);OsahikoHagiwara,HiroshiMatsukiyo,AkihiroOsawa,ToshiyukiEnomoto,ManabuWatanabe,ShinyaKusachi,TheTohoUniv.(Japan);ShigehiroSato,AkiraOgawa,IwateMedicalUniv.(Japan);JunOnagawa,TohokuGakuinUniv.(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8508-07]
Lunch/Exhibition Break.............................. 12:10to1:30pm
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . Thurs. 1:30 to 3:20 pm
SPECT and Other ApplicationsSession Chair: Hans Roehrig, ArizonaHealthSciencesCtr.,TheUniv.
ofArizona(UnitedStates)
Event-parameter estimation and 3D-reconstruction methods for ModPET (Invited Paper),LarsR.Furenlid,StephenK.Moore,HarrisonH.Barrett,TheUniv.ofArizona(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8508-08]
Depth of interaction SPECT imaging using crystalline microcolumnar CsI:Tl films (Invited Paper),HarishB.Bhandari,StuartR.Miller,RadiationMonitoringDevices,Inc.(UnitedStates);BrianW.Miller,H.BradfordBarber,CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates);VivekV.Nagarkar,RadiationMonitoringDevices,Inc.(UnitedStates). . . . . . . . . . . . . . . . [8508-09]
Imaging from Compton cameras using detectors with no spatial resolution capability,BruceD.Smith,TheUniv.ofTexasatSanAntonio(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8508-10]
NPS assessment of color medical displays using a monochromatic CCD camera,HansRoehrig,ArizonaHealthSciencesCtr.,TheUniv.ofArizona(UnitedStates);XiliangGu,ImageQualityLLC(UnitedStates);JiahuaFan,GEHealthcare(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8508-11]
spie.org/opadvance · TEL:+13606763290 · help@spie.org 163
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . Thurs. 3:40 to 5:15 pm
Other Medical ApplicationsSession Chair: Yonggang Cui, BrookhavenNationalLab.(UnitedStates)
Stitched large format CMOS image sensors for dental x-ray digital radiography (Invited Paper),ChiaoLiu,BAESystemsImagingSolutions(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8508-12]
A non-invasive blood glucose meter design using multi-type sensors,DungC.Nguyen,JanetM.Roveda,TheUniv.ofArizona(UnitedStates);HienVuNguyen,KaiserPermanente(UnitedStates). . . . . . . . . . . . . . . . . . . . . [8508-13]
Properties of some pixellated scintillators for use in SPECT,H.BradfordBarber,BrianW.Miller,CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates);GeorgeT.L.Chac,TheUniv.ofArizonaCollegeofMedicine(UnitedStates);DanielLemieux,CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8508-14]
Image quality evaluation of medical color and monochrome displays,HansRoehrig,ArizonaHealthSciencesCtr.,TheUniv.ofArizona(UnitedStates);XiliangGu,ImageQualityLLC(UnitedStates);JiahuaFan,GEHealthcare(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8508-15]
Conference 8508
SPIE thanks the individuals and organizations for their contributions to the SPIE Education fund in 2009.
SPIE provided over $2.5 million in support of education and outreach programs in 2011
SPIEScholarships
EducationOutreachGrants
StudentChapters
StudentActivities
BestStudentPaperPrizes
FreePosters
FreeEducationalCDs,DVDs,andVideos
WomeninOptics
EducationandTraininginOpticsandPhotonicsConference(ETOP)
StudentOutreach
ScienceFairs
OpticsEducationDirectory
FreeSPIEJournalAccessfordevelopingnations
ActiveLearninginOpticsandPhotonics(ALOP):TeacherTraining
InternationalCentreforTheoreticalPhysics(ICTP)WinterCollege
VisitingLecturersProgram
spie.org/altruism
164 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Conference 8509Monday-Wednesday 13-15 August 2012 • Proceedings of SPIE Vol. 8509
Penetrating Radiation Systems and Applications XIIIConference Chairs:Gary P. Grim, LosAlamosNationalLab.(UnitedStates);H. Bradford Barber, CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates)
Program Committee:Patrick Feng, SandiaNationalLabs.,California(UnitedStates);Paul Guss, NationalSecurityTechnologies,LLC(UnitedStates);Khalid M. Hattar, SandiaNationalLabs.(UnitedStates);Ralph B. James, BrookhavenNationalLab.(UnitedStates);Will E. Johns, VanderbiltUniv.(UnitedStates);Michael J. King, RapiscanSystemsLabs.(UnitedStates);Edward A. McKigney, LosAlamosNationalLab.(UnitedStates);Wondwosen Mengesha, PhysicalOpticsCorp.(UnitedStates);Frank Merrill, LosAlamosNationalLab.(UnitedStates);Michael R. Squillante, RadiationMonitoringDevices,Inc.(UnitedStates)
Monday 13 AugustPosters-Monday . . . . . . . . . . . . . . . . . . . . Mon. 5:30 to 7:30 pm
Conference attendees are invited to attend the poster session on Monday evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
MEMS photo-multiplier tubes for low-cost monitoring of scintillated radiological events,JamesC.Nicholson,DanielC.Scoggin,JesseLehmann,DwayneTeamer,Jr.,NicholasGroden,ChesterG.Wilson,LouisianaTechUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8509-19]
Capabilities of dual-energy x-ray imaging in medicine and security,OleksandrD.Opolonin,VolodymyrD.Ryzhikov,BorisGrinyov,SergiyGalkin,InstituteforScintillationMaterials(Ukraine);OlenaK.Lysetska,InstituteofScintillatingMaterials(Ukraine);EvgenVoronkin,InstituteforScintillationMaterials(Ukraine). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8509-20]
Acceleration of electrons by a tightly focused TM01 laser mode,Jean-PhilippeMacLean,ChristopherTchervenkov,StéphanePayeur,SylvainFourmaux,BrunoSchmidt,FrancoisLégaré,InstitutNationaldelaRechercheScientifique(Canada);MichelPiché,Univ.Laval(Canada);Jean-ClaudeKieffer,InstitutNationaldelaRechercheScientifique(Canada). . . . . . . . . . . . [8509-21]
Tuesday 14 AugustPenetrating Radiation Technical Event . . . . . . . . . . . . . . . . . . Tues. 8:00 to 10:00 pm
Chair:James E. Baciak, PacificNorthwestNationalLabs.(UnitedStates)
Thiseventbringstogethertechnologistsandscientistswithinterestsinneutron,x-andgamma-raydetection,spectroscopy,andimagingforallapplications.Speakertobeannounced.
Wednesday 15 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . . .Wed. 8:40 to 9:50 am
Particle SystemsSession Chair: H. Bradford Barber, CollegeofOpticalSciences,The
Univ.ofArizona(UnitedStates)
Pixelated diamond luminosity counter for the Large Hadron Collider (Invited Paper),RobertL.Stone,Rutgers,TheStateUniv.ofNewJersey(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8509-01]
Proton radiography at LANL and its uses,FessehaG.Mariam,LosAlamosNationalLab.(UnitedStates)................................. [8509-02]
Analysis of fusion product data from the National Ignition Facility,GaryP.Grim,FrankMerrill,CarlH.Wilde,NevzatGuler,ChrisR.Danly,PetrVolegov,LosAlamosNationalLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . [8509-03]
SESSION 2 . . . . . . . . . . . . . . . . . . . . Wed. 10:20 am to 12:10 pm
X-Ray/Gamma-Ray Systems ISession Chair: Gary P. Grim, LosAlamosNationalLab.(UnitedStates)
An imaging neutron/gamma-ray spectrometer (Invited Paper),JamesM.Ryan,ChristopherBancroft,PeterF.Bloser,TheUniv.ofNewHampshire(UnitedStates);DominiqueFourguette,LianeLarocque,MichiganAerospaceCorp.(UnitedStates);JasonS.Legere,MarkL.McConnell,TheUniv.ofNewHampshire(UnitedStates);GregRitter,GregoryJ.Wassick,MichiganAerospaceCorp.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8509-05]
Recent progress on new x-ray and pulsed particle beam sources at the Advanced Laser Light Source (ALLS) facility,Jean-ClaudeKieffer,SemenGnedyuk,SylvainFourmaux,InstitutNationaldelaRechercheScientifique(Canada);RobertFedosejevs,MianzhenMo,AtifAli,Univ.ofAlberta(Canada);KimTaPhuoc,AntoineRousse,EcoleNationaleSupérieuredeTechniquesAvancées(France);JulienFuchs,EcolePolytechnique(France) . . . . . [8509-06]
Beta decay product measurement in an ultra-high rate environment,AndreasKlein,RobertAragonez,MitziBoswell,MalcolmFowler,JeffreyR.Griego,GaryP.Grim,RobertS.King,RobertRundberg,JeremyWilhelmy,CarlH.Wilde,LosAlamosNationalLab.(UnitedStates). . . . . . . . . . . . . . . [8509-07]
Design of gamma-ray diagnostic imaging system with scintillator characterization,DanielA.Lemieux,CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8509-08]
A curve-fitting approach to radiographic image denoising and deblurring with uncertainty quantification,StephenE.Mitchell,AaronLuttman,NationalSecurityTechnologies,LLC(UnitedStates). . . . . . . . . . . . . . . . . . . . . [8509-09]
Lunch/Exhibition Break.............................. 12:10to1:30pm
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 1:30 to 3:00 pm
X-Ray/Gamma-Ray Systems IISession Chair: Paul Guss, NationalSecurityTechnologies,LLC(United
States)
Development of imaging hard x-ray detectors for the NuSTAR Mission (Invited Paper),FionaHarrison,VarunBhalerao,WalterR.CookIII,BrianW.Grefenstette,TakaoKitaguchi,PeterMao,HiromasaMiyasaka,VikramRana,CaliforniaInstituteofTechnology(UnitedStates). . . . . . . . . . . . . . . . . [8509-10]
Phase contrast imaging with polycapillary optics,HassanAbbas,Univ.atAlbany(UnitedStates);TianxiSun,BeijingNormalUniv.(China);CarolynA.MacDonald,Univ.atAlbany(UnitedStates). . . . . . . . . . . . . . . . . . . . . [8509-11]
Coded aperture-based coherent scatter x-ray imaging system for airport baggage screening,AmarpreetS.Chawla,DukeUniv.(UnitedStates)[8509-12]
Modeling of coherent scatter imaging,LailaHassan,CarolynA.MacDonald,Univ.atAlbany(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8509-13]
spie.org/opadvance · TEL:+13606763290 · help@spie.org 165
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 3:20 to 5:00 pm
MaterialsSession Chair: Daniel A. Lemieux, CollegeofOpticalSciences,The
Univ.ofArizona(UnitedStates)
Preliminary results from an investigation into nanostructured nuclear radiation detectors for non-proliferation applications,PaulGuss,RonaldE.Guise,DingYuan,SanjoyMukhopadhyay,NationalSecurityTechnologies,LLC(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8509-14]
Counterintuitive MCNPX results for scintillator surface roughness effect,DingYuan,PaulGuss,NationalSecurityTechnologies,LLC(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8509-15]
Structural stability of high-Z nanoparticle scintillators,SarahHoppe,KhalidM.Hattar,BernadetteA.Hernandez-Sanchez,TimothyJ.Boyle,JanelleVillone,PinYang,F.PatrickDoty,SandiaNationalLabs.(UnitedStates) . . . . [8509-16]
Size effects on high-z based nanoscintillators,BernadetteA.Hernandez-Sanchez,TimothyJ.Boyle,JanelleVillone,PinYang,MarkKinnan,F.PatrickDoty,KhalidM.Hattar,SandiaNationalLabs.(UnitedStates). . . . . . . [8509-17]
Nanoporous-doped scintillator for species-specific detection of low-level radioactive emitters in aqueous environments,DanielC.Scoggin,JamesC.Nicholson,NicholasGroden,JesseLehmann,DwayneTeamer,Jr.,ChesterG.Wilson,LouisianaTechUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . [8509-18]
Conference 8509
Optics+ Photonics
all paper presentations at this event become part of the world’s largest collection of optics and photonics research
PublishinSPIEProceedings-Timely-Relevant-Cited-Indexed
PresentatSPIEOptics+Photonics-Dynamic-Diverse-Current-Collaborative
SPIEDigitalLibrary.org
166 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Conference 8510Monday-Thursday 13-16 August 2012 • Proceedings of SPIE Vol. 8510
Earth Observing Systems XVIIConference Chairs:James J. Butler, NASAGoddardSpaceFlightCtr.(UnitedStates);Xiaoxiong Xiong, NASAGoddardSpaceFlightCtr.(UnitedStates);Xingfa Gu, InstituteofRemoteSensingApplications(China)
Program Committee:Philip E. Ardanuy, RaytheonIntelligence&InformationSystems(UnitedStates);Robert A. Barnes, NASAGoddardSpaceFlightCtr.(UnitedStates);Hal J. Bloom, EarthResourcesTechnology,Inc.(UnitedStates);Jeffrey S. Czapla-Myers, CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates);Armin Doerry, SandiaNationalLabs.(UnitedStates);Mitchell D. Goldberg, NationalOceanicandAtmosphericAdministration(UnitedStates);Joel McCorkel, NASAGoddardSpaceFlightCtr.(UnitedStates);Thomas S. Pagano, JetPropulsionLab.(UnitedStates);Jeffery J. Puschell, RaytheonSpace&AirborneSystems(UnitedStates);Carl F. Schueler, OrbitalSciencesCorp.(UnitedStates)
Monday 13 AugustPosters-Monday . . . . . . . . . . . . . . . . . . . . Mon. 5:30 to 7:30 pm
Conference attendees are invited to attend the poster session on Monday evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
NPP CrIMSS EDR algorithm validation,SusanH.Kizer,ScienceSystemsApplications,Inc.(UnitedStates);XuLiu,NASALangleyResearchCtr.(UnitedStates);ChristopherD.Barnet,NationalOceanicandAtmosphericAdministration(UnitedStates)andCtr.forSatelliteApplicationsandResearch(UnitedStates);MurtyG.Divakarla,IMSystemsGroup,Inc.(UnitedStates);GuangGuo,PSGS(UnitedStates);XiaozhenXiong,IMSystemsGroup,Inc.(UnitedStates);WilliamJ.Blackwell,VincentLeslie,MITLincolnLab.(UnitedStates);DanielK.Zhou,AllenM.Larar,NASALangleyResearchCtr.(UnitedStates);WilliamSmith,HamptonUniv.(UnitedStates). . . . . . . . . . . . . [8510-58]
Analog and digital saturation in the MODIS reflective solar bands,SriharshaMadhavan,AmitAngal,ScienceSystemsandApplications,Inc.(UnitedStates);JenniferL.Dodd,JunqiangSun,SigmaSpaceCorp.(UnitedStates);XiaoxiongXiong,NASAGoddardSpaceFlightCtr.(UnitedStates). . . . . . . . . . . [8510-59]
Combining passive polarimetric remote sensing and advanced measurements of lidar intensive variables in vertically resolved aerosol retrievals,JamesW.Frost,LawrenceMuller,Lynn-MariRodriquez,LaGuardiaCommunityCollege(UnitedStates);SharonP.Burton,RichardFerrare,ChrisA.Hostetler,NASALangleyResearchCtr.(UnitedStates);BrianCairns,NASAGoddardInstituteforSpaceStudies(UnitedStates) . . . . . . . . . . . . . . [8510-60]
Evolving high-fidelity climate sensor simulators to preserve climate data record continuity,KellyK.Teague,ScienceSystemsandApplications,Inc.(UnitedStates);GeorgeL.Smith,NationalInstituteofAerospace(UnitedStates);KoryJ.Priestley,NASALangleyResearchCtr.(UnitedStates). . . . . . [8510-60]
Characterization of NPP Visible/Infrared Imager Radiometer Suite (VIIRS) reflective solar bands dual gain anomaly,ShihYanLee,JeffMcIntire,HassanOudrari,SigmaSpaceCorp.(UnitedStates) . . . . . . . . . . . . . . . . . . . . [8510-61]
Monitoring and assessment of the temperature fluctuation of Aqua MODIS cold focal plane assembly,ZhipengWang,SigmaSpaceCorp.(UnitedStates);SriharshaMadhavan,ScienceSystemsandApplications,Inc.(UnitedStates);XiaoxiongXiong,NASAGoddardSpaceFlightCtr.(UnitedStates);AishengWu,BrianWenny,SigmaSpaceCorp.(UnitedStates) . . . . . . . . . . . . . . . . [8510-62]
Assessment of the VIIRS RVS for the thermal emissive bands using the first pitch maneuver observations,AishengWu,SigmaSpaceCorp.(UnitedStates);XiaoxiongXiong,NASAGoddardSpaceFlightCtr.(UnitedStates);ChengboSun,SigmaSpaceCorp.(UnitedStates) . . . . . . . . . . . . . . . [8510-63]
Early assessment of VIIRS onboard calibrators performance in support of VIIRS SDR radiometric calibration,KwofuChiang,SigmaSpaceCorp.(UnitedStates);XiaoxiongXiong,NASAGoddardSpaceFlightCtr.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8510-64]
Tuesday 14 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . Tues. 8:20 to 10:00 am
Earth Radiation Budget Missions and InstrumentsSession Chair: Xiaoxiong Xiong, NASAGoddardSpaceFlightCtr.
(UnitedStates)
SCARAB: first results of the Scanner for Radiative Budget on board the Indo-French satellite Megha-Tropiques,ThierryL.Trémas,AlainRosak,Ctr.Nationald’ÉtudesSpatiales(France) . . . . . . . . . . . . . . . . . . . . . . . . . . [8510-01]
On-orbit solar calibration methods using the Clouds and Earth’s Radiant Energy (CERES) in-flight Mirror Attenuator Mosaic(MAM) calibration system,RobertS.Wilson,ScienceSystemsandApplications,Inc.(UnitedStates);KoryJ.Priestley,NASALangleyResearchCtr.(UnitedStates);PhillipC.Hess,SusanThomas,ScienceSystemsandApplications,Inc.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8510-02]
Performance stability of the Clouds and Earth’s Radiant Energy System (CERES) instrument sensors on board the Aqua and Terra spacecraft,MohanShankar,ScienceSystemsandApplications,Inc.(UnitedStates);KoryJ.Priestley,NASALangleyResearchCtr.(UnitedStates);SusanThomas,PhillipC.Hess,DaleR.Walikainen,NathanielP.Smith,ScienceSystemsandApplications,Inc.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8510-03]
Performance of the Clouds and the Earth Radiant Energy System (CERES) Flight Model 5 (FM5) instrument on NPP mission,SusanThomas,ScienceSystemsandApplications,Inc.(UnitedStates);KoryJ.Priestley,NASALangleyResearchCtr.(UnitedStates);PhillipC.Hess,RobertS.Wilson,NathanielP.Smith,MarkG.Timcoe,MohanShankar,DaleR.Walikainen,ScienceSystemsandApplications,Inc.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . [8510-04]
A strategy to assess the pointing accuracy of the CERES (FM5) scanner,NathanielP.Smith,Z.PeterSzewczyk,ScienceSystemsandApplications,Inc.(UnitedStates)andNASALangleyResearchCtr.(UnitedStates);KoryJ.Priestley,NASALangleyResearchCtr.(UnitedStates). . . . . . . . . . . . [8510-05]
SESSION 2 . . . . . . . . . . . . . . . . . . . . Tues. 10:30 am to 12:30 pm
New Missions and InstrumentsSession Chair: Thomas S. Pagano, JetPropulsionLab.(UnitedStates)
Early orbit operations performance of the Suomi NPP OMPS instrument,MatthewG.Kowalewski,GoddardEarthSciencesandTechnologyCtr.(UnitedStates);ScottJ.Janz,NASAGoddardSpaceFlightCtr.(UnitedStates);ChunhuiPan,Univ.ofMaryland,CollegePark(UnitedStates). . . . . . . . . . . . . . [8510-06]
Next-generation pushbroom filter radiometers for remote sensing,RichardW.Tarde,MichaelG.Dittman,GeirE.Kvaran,BallAerospace&TechnologiesCorp.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8510-07]
Out of band scatter measurements from OLI optical bandpass filters,PeterD.Fuqua,ChristopherPanetta,JamesD.Barrie,TheAerospaceCorp.(UnitedStates);EugeneWaluschka,NASAGoddardSpaceFlightCtr.(UnitedStates);ThomasMooney,MaterionBarrPrecisionOptics&ThinFilmCoatings(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8510-08]
Dark and background response of the Landsat 8 thermal infrared sensor,KellyJ.Vanderwerff,SGT,Inc.(UnitedStates);MatthewMontanaro,SigmaSpaceCorp.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8510-09]
Instrumentation and first results of the Reflected Solar Demonstration System for the Climate Absolute Radiance and Refractivity Observatory,JoelMcCorkel,KurtisJ.Thome,DouglasM.Rabin,BrendanMcAndrew,DonaldE.Jennings,JasonH.Hair,AdrianDaw,AllenW.Lunsford,NASAGoddardSpaceFlightCtr.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8510-10]
spie.org/opadvance · TEL:+13606763290 · help@spie.org 167
Multislit optimized spectrometer for ocean color remote sensing,TimValle,ChuckHardesty,BallAerospace&TechnologiesCorp.(UnitedStates);CurtissO.Davis,NicholasTufillaro,OregonStateUniv.(UnitedStates);MichelleStephens,WilliamS.Good,PeterT.Spuhler,BallAerospace&TechnologiesCorp.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8510-11]
Lunch/Exhibition Break.............................. 12:30to2:00pm
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 2:00 to 3:20 pm
Pre-Launch Calibration and CharacterizationSession Chair: Jeffrey S. Czapla-Myers, CollegeofOpticalSciences,
TheUniv.ofArizona(UnitedStates)
The distance dependences and spatial uniformities of spectral irradiance standard lamps,HowardW.Yoon,NationalInstituteofStandardsandTechnology(UnitedStates);GaryS.Graham,ITTCorp.(UnitedStates);RobertD.Saunders,YuqinZong,EricL.Shirley,NationalInstituteofStandardsandTechnology(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8510-12]
The validation of the dissemination of spectral irradiance values using FEL lamps,CarolJohnson,NationalInstituteofStandardsandTechnology(UnitedStates);GaryS.Graham,ITTCorp.(UnitedStates);RobertD.Saunders,HowardW.Yoon,EricL.Shirley,NationalInstituteofStandardsandTechnology(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8510-13]
Preferred mirror coatings for UV, visible, and IR space optical instruments,JamesB.Heaney,LonnyR.Kauder,ScottC.Freese,SGT,Inc.(UnitedStates);ManuelA.Quijada,NASAGoddardSpaceFlightCtr.(UnitedStates). [8510-14]
New approach to spectral features modeling,HedservanBrug,TNOScienceandIndustry(Netherlands) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8510-15]
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 3:50 to 5:50 pm
On-Orbit Calibration and CharacterizationSession Chair: Joel McCorkel, NASAGoddardSpaceFlightCtr.(United
States)
On-orbit performance of MODIS solar diffuser stability monitor,XiaoxiongXiong,NASAGoddardSpaceFlightCtr.(UnitedStates);AmitAngal,ScienceSystemsandApplications,Inc.(UnitedStates) . . . . . . . . . . . . . . . . . . [8510-16]
Recent progress of MODIS solar diffuser on-orbit degradation characterization,HongdaChen,ZhipengWang,JunqiangSun,SigmaSpaceCorp.(UnitedStates);AmitAngal,ScienceSystemsandApplications,Inc.(UnitedStates);XiaoxiongXiong,NASAGoddardSpaceFlightCtr.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8510-17]
MODIS reflective solar bands time-dependent response versus scan angle,JunqiangSun,SigmaSpaceCorp.(UnitedStates);XiaoxiongXiong,NASAGoddardSpaceFlightCtr.(UnitedStates);AmitAngal,ScienceSystemsandApplications,Inc.(UnitedStates);HongdaChen,XuGeng,AishengWu,SigmaSpaceCorp.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8510-18]
On-board calibration radiance error correction for MetOp/AVHRR IR channel,TiejunChang,I.M.SystemsGroup(UnitedStates);XiangqianWu,NationalOceanicandAtmosphericAdministration(UnitedStates). . . [8510-19]
On-orbit characterization of the GOES-13 Imager channel-to-channel co-registration,MichaelG.Grotenhuis,EarthResourcesTechnology,Inc.(UnitedStates);XiangqianWu,ChangyongCao,NationalOceanicandAtmosphericAdministration(UnitedStates)andNationalEnvironmentalSatellite,Data,andInformationService(UnitedStates)andSTAR(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8510-20]
Recent advances in calibration of GOES Imager visible channel at NOAA,CharlesDean,I-LokChang,EarthResourcesTechnology,Inc.(UnitedStates);ZhenpingLi,SGT,Inc.(UnitedStates);MichaelWeinreb,RiversideTechnology,Inc.(UnitedStates);XiangqianWu,NationalOceanicandAtmosphericAdministration(UnitedStates)andNationalEnvironmentalSatellite,Data,andInformationService(UnitedStates)andSTAR(UnitedStates);FangfangYu,EarthResourcesTechnology,Inc.(UnitedStates). . . . . . . . . . . . . . . . [8510-21]
Wednesday 15 AugustSESSION 5 . . . . . . . . . . . . . . . . . . . . . . . . .Wed. 8:30 to 10:10 am
Instrument Cross-Comparison and Vicarious CalibrationSession Chair: Mitchell D. Goldberg, NationalOceanicand
AtmosphericAdministration(UnitedStates)
Cross-calibration of imaging sensors using model-based, SI-traceable predictions of at-sensor radiance,KurtisJ.Thome,JoelMcCorkel,NASAGoddardSpaceFlightCtr.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . [8510-22]
A comparative study of stripe noise on MODIS/VIIRS thermal emissive bands,MarouanBouali,NationalOceanicandAtmosphericAdminstration(UnitedStates)andNationalEnvironmentalSatellite,Data,andInformationService(UnitedStates);AlexanderIgnatov,NationalOceanicandAtmosphericAdministration(UnitedStates)andNationalEnvironmentalSatellite,Data,andInformationService(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . [8510-23]
NPP VIIRS and Aqua MODIS RSB comparison using observations from simultaneous nadir overpasses (SNO),AishengWu,SigmaSpaceCorp.(UnitedStates);XiaoxiongXiong,NASAGoddardSpaceFlightCtr.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8510-24]
Using SCIAMACHY to improve corrections for spectral band differences when transferring calibration between visible sensors,BenjaminScarino,ScienceSystemsandApplications,Inc.(UnitedStates);DavidR.Doelling,NASALangleyResearchCtr.(UnitedStates);DanielL.Morstad,RajendraBhatt,ScienceSystemsandApplications,Inc.(UnitedStates);ConstantineLukashin,PatrickMinnis,NASALangleyResearchCtr.(UnitedStates). . . . . . . . [8510-25]
Refined algorithms for star-based monitoring of GOES Imager visible-channel responsivities,I-LokChang,CharlesDean,EarthResourcesTechnology,Inc.(UnitedStates);ZhenpingLi,SGT,Inc.(UnitedStates);MichaelP.Weinreb,RiversideTechnology,Inc.(UnitedStates);XiangqianWu,NationalOceanicandAtmosphericAdministration(UnitedStates)andNationalEnvironmentalSatellite,Data,andInformationService(UnitedStates)andSTAR(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8510-26]
SESSION 6 . . . . . . . . . . . . . . . . . . . . Wed. 10:40 am to 12:00 pm
Atmospheric Infrared SounderSession Chair: Armin Doerry, SandiaNationalLabs.(UnitedStates)
Relative trends of AIRS and IASI radiometric calibrations,DenisA.Elliott,JetPropulsionLab.(UnitedStates);LarrabeeStrow,Univ.ofMaryland,BaltimoreCounty(UnitedStates);HartmutH.Aumann,JetPropulsionLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8510-27]
Validation of the radiometric stability of the Atmospheric Infrared Sounder,HartmutH.Aumann,JetPropulsionLab.(UnitedStates);DenisA.Elliott,CaliforniaInstituteofTechnology(UnitedStates)andJetPropulsionLab.(UnitedStates);LarrabeeStrow,Univ.ofMaryland,BaltimoreCounty(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8510-28]
Significant advances in the AIRS Science Team Version-6 retrieval algorithm,JoelSusskind,JohnM.Blaisdell,NASAGoddardSpaceFlightCtr.(UnitedStates);LenaIredell,SAIC(UnitedStates);GyulaI.Molnar,MorganStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8510-29]
Level 1C product from AIRS,EvanM.Manning,HartmutH.Aumann,YiboJiang,JetPropulsionLab.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . [8510-30]
Lunch/Exhibition Break.............................. 12:00to1:40pm
SESSION 7 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 1:40 to 3:00 pm
Remote Sensing Data AnalysisSession Chair: Robert A. Barnes, NASAGoddardSpaceFlightCtr.
(UnitedStates)
GIMS technology in remote monitoring of marine ecosystems,FerdenantMkrtchyan,InstituteofRadioEngineeringandElectronics(RussianFederation) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8510-31]
Remote sensing and mountainous regions in Iran,AliFarzaneh,ANREO(Iran,IslamicRepublicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8510-32]
Circulation indices of the Aleutian low pressure system: its definitions and relationships to NH climate anomalies,LipingLi,PanxingWang,NanjingUniv.ofInformationScience&Technology(China). . . . . . . . . . . . . . . . . . . . [8510-33]
Remote sensing monitoring of sea ice based on NOAA/AVHRR data,JunyiShi,JianmaoGuo,NanjingUniv.ofInformationScience&Technology(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8510-34]
Conference 8510
168 spie.org/opadvance · TEL:+13606763290 · help@spie.org
SESSION 8 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 3:30 to 5:10 pm
VIIRS ISession Chair: Jeffery J. Puschell, RaytheonSpace&Airborne
Systems(UnitedStates)
Radiometric calibration of a 100 cm sphere integrating source for VIIRS solar diffuser stability monitor bands,EugeneD.Kim,VijayMurgai,ReinhardW.Menzel,RaytheonSpace&AirborneSystems(UnitedStates). . . . [8510-35]
Preliminary assessment of Suomi-NPP VIIRS on-orbit radiometric performance,HassanOudrari,SigmaSpaceCorp.(UnitedStates);FrankJ.DeLuccia,TheAerospaceCorp.(UnitedStates);JeffMcIntire,SigmaSpaceCorp.(UnitedStates);DavidI.Moyer,TheAerospaceCorp.(UnitedStates);KwofuChiang,SigmaSpaceCorp.(UnitedStates);XiaoxiongXiong,JamesJ.Butler,NASAGoddardSpaceFlightCtr.(UnitedStates). . . . . . . . . . . . . . . . . [8510-36]
VIIRS day-night band calibration and on-orbit performance,JasonGeis,ChristopherJ.Florio,DavidMoyer,KameronW.Rausch,FrankJ.DeLuccia,TheAerospaceCorp.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . [8510-37]
NPP VIIRS early on-orbit geometric performance,RobertE.Wolfe,NASAGoddardSpaceFlightCtr.(UnitedStates);GuoqingLin,INNOVIM(UnitedStates)andNASAGoddardSpaceFlightCtr.(UnitedStates);NishihamaMasahiro,SigmaSpaceCorp.(UnitedStates);KrishnaP.Tewari,INNOVIM(UnitedStates);EnriqueL.Montano,SigmaSpaceCorp.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8510-38]
NPP VIIRS SDR postlaunch calibration/validation: an overview of progress, challenges, and the way forward,ChangyongCao,NationalOceanicandAtmosphericAdministration(UnitedStates);FrankDeLuccia,TheAerospaceCorp.(UnitedStates);XiaoxiongXiong,NASAGoddardSpaceFlightCtr.(UnitedStates);FuzhongWeng,BruceGuenther,NationalOceanicandAtmosphericAdministration(UnitedStates);JamesJ.Butler,NASAGoddardSpaceFlightCtr.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8510-39]
Thursday 16 AugustSESSION 9 . . . . . . . . . . . . . . . . . . . . . . . Thurs. 8:30 to 10:10 am
VIIRS IISession Chair: Carl F. Schueler, OrbitalSciencesCorp.(UnitedStates)
Characterization and performance of the NPP/VIIRS solar diffuser stability monitor,JonFulbright,NingLei,KwofuChiang,SigmaSpaceCorp.(UnitedStates);XiaoxiongXiong,NASAGoddardSpaceFlightCtr.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8510-40]
VIIRS solar diffuser bidirectional reflectance distribution function (BRDF) degradation factor operational trending and update,EvanM.Haas,DavidMoyer,FrankJ.DeLuccia,TheAerospaceCorp.(UnitedStates);JonFulbright,SigmaSpaceCorp.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . [8510-41]
Characterization of earthshine impacts on Visible/Infrared Imager Radiometer Suite reflective solar bands calibration,ShihYanLee,JeffMcIntire,HassanOudrari,SigmaSpaceCorp.(UnitedStates) . . . . . . [8510-42]
Initial on-orbit radiometric calibration of Soumi NPP VIIRS reflective solar bands,NingLei,JonFulbright,KwofuChiang,SigmaSpaceCorp.(UnitedStates);XiaoxiongXiong,NASAGoddardSpaceFlightCtr.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8510-43]
Operational calibration of VIIRS reflective solar band sensor data records,JasonC.Cardema,KameronW.Rausch,TheAerospaceCorp.(UnitedStates);NingLei,SigmaSpaceCorp.(UnitedStates);DavidI.Moyer,FrankJ.DeLuccia,TheAerospaceCorp.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . [8510-44]
SESSION 10 . . . . . . . . . . . . . . . . . . . . . Thurs. 10:40 to 11:40 am
VIIRS IIISession Chair: Hal J. Bloom, EarthResourcesTechnology,Inc.(United
States)
Discovery and characterization of on-orbit degradation of the VIIRS rotating telescope assembly,FrankDeLuccia,DavidI.Moyer,TheAerospaceCorp.(UnitedStates);EricH.Johnson,RaytheonSpaceandAirborneSystems(UnitedStates);KameronW.Rausch,TheAerospaceCorp.(UnitedStates);NingLei,KwofuChiang,SigmaSpaceCorp.(UnitedStates);XiaoxiongXiong,NASAGoddardSpaceFlightCtr.(UnitedStates);EvanM.Haas,TheAerospaceCorp.(UnitedStates);JonFulbright,SigmaSpaceCorp.(UnitedStates);GlennIona,NASAGoddardSpaceFlightCtr.(UnitedStates). . . . . . . . . . . . . . . . . [8510-46]
Root cause determination of on-orbit degradation of the VIIRS rotating telescope assembly,PeterD.Fuqua,JamesD.Barrie,MichaelJ.Meshishnek,MartinCiofalo,Chung-TseChu,JohnChaney,RobertMoision,TheAerospaceCorp.(UnitedStates);LarissaGraziani,SGT,Inc.(UnitedStates). . . . [8510-47]
VIIRS on-orbit optical anomaly: lessons learned,GlennIona,NASAGoddardSpaceFlightCtr.(UnitedStates);EricH.Johnson,StellarSolutions,Inc.(UnitedStates);MarkAyers,FrankJ.DeLuccia,TheAerospaceCorp.(UnitedStates);LarissaGraziani,SGT,Inc.(UnitedStates);BruceGuenther,BrianKennedy,NASAGoddardSpaceFlightCtr.(UnitedStates);CraigJ.Kent,StellarSolutions,Inc.(UnitedStates);RobertW.Lambeck,MEITechnologies,Inc.(UnitedStates);JackXiong,EugeneWaluschka,NASAGoddardSpaceFlightCtr.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8510-48]
Lunch/Exhibition Break........................... 11:40amto1:10pm
SESSION 11 . . . . . . . . . . . . . . . . . . . . . . . Thurs. 1:10 to 2:10 pm
VIIRS IVSession Chair: Philip E. Ardanuy, RaytheonIntelligence&Information
Systems(UnitedStates)
VIIRS thermal emissive bands calibration algorithm and on-orbit performance,DavidI.Moyer,TheAerospaceCorp.(UnitedStates);JeffMcIntire,SigmaSpaceCorp.(UnitedStates);FrankJ.DeLuccia,TheAerospaceCorp.(UnitedStates);BoryanaEfremova,KwofuChiang,SigmaSpaceCorp.(UnitedStates);XiaoxiongXiong,NASAGoddardSpaceFlightCtr.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8510-49]
NPP VIIRS emissive band radiance calibration and analysis,QuanhuaLiu,Univ.ofMaryland(UnitedStates)andNationalOceanicandAtmosphericAdministration(UnitedStates);ChangyongCao,FuzhongWeng,NationalOceanicandAtmosphericAdministration(UnitedStates) . . . . . . . . . . [8510-50]
VIIRS emissive band radiometric performance trending,EricH.Johnson,RaytheonCo.(UnitedStates);CourtneyRanshaw,RaytheonSpace&AirborneSystems(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8510-51]
SESSION 12 . . . . . . . . . . . . . . . . . . . . . . . Thurs. 2:10 to 4:40 pm
VIIRS VSession Chair: James J. Butler, NASAGoddardSpaceFlightCtr.
(UnitedStates)
VIIRS on-orbit calibration for ocean color data processing,RobertE.Eplee,Jr.,SAIC(UnitedStates);GerhardMeister,NASAGoddardSpaceFlightCtr.(UnitedStates);GwynF.Fireman,SAIC(UnitedStates);ThomasC.Stone,U.S.GeologicalSurvey(UnitedStates);KevnR.Turpie,FrederickS.Patt,SAIC(UnitedStates);BryanA.Franz,CharlesR.McClain,NASAGoddardSpaceFlightCtr.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8510-52]
Suomi NPP VIIRS ocean color data product early mission assessment,KevinR.Turpie,SAIC(UnitedStates);BryanA.Franz,CharlesR.McClain,NASAGoddardSpaceFlightCtr.(UnitedStates);WayneD.Robinson,RobertE.Eplee,Jr.,SAIC(UnitedStates);GerhardMeister,NASAGoddardSpaceFlightCtr.(UnitedStates);GwynF.Fireman,FrederickS.Patt,RobertA.Barnes,SAIC(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8510-53]
VIIRS on-orbit calibration and characterization using the moon,JunqiangSun,SigmaSpaceCorp.(UnitedStates);XiaoxiongXiong,JamesJ.Butler,NASAGoddardSpaceFlightCtr.(UnitedStates). . . . . . . . . . . . . . . . . [8510-54]
An overview of NPP VIIRS calibration maneuvers,JamesJ.Butler,NASAGoddardSpaceFlightCtr.(UnitedStates);XiaoxiongXiong,NASAGoddardSpaceFlightCenter(UnitedStates);RobertA.Barnes,FrederickS.Patt,SAIC(UnitedStates);JunqiangSun,KwofuChiang,SigmaSpaceCorp.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8510-55]
Analysis of VIIRS F1 sensor vignetting functions based on yaw maneuver data,JeffMclntire,BoryanaEfremova,SigmaSpaceCorp.(UnitedStates);DavidMoyer,TheAerospaceCorp.(UnitedStates);ShihyanLee,SigmaSpaceCorp.(UnitedStates);XiaoxiongXiong,NASAGoddardSpaceFlightCtr.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8510-56]
VIIRS VisNIR/SMWIR end-of-life sensitivity predictions,VijayMurgai,NeilR.Nelson,EricH.Johnson,KarenE.Yokoyama,RaytheonSpace&AirborneSystems(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8510-57]
Conference 8510
spie.org/opadvance · TEL:+13606763290 · help@spie.org 169
Conference 8511Monday-Tuesday 13-14 August 2012 • Proceedings of SPIE Vol. 8511
Infrared Remote Sensing and Instrumentation XXConference Chairs:Marija Strojnik, Ctr.deInvestigacionesenÓptica,A.C.(Mexico);Gonzalo Paez, Ctr.deInvestigacionesenÓptica,A.C.(Mexico)
Program Committee:John Antoniades, BAESystems(UnitedStates);Gabriele E. Arnold, DeutschesZentrumfürLuft-undRaumfahrte.V.(Germany);Gail J. Brown, AirForceResearchLab.(UnitedStates);Catherine J. Cesarsky, EuropeanSouthernObservatory(Germany);Jam Farhoomand, TechnoScienceCorp.(UnitedStates);Gerald T. Fraser, NationalInstituteofStandardsandTechnology(UnitedStates);John C. Gille, NationalCtr.forAtmosphericResearch(UnitedStates);Sarath D. Gunapala, JetPropulsionLab.(UnitedStates);Dietrich Lemke, Max-Planck-InstitutfürAstronomie(Germany);Neil R. Malone, RaytheonCo.(UnitedStates);Stanley J. Wellard, SpaceDynamicsLab.(UnitedStates);Jan L. Williams, e-SystemsManagementConsultants(UnitedStates);Jürgen Wolf, NASAAmesResearchCtr.(UnitedStates)
Sunday 12 AugustSymposium-Wide Plenary Session . . . . . . . . . . . . . . . . . . . . Sun. 6:00 to 7:25 pm6:00pm: Introduction and Opening Remarks
6:05pm: The Exciting Science of Light with Metamaterials, VladimirM.Shalaev,PurdueUniv.(USA)
6:45pm:Future of Optics and Photonics, BahaaE.A.Saleh,CREOL,TheCollegeofOpitcsandPhotonicsattheUniv.ofCentralFlorida(USA)
Monday 13 AugustWelcome and Opening Remarks . . . . . . . .Mon. 8:30 to 8:50 am
Session Chairs: Marija Strojnik, Ctr.deInvestigacionesenÓptica,A.C.(Mexico);Gonzalo Páez, Ctr.deInvestigacionesenÓptica,A.C.
(Mexico)
SESSION 1 . . . . . . . . . . . . . . . . . . . . . Mon. 8:50 am to 12:20 pm
Infrared Activities at the Jet Propulsion LaboratorySession Chair: Sarath D. Gunapala, JetPropulsionLab.(UnitedStates)
Measuring stable isotope ratios in the Martian atmosphere and regolith using IR tunable laser absorption spectroscopy (Invited Paper),ChristopherR.Webster,JetPropulsionLab.(UnitedStates). . . . . . . . . . . . . . . . . . [8511-24]
Infrared instrument support for HyspIRI-TIR,WilliamR.Johnson,SimonJ.Hook,MarcC.Foote,BjornT.Eng,BrunoM.Jau,JetPropulsionLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8511-07]
Inductively coupled plasma etching for delineation of InAs/GaSb pixels,JeanNguyen,SirB.Rafol,AlexanderSoibel,ArezouKhoshakhlagh,DavidZ.Ting,JohnK.Liu,JasonM.Mumolo,SarathD.Gunapala,JetPropulsionLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8511-16]
Barrier infrared detector research at the Jet Propulsion Laboratory (Invited Paper),DavidZ.Ting,SamA.Keo,JohnK.Liu,JasonM.Mumolo,ArezouKhoshakhlagh,AlexanderSoibel,JeanNguyen,LindaHöglund,SirB.Rafol,CoryJ.Hill,SarathD.Gunapala,JetPropulsionLab.(UnitedStates). [8511-13]
Multicolor QWIP FPAs for hyperspectral thermal emission instruments,AlexanderSoibel,EdwardM.Luong,JasonM.Mumolo,JohnK.Liu,SirB.Rafol,KeoA.Sam,WilliamR.Johnson,DanielW.Wilson,CoryJ.Hill,DavidZ.Ting,SarathD.Gunapala,JetPropulsionLab.(UnitedStates). . . . . . . . . . . [8511-11]
Minority carrier lifetime and photoluminescence studies of antimony-based superlattices,LindaHöglund,AlexanderSoibel,DavidZ.Ting,ArezouKhoshakhlagh,SarathD.Gunapala,JetPropulsionLab.(UnitedStates)[8511-21]
Characterization of infrared focal plane arrays,SirB.Rafol,SarathD.Gunapala,DavidZ.Ting,AlexanderSoibel,ArezouKhoshakhlagh,JeanNguyen,JohnK.Liu,JasonM.Mumolo,SamA.Keo,EdwardM.Luong,LindaHöglund,JetPropulsionLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . [8511-23]
Fundamental and electrical characterization of atomic layer deposited dielectrics on GaSb and InAs substrates,FrankGreer,AnitaM.Fisher,JeanNguyen,AlexanderSoibel,ArezouKhoshakhlagh,RobertKowalczyk,SamA.Keo,EdwardM.Luong,DavidZ.Ting,SarathD.Gunapala,JetPropulsionLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8511-18]
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:20to1:50pm
SESSION 2 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 1:50 to 4:30 pm
Infrared Missions and InstrumentsSession Chairs: Marija Strojnik, Ctr.deInvestigacionesenÓptica,A.C.
(Mexico);Stanley J. Wellard, SpaceDynamicsLab.(UnitedStates)
LINC-NIRVANA for the LBT: setting up the world’s largest NIR binoculars for astronomy (Invited Paper),RalphHofferbert,HaraldBaumeister,ThomasBertram,JürgenBerwein,PeterBizenberger,ArminBoehm,MichaelBoehm,JoseLuisBorelli,MatthieuBrangier,FlorianBriegel,AlbertConrad,FulvioDeBonis,RomanFollert,TomM.Herbst,ArminHuber,FrankKittmann,MartinKürster,WernerLaun,UlrichMall,DanielMeschke,LarsMohr,VianakNaranjo,AlekseiPavlov,Jorg-UwePott,Hans-WalterRix,Ralf-RainerRohloff,EvaSchinnerer,ClemensStorz,JanTrowitzsch,ZhaojunYan,XianyuZhang,Max-Planck-InstitutfürAstronomie(Germany);AndreasEckart,MatthewHorrobin,SteffenRost,ChristianStraubmeier,InkeWank,JensZuther,Univ.zuKöln(Germany);UdoBeckmann,ClausConnot,MatthiasHeininger,TimKroener,EddyNussbaum,DieterSchertl,GerdP.Weigelt,Max-Planck-InstitutfürRadioastronomie(Germany);MariaBergomi,AlessandroBrunelli,JacopoFarinato,RobertoRagazzoni,ValentinaViotto,INAF-OsservatorioAstronomicodiPadova(Italy);CarmeloArcidiacono,EmilianoDiolaiti,ItaloFoppiani,MatteoLombini,LauraSchreiber,INAF-OsservatorioAstronomicodiBologna(Italy);FrancescoD’Alessio,GianlucaLiCausi,DarioLorenzetti,FabrizioVitali,INAF-OsservatorioAstronomicodiRoma(Italy);MarioBertero,PatriziaBoccacci,AndreaLaCamera,Univ.degliStudidiGenova(Italy). . . . . . . . . . . . . [8511-03]
Stratospheric Observatory for Infrared Astronomy (SOFIA) (Invited Paper),EricE.Becklin,SOFIA/USRA(UnitedStates)andNASAAmesResearchCtr.(UnitedStates)andUniv.ofCalifornia,LosAngeles(UnitedStates). . [8511-32]
Infrared remote sensing of planetary surfaces: an overview, outstanding questions, and prospects (Invited Paper),GabrieleE.Arnold,DeutschesZentrumfürLuft-undRaumfahrte.V.(Germany). . . . . . . . . . . . . . . . . [8511-09]
Design and buildup of a fibre-based coherent laser Doppler wind remote sensing system for active control of wind turbine,LeileiShinohara,SiegwartBogatscher,HarshaUmeshBabu,NicoHeussner,ThorstenBeuth,WilhelmStork,KarlsruherInstitutfürTechnologie(Germany) . . . . . . . . . . . . . . [8511-14]
Airborne measurement of atmospheric methane concentration using pulsed lidar,AnandK.Ramanathan,KenjiNumata,StewartT.Wu,StevenX.Li,MarthaW.Dawsey,JianpingMao,StephanR.Kawa,HarisRiris,NASAGoddardSpaceFlightCtr.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8511-15]
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 4:30 to 6:00 pm
Novel Infrared Technologies and In-Flight CalibrationSession Chairs: Gonzalo Páez, Ctr.deInvestigacionesenÓptica,A.C.(Mexico);Sergey N. Mekhontsev, NationalInstituteofStandardsand
Technology(UnitedStates)
Interband cascade lasers for sensing operating in continuous wave mode at room temperature (Invited Paper),SvenHöfling,AdamBauer,RobertWeih,MartinKamp,AlfredA.Forchel,Julius-Maximilians-Univ.Würzburg(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8511-31]
GaAs/AlGaAs resonant tunneling diodes with a GaInNAs absorption layer for telecommunication light sensing,FabianHartmann,FabianLanger,DirkBisping,AMusterer,SvenHöfling,MartinKamp,AlfredW.Forchel,LukasWorschech,Julius-Maximilians-Univ.Würzburg(Germany). . . . . . . . . [8511-30]
Sensitive detectors of terahertz radiation based on Pb1-xSnxTe(In),DmitryDolzhenko,LomonosovMoscowStateUniv.(RussianFederation);AndreyV.Nicorici,InstituteofAppliedPhysics(Moldova);LudmilaI.Ryabova,DmitryR.Khokhlov,LomonosovMoscowStateUniv.(RussianFederation). . . . [8511-01]
170 spie.org/opadvance · TEL:+13606763290 · help@spie.org
In-flight blackbody calibration sources for the GLORIA interferometer,FriedhelmOlschewski,BergischeUniv.Wuppertal(Germany);ChristianRolf,ForschungszentrumJülichGmbH(Germany);PhilippSteffens,BergischeUniv.Wuppertal(Germany);AnneKleinert,ChristofPiesch,AndreasEbersoldt,KarlsruherInstitutfürTechnologie(Germany);ChristianMonte,BerndtGutschwager,JoergHollandt,Physikalisch-TechnischeBundesanstalt(Germany);PeterPreusse,ForschungszentrumJülichGmbH(Germany);FelixFriedl-Vallon,KarlsruherInstitutfürTechnologie(Germany);RalfKoppmann,BergischeUniv.Wuppertal(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . [8511-02]
Posters-Monday . . . . . . . . . . . . . . . . . . . . Mon. 5:30 to 7:30 pmConference attendees are invited to attend the poster session on Monday
evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
Metrological advantages of the light source based on optically connected integrating spheres,LeonidA.Mikheenko,VolodymyrN.Borovytsky,ZaharV.Fesenko,NationalTechnicalUniv.ofUkraine(Ukraine). . . . . . . . . . . . [8511-05]
Improvement of the signal-to-noise ratio in the acquisition of photoplethysmographic images,LuisF.CorralMartinez,GonzaloPaez,MarijaStrojnik,Ctr.deInvestigacionesenÓptica,A.C.(Mexico). . . . . . . . . . [8511-25]
Qualitative performance analysis of a rotationally-shearing interferometer for testing components without rotational symmetry,EnochGutierrez-Herrera,TecnológicodeMonterrey(Mexico);MarijaStrojnik,GonzaloPaez,Ctr.deInvestigacionesenÓptica,A.C.(Mexico);JuanManuelLopez-Ramirez,TecnológicodeMonterrey(Mexico). . . . . . . . . . . . . . . . . . . . . . . . . . . [8511-26]
Methods for edge enhancement in color images based on derivative operations,JorgeL.Flores-Nuñez,Univ.deGuadalajara(Mexico);JoséA.Ferrari,GastónA.Ayubi,J.MatíasDiMartino,ArielFernández,JuliaR.Alonso,Univ.delaRepública(Uruguay) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8511-33]
Vectorial shearing interferometer used in defocus detection,GuillermoGarcía-Torales,JorgeSanchezPreciado,JorgeL.Flores,Univ.deGuadalajara(Mexico). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8511-34]
Implementation of a fluorescence-based thermal-to-visible converter,MarianaAlfaro,GonzaloPaez,MarijaStrojnik,Ctr.deInvestigacionesenÓptica,A.C.(Mexico). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8511-35]
Tuesday 14 AugustSESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . Tues. 8:20 to 11:50 am
Instruments for Infrared Atmospheric ProbingSession Chairs: Gabriele E. Arnold, DeutschesZentrumfürLuft-undRaumfahrte.V.(Germany);Marija Strojnik, Ctr.deInvestigacionesen
Óptica,A.C.(Mexico)
Mexican InfraRed Observation Satellite (MIROS): instrument concept and mission description,EnriquePacheco-Cabrera,Ctr.deInvestigaciónCientíficaydeEducaciónSuperiordeEnsenada(Mexico);MichaelSchmidt,ComisiónNacionalParaelConocimientoyUsodelaBiodiversidad(Mexico);FranciscoJ.Mendieta,Ctr.deInvestigaciónCientíficaydeEducaciónSuperiordeEnsenada(Mexico);EckehardLorenz,DeutschesZentrumfürLuft-undRaumfahrte.V.(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8511-44]
Final correction algorithms for HIRDLS version 7 data (Invited Paper),JohnC.Gille,Univ.ofColoradoatBoulder(UnitedStates)andNationalCtr.forAtmosphericResearch(UnitedStates);CharlesCavanaugh,GeneL.Francis,ChristopherHalvorson,CraigHartsough,BrunoNardi,MariaB.Rivas,LesleySmith,NationalCtr.forAtmosphericResearch(UnitedStates). . . . . . [8511-22]
The engineering model for the multispectral imager of the EarthCARE spacecraft,AbelardoPerez-Albinana,RobertV.Gelsthorpe,AlainLefebvre,EuropeanSpaceResearchandTechnologyCtr.(Netherlands);MaximilianSauer,Klaus-WernerKruse,RalfMünzenmayer,EADSAstriumGmbH(Germany);GuyC.Baister,MarkChang,JulieEverett,AndyBarnes,NigelBates,MattPrice,MarkSkipper,SurreySatelliteTechnologyLtd.(UnitedKingdom);BryanT.G.deGoeij,EllartA.Meijer,FritsvanderKnaap,AdriaanVan’tHof,TNO(Netherlands). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8511-04]
Lessons learned from three years’ operation of TANSO-FTS on GOSAT,HiroshiSuto,AkihikoKuze,KeiShiomi,MasakatsuNakajima,JapanAerospaceExplorationAgency(Japan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8511-20]
Absolute radiance re-calibration of FIRST,HarriLatvakoski,SpaceDynamicsLab.(UnitedStates);MartinMlynczak,DavidG.Johnson,RichardCageao,NASALangleyResearchCtr.(UnitedStates);JasonA.Swasey,KendallJohnson,SpaceDynamicsLab.(UnitedStates). . . . . . . . . . . . . . . . . . [8511-06]
Infrared remote sensing of the ionosphere-thermosphere response to auroral participle precipitation at E-region altitudes,ChristopherJ.Mertens,NASALangleyResearchCtr.(UnitedStates);XiaojingXu,ScienceSystemsandApplications,Inc.(UnitedStates);StanleyJ.Wellard,SpaceDynamicsLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8511-12]
In-orbit performance of the AVHRR, HIRS and AMSU-A instruments onboard MetOp-A and MetOp-B,DouglasR.Battles,HESpaceOperations,Inc.(UnitedStates);RobertW.Lambeck,DellPerotSystems(UnitedStates);AbelardoPerez-Albinana,EuropeanSpaceResearchandTechnologyCtr.(Netherlands);XiangqianWu,ChangyongCao,NOAA-NESDIS(UnitedStates);HelmutBauch,VEGA-DeutschlandGmbH(Germany);FrancoisMontagner,EuropeanOrganisationfortheExploitationofMeteorologicalSatellites(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8511-08]
Recent advances in improvement of forecast skill and understanding climate processes using AIRS Version-5 products (Invited Paper),JoelSusskind,NASAGoddardSpaceFlightCtr.(UnitedStates);GyulaI.Molnar,MorganStateUniv.(UnitedStates);LenaIredell,SAIC(UnitedStates);OresteReale,GESTAR/USRA(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . [8511-29]
SESSION 5 . . . . . . . . . . . . . . . . . . . . Tues. 11:50 am to 12:30 pm
Radiometry and Thermography ISession Chairs: John C. Gille, Univ.ofColoradoatBoulder(United
States);Gonzalo Páez, Ctr.deInvestigacionesenÓptica,A.C.(Mexico)
Expansion of the temperature and wavelength ranges of NIST infrared spectroradiometry capabilities for thermal sources and materials,SergeyN.Mekhontsev,NationalInstituteofStandardsandTechnology(UnitedStates);VladimirKhromchenko,SpaceDynamicsLab.(UnitedStates);BorisWilthan,LeonardM.Hanssen,NationalInstituteofStandardsandTechnology(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8511-10]
Infrared reflectometry of blackbody and radiometer cavities for satellite instrumentation,LeonardM.Hanssen,JinanZeng,NationalInstituteofStandardsandTechnology(UnitedStates) . . . . . . . . . . . . . . . . . . . . . [8511-19]
Lunch/Exhibition Break.............................. 12:30to2:00pm
SESSION 6 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 2:00 to 3:10 pm
Radiometry and Thermography IISession Chairs: John C. Gille, Univ.ofColoradoatBoulder(United
States);Gonzalo Páez, Ctr.deInvestigacionesenÓptica,A.C.(Mexico)
Microscale thermal imaging of advanced organic and polymeric materials (Invited Paper),JunkoMorikawa,TokyoInstituteofTechnology(Japan)[8511-27]
Generation of a GIS-based environment for infrared thermography analysis of buildings,MarcoScaioni,TongjiUniv.(China);ElisabettaRosina,LuigiBarazzetti,MattiaPrevitali,VeronicaRedaelli,PolitecnicodiMilano(Italy) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8511-17]
Simultaneous measurement of temperature and emissivity with stereo dual wavelength thermography,GennaroCardone,Univ.degliStudidiNapoliFedericoII(Italy) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8511-28]
Conference 8511
spie.org/opadvance · TEL:+13606763290 · help@spie.org 171
Conference 8511
SESSION 7 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 3:10 to 6:20 pm
Toward Larger and More Robust Infrared ArraysSession Chairs: Neil R. Malone, RaytheonCo.(UnitedStates);Decosta
Lindsay, RaytheonCo.(UnitedStates)
Performance results from MISSE7 focal plane flown on International Space Station (ISS) for 2 years,NeilR.Malone,RaytheonCo.(UnitedStates)[8511-43]
Blinker pixels in infrared focal plane arrays,RaymondBoe,RaytheonCo.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8511-36]
Lifetime evaluation of field effect transistors,AlbertLinder,RaytheonCo.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8511-37]
LET analysis for space-based focal planes,RickOsgood,RaytheonCo.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8511-38]
Radiometric analysis for infrared focal planes,DecostaLindsay,RaytheonCo.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8511-39]
Large format infrared digital focal planes,MickyHarris,RaytheonCo.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8511-40]
Large format SiPIN focal plane yield advancements,BryanKean,RaytheonCo.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8511-41]
Infrared focal plane alignment capabilities at Raytheon,RussellParlato,RaytheonCo.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8511-42]
Concluding Remarks . . . . . . . . . . . . . . . . . Tues. 6:20 to 6:40 pm
Session Chairs: Marija Strojnik, Ctr.deInvestigacionesenÓptica,A.C.(Mexico);Gonzalo Páez, Ctr.deInvestigacionesenÓptica,A.C.
(Mexico)
172 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Conference 8512Tuesday-Wednesday 14-15 August 2012 • Proceedings of SPIE Vol. 8512
Infrared Sensors, Devices, and Applications IIConference Chairs:Paul D. LeVan, AirForceResearchLab.(UnitedStates);Ashok K. Sood, MagnoliaOpticalTechnologies,Inc.(UnitedStates);Priyalal S. Wijewarnasuriya, U.S.ArmyResearchLab.(UnitedStates);Arvind I. D’Souza, DRSSensors&TargetingSystems,Inc.(UnitedStates)
Program Committee:Sumith Bandara, U.S.ArmyNightVision&ElectronicSensorsDirectorate(UnitedStates);Eustace L. Dereniak, CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates);Nibir K. Dhar, DefenseAdvancedResearchProjectsAgency(UnitedStates);Patti S. Gillespie, U.S.ArmyResearchLab.(UnitedStates);Barbara G. Grant, LinesandLightsTechnology(UnitedStates);Sarath D. Gunapala, JetPropulsionLab.(UnitedStates);John P. Hartke, U.S.MilitaryAcademy(UnitedStates);John E. Hubbs, BallAerospace&TechnologiesCorp.(UnitedStates);Sanjay Krishna, Ctr.forHighTechnologyMaterials(UnitedStates);Michael W. Kudenov, CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates);Randolph E. Longshore, RaytheonMissileSystems(Retired)(UnitedStates);Hiroshi Murakami, JapanAerospaceExplorationAgency(Japan);Manijeh Razeghi, NorthwesternUniv.(UnitedStates);James A. Stobie, BAESystems(UnitedStates);Jimmy Xu, BrownUniv.(UnitedStates);Sung-shik Yoo, NorthropGrummanElectronicSystems(UnitedStates)
Monday 13 AugustPosters-Monday . . . . . . . . . . . . . . . . . . . . Mon. 5:30 to 7:30 pm
Conference attendees are invited to attend the poster session on Monday evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
Optimization of biogas production using MEMS-based near infrared inline-sensor,RaySaupe,Fraunhofer-InstitutfürElektronischeNanosysteme(UnitedStates);ThomasSeider,Fraunhofer-InstitutfürElektronischeNanosysteme(Germany);VolkerStock,Fraunhofer-InstitutfürElektronischeNanosysteme(UnitedStates);ThomasOtto,ThomasGessner,Fraunhofer-InstitutfürElektronischeNanosysteme(Germany) . . . . . . . . . . . . . . . . . . . . . . . . [8512-36]
Tuesday 14 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . Tues. 8:30 to 10:10 am
Graphene and Related DetectorsSession Chairs: Ashok K. Sood, MagnoliaOpticalTechnologies,Inc.
(UnitedStates);Paul D. LeVan, AirForceResearchLab.(UnitedStates)
Graphene science and technology: a new frontier in multifunctional material and electronics (Invited Paper),MadanDubey,U.S.ArmyResearchLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8512-01]
Characterization of polymeric composite films with MWCNT and Ag nanoparticles,MatthewE.Edwards,AshokK.Batra,AshwithK.Chilvery,PadmajaGuggilla,ManmohanD.Aggarwal,AlabamaA&MUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8512-02]
Graphene P-N junction devices: an overview (Invited Paper),JeUngLee,CollegeofNanoscaleScience&Engineering(UnitedStates) . . . . . . . [8512-03]
Design and development of CNT and graphene-based microbolometer for IR imaging applications,AshokK.Sood,E.JamesEgerton,YashR.Puri,MagnoliaOpticalTechnologies,Inc.(UnitedStates);AkinAkturk,NeilGoldsman,Univ.ofMaryland,CollegePark(UnitedStates);NibirK.Dhar,DefenseAdvancedResearchProjectsAgency(UnitedStates);PriyalalWijewarnasuriya,MadanDubey,U.S.ArmyResearchLab.(UnitedStates). . . . . . . . . . . [8512-04]
SESSION 2 . . . . . . . . . . . . . . . . . . . . Tues. 10:40 am to 12:10 pm
EO-IR and ApplicationsSession Chairs: Priyalal S. Wijewarnasuriya, U.S.ArmyResearchLab.
(UnitedStates);Ashok K. Sood, MagnoliaOpticalTechnologies,Inc.(UnitedStates)
EO-IR material and device research at the Army Research Laboratory (Invited Paper),ParvezN.Uppal,U.S.ArmyResearchLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8512-05]
NIR reflectance spectroscopy for nondestructive moisture content determination of different varieties of in-shell peanuts,ChariV.Kandala,JayaSundaram,AgriculturalResearchService(UnitedStates). . . . . . [8512-06]
Overview of HgCdSe material research for IR applications at the Army Research Laboratory,GregoryN.Brill,YuanpingChen,U.S.ArmyResearchLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8512-07]
Common-path interferometer for stimulated Raman scattering (SRS) and coherent anti-stokes Raman scattering applications (CARS),GabrielaNegrete-Gonzalez,Ctr.deInvestigacióneInnovaciónTecnológica(Mexico);HermanL.Offerhaus,Univ.Twente(Netherlands);FernandoMartinez-Pinon,JoseA.Alvarez-Chavez,Ctr.deInvestigacióneInnovaciónTecnológica(Mexico). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8512-08]
Lunch/Exhibition Break.............................. 12:10to1:40pm
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 1:40 to 3:10 pm
Advanced Concepts and MaterialsSession Chairs: Arvind I. D’Souza, DRSSensors&TargetingSystems,
Inc.(UnitedStates);Sumith Bandara, U.S.ArmyNightVision&ElectronicSensorsDirectorate(UnitedStates)
Integrated EO/IR programs at DARPA /MTO (Invited Paper),NibirK.Dhar,DefenseAdvancedResearchProjectsAgency(UnitedStates) . . . . . . [8512-09]
Design and performance modeling of an HgCdTe-based SWIR micro-camera,ChristopherAnton,Episensors,Inc.(UnitedStates);SilviuVelicu,FikriAqariden,EPIRTechnologies,Inc.(UnitedStates). . . . . . . . . . . . . . . . [8512-10]
Novel bit rate limit imposed by SRS calculation in long-haul DWDM systems,DaliaCisneros-Chable,Ctr.deInvestigacióneInnovaciónTecnológica(Mexico);LeliodelaCruz-May,Univ.AutónomadelCarmen(Mexico);MiguelMagana-Loyo,TEINTMEXS.A.(Mexico);JoseA.Alvarez-Chavez,Ctr.deInvestigacióneInnovaciónTecnológica(Mexico). . . . . . . . . . . . . . . . . [8512-11]
Study on fluorescence of Na 2KSb(Cs) multi-alkali photocathode film during growth process,XiaofengLi,NorthNightVisionTechnologyCo.,Ltd.(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8512-12]
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 3:40 to 5:00 pm
Miscellaneous Detector ApplicationsSession Chairs: Paul D. LeVan, AirForceResearchLab.(United
States);Sumith Bandara, U.S.ArmyNightVision&ElectronicSensorsDirectorate(UnitedStates)
Fast scan-fail device for class 1 operation of scanning micromirrors at a high-laser power in the near-infrared region,SiegwartBogatscher,ChristianGiesel,ThorstenBeuth,HarshaUmesh-Babu,LeileiShinohara,NicoHeussner,WilhelmStork,KarlsruherInstitutfürTechnologie(Germany) . . . . . . . [8512-13]
Silver halide integrated waveguides for the mid-infrared,TomerLewi,AbrahamKatzir,TelAvivUniv.(Israel). . . . . . . . . . . . . . . . . . . . . . . . . . [8512-14]
A NiTiNOL membrane controlled by an external heat source,MargaritaTecpoyotl-Torres,RamonCabello-Ruiz,JoseGerardoVera-Dimas,Univ.AutónomadelEstadodeMorelos(Mexico);JorgeVarona,Univ.Panamericana(Mexico). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8512-15]
Study of atmospheric effects on infrared polarization imaging system based on polarized Monte Carlo model,ZhenyueChen,XiaWang,WeiqiJin,BeijingInstituteofTechnology(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8512-16]
spie.org/opadvance · TEL:+13606763290 · help@spie.org 173
Wednesday 15 AugustSESSION 5 . . . . . . . . . . . . . . . . . . . . . . . . Wed. 8:30 to 10:30 pm
III-V and SL DetectorsSession Chairs: Sumith Bandara, U.S.ArmyNightVision&Electronic
SensorsDirectorate(UnitedStates);Arvind I. D’Souza, DRSSensors&TargetingSystems,Inc.(UnitedStates)
Growth and device performance of superlattice-based infrared detectors,ArezouKhoshakhlagh,DavidTing,AlexanderSoibel,LindaHoglund,SamA.Keo,SarathD.Gunapala,JetPropulsionLab.(UnitedStates). . . . . . . [8512-17]
Type-II InAs/GaSb superlattices grown by molecular beam epitaxy for mid- and long-wavelength infrared detector applications,AminAlTorfi,ColumbiaUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8512-18]
Post growth annealing study on LWIR InAs/GaSb superlattices,HeatherJ.Haugan,GailJ.Brown,AirForceResearchLab.(UnitedStates);SaidElhamri,Univ.ofDaytonResearchInstitute(UnitedStates);ShaneePacley,AirForceResearchLab.(UnitedStates);BenjaminV.Olson,ThomasF.Boggess,TheUniv.ofIowa(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8512-19]
Study of the minority carrier lifetime in mid-wavelength infrared InAs/InAs1-xSbx type-II superlattices,ElizabethH.Steenbergen,ArizonaStateUniv.(UnitedStates);BlairConnelly,GraceD.Metcalfe,PaulH.Shen,MichaelWraback,USArmyResearchLab.(UnitedStates);DmitriLubyshev,YuemingQiu,JoelFastenau,AmyW.K.Liu,IQEInc.(UnitedStates);SaidElhamri,Univ.ofDayton(UnitedStates);OrayO.Cellek,Yong-HangZhang,ArizonaStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8512-20]
Infrared photodetectors based on MWIR and LWIR InAs/InAsSb superlattices,HaSulKim,OrayO.Cellek,HuaLi,ShiLiu,ZhiyuanLin,ElizabethH.Steenbergen,Yong-HangZhang,ArizonaStateUniv.(UnitedStates)[8512-21]
Design and development of low dark current SLS detectors for IRFPA applications,AshokK.Sood,RogerE.Welser,MagnoliaOpticalTechnologies,Inc.(UnitedStates);NutanGautam,SanjayKrishna,Ctr.forHighTechnologyMaterials(UnitedStates);EricA.DeCuir,Jr.,PriyalalWijewarnasuriya,U.S.ArmyResearchLab.(UnitedStates);NibirK.Dhar,DefenseAdvancedResearchProjectsAgency(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8512-22]
SESSION 6 . . . . . . . . . . . . . . . . . . . . Wed. 11:00 am to 12:20 pm
Si-based DetectorsSession Chairs: Paul D. LeVan, AirForceResearchLab.(UnitedStates);
Arvind I. D’Souza, DRSSensors&TargetingSystems,Inc.(UnitedStates)
Antimony-doped silicon blocked impurity band (BIB) arrays for low-flux applications,VaikunthKhalap,HenryH.Hogue,DRSSensors&TargetingSystems,Inc.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8512-23]
Studies on transmittance of silicon with AR coating films for IR transparent window,MyeonghoSong,NationalNanofabCtr.(Korea,Republicof)andChungnamNationalUniv.(Korea,Republicof);EunmiPark,MoonSeopHyun,TaeHyunKim,HeeYeounKim,NationalNanofabCtr.(Korea,Republicof);GawonLee,ChungnamNationalUniv.(Korea,Republicof) . . . . . . . . [8512-24]
Silicon PIN diodes for remote sensing,ErnestW.Robinson,ArvindI.D’Souza,DRSSensors&TargetingSystems,Inc.(UnitedStates) . . . . . . . . . . . [8512-25]
Development of large area nanostructured antireflection coatings for EO/IR sensor applications,AshokK.Sood,RogerE.Welser,AdamW.Sood,YashR.Puri,MagnoliaOpticalTechnologies,Inc.(UnitedStates);JaeheeCho,SamsungAdvancedInstituteofTechnology(Korea,Republicof);E.FredSchubert,RensselaerPolytechnicInstitute(UnitedStates);NibirK.Dhar,DefenseAdvancedResearchProjectsAgency(UnitedStates);PriyalalWijewarnasuriya,U.S.ArmyResearchLab.(UnitedStates);MartinB.Soprano,U.S.ArmyResearch,DevelopmentandEngineeringCommand(UnitedStates) . [8512-26]
Lunch/Exhibition Break.............................. 12:20to1:50pm
SESSION 7 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 1:50 to 3:10 pm
Medical ApplicationsSession Chairs: Priyalal Wijewarnasuriya, U.S.ArmyResearchLab.
(UnitedStates);Paul D. LeVan, AirForceResearchLab.(UnitedStates)
Research on application of spectral imaging technology in determining on thermal burn degree,YongquanLuo,LiXianHuang,ChinaAcademyofEngineeringPhysics(China);JunjieYang,JunWu,ThirdMilitaryMedicalUniv.(China);DayongZhang,ChinaAcademyofEngineeringPhysics(China)[8512-27]
Er 3+-doped fibre laser sensor for structural health monitoring applications design,MariaGuadalupePulido-Navarro,GrethellPerez-Sanchez,DaliaCisneros-Chable,JoseA.Alvarez-Chavez,Ctr.deInvestigacióneInnovaciónTecnológica(Mexico) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8512-28]
A fiber loop ringdown urine glucose sensor,MalikKaya,ChujiWang,MississippiStateUniv.(UnitedStates);CharlotteWang,TheMississippiSchoolforMathematicsandScience(UnitedStates). . . . . . . . . . . . . . . . . . . . [8512-29]
SU-8 photoresist microstructure with cytochrome c protein as a sensing pixel for microbolometer,Jian-LunLai,Guo-DungJ.Su,NationalTaiwanUniv.(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8512-30]
SESSION 8 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 3:40 to 5:20 pm
Lasers and THzSession Chairs: Ashok K. Sood, MagnoliaOpticalTechnologies,Inc.(UnitedStates);Priyalal Wijewarnasuriya, U.S.ArmyResearchLab.
(UnitedStates)
Range profile by using compressive sensing in a chaotic lidar,BereniceVerdin,RicardovonBorries,TheUniv.ofTexasatElPaso(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8512-31]
3D active imaging to see through adverse conditions,NicolasRiviere,LaurentHespel,ErwanBernard,RomainCeolato,ONERA(France);MathieuRenaudat,SAGEMSA(France);BernardTanguy,ONERA(France). . . [8512-32]
Terahertz and millimeter-wave plasmonic photoresponse of grating-gated InP and graphene-based HEMT devices,NimaNaderEsfahani,SolidStateScientificCorp.(UnitedStates);RobertE.Peale,Univ.ofCentralFlorida(UnitedStates);WalterR.Buchwald,SolidStateScientificCorp.(UnitedStates);JustinW.Cleary,AirForceResearchLab.(UnitedStates);ChristopherJ.Fredricksen,Univ.ofCentralFlorida(UnitedStates);JoshuaR.Hendrickson,AirForceResearchLab.(UnitedStates);MasahiroIshigami,BenDawson,Univ.ofCentralFlorida(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8512-33]
Single-cycle pulse generation in the course of four-wave mixing in the filament,VeraAndreeva,NicolayPanov,OlgaG.Kosareva,LomonosovMoscowStateUniv.(RussianFederation);SeeLeangChin,Ctr.d’optique,photoniqueetlaser(Canada) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8512-34]
Enhanced directionality of terahertz emission from a cluster of femtosecond filaments in gases,VeraAndreeva,OlgaG.Kosareva,NicolayPanov,LomonosovMoscowStateUniv.(RussianFederation);T.J.Wang,S.Yuan,SeeLeangChin,Ctr.d’optique,photoniqueetlaser(Canada) . [8512-35]
Conference 8512
174 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Conference 8513Thursday 16 August 2012 • Proceedings of SPIE Vol. 8513
Remote Sensing and Modeling of Ecosystems for Sustainability IXConference Chairs:Wei Gao, ColoradoStateUniv.(UnitedStates);Thomas J. Jackson, U.S.Dept.ofAgriculture(UnitedStates)
Conference Co-Chairs:Jinnian Wang, InstituteofRemoteSensingApplications(China);Ni-Bin Chang, Univ.ofCentralFlorida(UnitedStates)
Program Committee:John D. Bolten, NASAGoddardSpaceFlightCtr.(UnitedStates);E. Raymond Hunt, Jr., AgriculturalResearchService(UnitedStates);Brian Robert Johnson, NEON,Inc.(UnitedStates);Thomas U. Kampe, NEON,Inc.(UnitedStates);Xin-Zhong Liang, Univ.ofIllinoisatUrbana-Champaign(UnitedStates);Dennis Ojima, ColoradoStateUniv.(UnitedStates);John J. Qu, GeorgeMasonUniv.(UnitedStates);David Riaño, Univ.ofCalifornia,Davis(UnitedStates);Jiong Shu, EastChinaNormalUniv.(China);Qiao Wang, MinistryofEnvironmentalProtection(China);Hongjie Xie, TheUniv.ofTexasatSanAntonio(UnitedStates);Denghua Yan, ChinaInstituteofWaterResourcesandHydropowerResearch(China);Xiaobing Zhou, MontanaTech(UnitedStates)
Monday 13 AugustPosters-Monday . . . . . . . . . . . . . . . . . . . . Mon. 5:30 to 7:30 pm
Conference attendees are invited to attend the poster session on Monday evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
A study of retrieval and validation of atmospheric sounding profiles using infrared hyperspectral measurements AIRS,ChaoshunLiu,EastChinaNormalUniv.(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8513-15]
Dynamic modelling of future land-use change: a comparison between CLUE-S and Dinamica EGO models,WeiYi,ZhiqiangGao,InstituteofGeographicalSciencesandNatureResourcesResearch(China) . . . . [8513-16]
Land-use and land-cover sceneries in China: an application of Dinamica EGO model,WeiYi,InstituteofGeographicalSciencesandNatureResourcesResearch(China)andGraduateUniv.oftheChineseAcademyofSciences(China);ZhiqiangGao,InstituteofGeographicalSciencesandNatureResourcesResearch(China);ZhihuaLi,EastChinaNormalUniv.(China). . . . . . . [8513-17]
The spatio-temporal analysis between carbon dioxide and fire in China using multisensor data,CongZhou,EastChinaNormalUniv.(China)[8513-18]
Spatially and seasonally nonstationary relationships between PM10 and related factors in Eastern China by geographically weighted regression,YuanyuanChen,EastChinaNormalUniv.(China). . . . . . . . . . . . . . . . [8513-19]
Population dynamics in Yangtze River delta: a neural-network and spatial statistical analysis,ChaoWang,EastChinaNormalUniv.(China). . . [8513-20]
Multiscale remote-sensing retrieval in the evapotranspiration of Haloxylon ammodendron in the Gurbantunggut desert, China,XiaomingCao,GraduateUniv.oftheChineseAcademyofSciences(China);JuanleWang,ZhiqiangGao,InstituteofGeographicalSciencesandNaturalResourcesResearch(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8513-21]
The differences analysis of UHI character between air temperature and LST,KeLiu,InstituteofRemoteSensingApplications(China);WeiGao,EastChinaNormalUniv.(China);XingfaGu,InstituteofRemoteSensingApplications(China);ZhiqiangGao,InstituteofGeographicalSciencesandNaturalResourcesResearch(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8513-22]
Water consumption and transpiration of Haloxylon ammodendron in hinterland of Gurbantunggut desert,XiaomingCao,GraduateUniv.oftheChineseAcademyofSciences(China);ZhiqiangGao,JuanleWang,InstituteofGeographicalSciencesandNaturalResourcesResearch(China). . . . [8513-23]
Relationships between urban heat island effect and land use around weather stations,KeLiu,XingfaGu,InstituteofRemoteSensingApplications(China);WeiGao,EastChinaNormalUniv.(China);ZhiqiangGao,InstituteofGeographicSciencesandNaturalResourcesResearch(China);TaoYu,InstituteofRemoteSensingApplications(China). . . . . . . . . . . . . . . . . . . . . . . . [8513-24]
The simulation of land surface process with MODIS data in Haihe basin, China,ZhiqiangGao,InstituteofGeographicalSciencesandNaturalResourcesResearch(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8513-25]
The analysis of net primary productivity in China based on GEOLUE model,ZhiqiangGao,InstituteofGeographicalSciencesandNaturalResourcesResearch(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8513-26]
Optical controlling methods of plants under external influence,LarisaTaskina,ElenaV.Timchenko,SamaraStateAerospaceUniv.(RussianFederation) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8513-27]
Analysis on the spatial-temporal variations of methane over China,JinnianWang,LifuZhang,HengqianZhao,TaixiaWu,InstituteofRemoteSensingApplications(China)........................................ [8513-28]
A method for capturing the solar shape and intensity on occurrence of solar occultation,LiqinKong,YuejinZhao,LiquanDong,BeijingInstituteofTechnology(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8513-29]
Using remote sensing data and crop model to simulate regional winter wheat growth,JiaYang,JianmaoGuo,NanjingUniv.ofInformationScience&Technology(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8513-30]
Thursday 16 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . . . Thurs. 8:30 to 10:10 am
Vegetation ParametersSession Chair: Ni-Bin Chang, Univ.ofCentralFlorida(UnitedStates)
Remote sensing of fuel moisture content from the ratios of canopy water indices with a foliar dry matter index,E.RaymondHunt,Jr.,AgriculturalResearchService(UnitedStates);LingliWang,JohnJ.Qu,XianjunHao,GeorgeMasonUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8513-01]
Estimating the vegetation water content using a radar vegetation index,ThomasJ.Jackson,U.S.Dept.ofAgriculture(UnitedStates);YihyunKim,NationalAcademyofAgriculturalScience(Korea,Republicof);RajatBindlish,U.S.Dept.ofAgriculture(UnitedStates);HoonyolLee,KangwonNationalUniv.(Korea,Republicof);SukYoungHong,NationalAcademyofAgriculturalScience(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8513-02]
Remote sensing of ash tree health associated with the emerald ash borer via analyses of fluctuations in land-based and satellite-based data indices,GeorgeTremberger,Jr.,PaulJ.Marchese,ToddHolden,TakD.Cheung,QueensboroughCommunityCollege(UnitedStates). . . . . . . . . . . . . . [8513-03]
Atmospheric correction of EO-1 Hyperion data using multifilter rotating shadowband radiometer (MFRSR),MaosiChen,ColoradoStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8513-04]
Assessment of RADARSAT-2 quad-polarization SAR data in rice crop mapping and yield estimation,ShenbinYang,ShuangheShen,XiaoyanZhao,NanjingUniv.ofInformationScience&Technology(China). . . . . . . . . [8513-05]
spie.org/opadvance · TEL:+13606763290 · help@spie.org 175
SESSION 2 . . . . . . . . . . . . . . . . . . . Thurs. 10:40 am to 12:00 pm
Climate and CarbonSession Chair: E. Raymond Hunt, Jr., AgriculturalResearchService
(UnitedStates)
Monitoring the total organic carbon concentrations in a lake with the integrated data fusion and mining technique,Ni-BinChang,Univ.ofCentralFlorida(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8513-06]
Long-wave infrared imaging of vegetation for detecting leaking CO 2 gas,JenniferE.Johnson,JosephA.Shaw,PaulW.Nugent,RickL.Lawrence,JustinA.Hogan,LauraDobeck,LeeH.Spangler,MontanaStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8513-07]
Simulation studies for comparative evaluation of alternative spectral regions for the sensing of CO 2 and O 2 suitable for the ASCENDS Mission,NarasimhaS.Prasad,DenisV.Pliutau,NASALangleyResearchCtr.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8513-08]
Cross wavelet analysis for retrieving climate teleconnection signals between sea surface temperature and forest greenness,Ni-BinChang,Univ.ofCentralFlorida(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8513-09]
Lunch/Exhibition Break.............................. 12:00to1:30pm
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . Thurs. 1:30 to 3:10 pm
Crops and VegetationSession Chair: Thomas J. Jackson, U.S.Dept.ofAgriculture(United
States)
The Shortwave Infrared Perpendicular Water Stress Index (SPSI) and its application in drought monitoring,HongweiZhang,Huai-liangChen,HenanInstituteofMeteorologicalScience(China). . . . . . . . . . . . . . . . . . . . . . [8513-10]
Analysis on the environment comparison along the Silk Road during 2000 years using spatial technology,XingxingWang,Ctr.forEarthObservationandDigitalEarth(China);GuilinLuo,CentralSouthUniv.(China);JiantaoBi,Ctr.forEarthObservationandDigitalEarth(China). . . . . . . . . . . . . . . . . . . . . [8513-11]
Inversion land surface temperature by using TM data,XiangyunHan,JianmaoGuo,NanjingUniv.ofInformationScience&Technology(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8513-12]
Simulation of regional winter wheat growth by using remote sensing data and crop model,QiWang,JianmaoGuo,ZhengTengfei,NanjingUniv.ofInformationScience&Technology(China). . . . . . . . . . . . . . . . . . . . . . [8513-13]
Estimation rice yield based on integration remote sensing information and crop model,XujieLi,JianmaoGuo,NanjingUniv.ofInformationScience&Technology(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8513-14]
Conference 8513
176 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Conference 8514Sunday-Monday 12-13 August 2012 • Proceedings of SPIE Vol. 8514
Satellite Data Compression, Communications, and Processing VIIIConference Chairs:Bormin Huang, Univ.ofWisconsin-Madison(UnitedStates);Antonio J. Plaza, Univ.deExtremadura(Spain);Carole Thiebaut, Ctr.Nationald’ÉtudesSpatiales(France)
Conference Co-Chairs:Chulhee Lee, YonseiUniv.(Korea,Republicof);Yunsong Li, XidianUniv.(China);Shen-En Qian, CanadianSpaceAgency(Canada)
Program Committee:Philip E. Ardanuy, RaytheonIntelligence&InformationSystems(UnitedStates);Chein-I Chang, Univ.ofMaryland,BaltimoreCounty(UnitedStates);Lena Chang, NationalTaiwanOceanUniversity(Taiwan);Yang-Lang Chang, NationalTaipeiUniv.ofTechnology(Taiwan);Myungjin Choi, KoreaAerospaceResearchInstitute(Korea,Republicof);Qian Du, MississippiStateUniv.(UnitedStates);Yong Fang, NorthwestA&FUniv.(China);Samuel D. Gasster, TheAerospaceCorp.(UnitedStates);Mitchell D. Goldberg, NationalOceanicandAtmosphericAdministration(UnitedStates);Lingjia Gu, JilinUniv.(China);Roger W. Heymann, NationalEnvironmentalSatellite,Data,andInformationService(UnitedStates);Tung-Ju Hsieh, NationalTaipeiUniv.ofTechnology(Taiwan);Matthew A. Klimesh, JetPropulsionLab.(UnitedStates);Sebastian Lopez Suarez, Univ.deLasPalmasdeGranCanaria(Spain);Enrico Magli, PolitecnicodiTorino(Italy);Jarno Mielikainen, Univ.ofEasternFinland(Finland);Abel Paz, Univ.deExtremadura(Spain);Jordi Portell de Mora, Univ.deBarcelona(Spain);Jeffery J. Puschell, RaytheonSpace&AirborneSystems(UnitedStates);Joan Serra-Sagrista, Univ.AutònomadeBarcelona(Spain);Jordi Serra-Ruiz, UniversitatObertadeCatalunya(Spain);Xiaopeng Shao, XidianUniv.(China);Yuliya Tarabalka, Univ.ofIceland(Iceland);Raffaele Vitulli, EuropeanSpaceResearchandTechnologyCtr.(Netherlands);Shih-Chieh Wei, TamkangUniv.(Taiwan);Jiaji Wu, XidianUniv.(China);Zhen-sen Wu, XidianUniv.(China);Ye Zhang, HarbinInstituteofTechnology(China)
Sunday 12 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 8:30 to 10:10 am
Compression ISession Chair: Bormin Huang, Univ.ofWisconsin-Madison(United
States)
Fixed-quality/variable bit-rate on-board image compression for future CNES missions,RobertoCamarero,Ctr.Nationald’ÉtudesSpatiales(France);XavierDelaunay,NoveltisSA(France);CaroleThiebaut,Ctr.Nationald’ÉtudesSpatiales(France). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8514-01]
Single event upset injection simulation and fault-tolerant design for image compression applications,JieGuo,YunsongLi,KaiLiu,JieLei,ChengkeWu,XidianUniv.(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8514-02]
GPU acceleration of predictiion-based lower triangular transform for lossless compression,Shih-ChiehWei,TamkangUniv.(Taiwan);BorminHuang,Univ.ofWisconsin-Madison(UnitedStates) . . . . . . . . . . . . . . [8514-03]
A zero block detection algorithm used in EBCOT and its architecture,KaiLiu,XidianUniv.(China);EvgenyA.Belyaev,TampereUniv.ofTechnology(Finland);YunSongLi,JieLei,XidianUniv.(China). . . . . . . . . . . . . . . . [8514-04]
Onboard optimized hardware implementation of JPEG-LS encoder based on FPGA,WenWei,JieLei,YunsongLi,XidianUniv.(China). . . . . . . [8514-05]
SESSION 2 . . . . . . . . . . . . . . . . . . . . . Sun. 10:40 am to 12:00 pm
Image QualitySession Chair: Antonio J. Plaza, Univ.deExtremadura(Spain)
A new reduced-reference metric for assessing images after spatial resolution enhancement,Shen-EnQian,GuangyiChen,CanadianSpaceAgency(Canada). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8514-06]
Phase congruency assesses hyperspectral image quality,XiaopengShao,ZhenhuaJin,ZhongkuiDing,XidianUniv.(China) . . . . . . . . . . . . . . . . [8514-07]
Car camera quality measurements based on stability, contrast and intensity in text regions,SungwookYoun,ChulheeLee,YonseiUniv.(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8514-08]
Evaluation of spatial upscaling methods based on remote sensing data with multiple spatial resolutions,RuizhiRen,LingJiaGu,HaipengChen,HaofengWang,JilinUniv.(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8514-09]
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:00to1:30pm
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 1:30 to 3:10 pm
CommunicationSession Chair: Shen-En Qian, CanadianSpaceAgency(Canada)
A threshold-based opportunistic network coding methods combining with compressive sensing in satellite environments,HuiNiu,SongXiao,XidianUniv.(China) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8514-10]
Frequency position modulation using nonlinear compressed sensing,JoelGoodman,CrystalBertoncini,BryanNousain,GregoryCowart,U.S.NavalResearchLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8514-11]
An improved MORE protocol in satellite network based on network coding,YingKang,SongXiao,XidianUniv.(China) . . . . . . . . . . . . . . . . . . . . . [8514-12]
Collinear acousto-optical interaction in a crystalline cell to coherent optical processing of UHF radio-wave electronic pulses,MauroSanchez-Sanchez,Univ.delPapaloapan(Mexico);AlexandreS.Shcherbakov,InstitutoNacionaldeAstrofisica,ÓpticayElectrónica(Mexico). . . . . . . . . . . . . . . . . . . . . . . [8514-13]
A coding-aware routing algorithm in satellite networks,LiZhang,SongXiao,XidianUniv.(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8514-14]
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 3:40 to 5:20 pm
Processing ISession Chair: Yunsong Li, XidianUniv.(China)
GPU implementation of the image space reconstruction algorithm for remotely sensed hyperspectral unmixing,SergioSanchez,AntonioJ.Plaza,Univ.deExtremadura(Spain). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8514-15]
Exploring parallel computing paradigm for WRF single moment 3-class cloud microphysics scheme,XianyunWu,XidianUniv.(China);BorminHuang,Univ.ofWisconsin-Madison(UnitedStates);YunsongLi,XidianUniv.(China);Hung-LungA.Huang,Univ.ofWisconsin-Madison(UnitedStates);MitchellD.Goldberg,NationalOceanicandAtmosphericAdministration(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8514-16]
A fast full constraints unmixing method,RanWei,ZhangYe,HarbinInstituteofTechnology(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8514-17]
Improving the processing of data obtained from meteorological satellites using graphics processing units (GPUs),FranciscoRuiz,FelixRodriguez,AntonioJ.Plaza,Univ.deExtremadura(Spain). . . . . . . . . . . . . . . . . . [8514-18]
GPU-based parallel design of vertex component analysis for hyperspectral unmixing,LiangChen,YongFang,NorthwestA&FUniv.(China);BorminHuang,Univ.ofWisconsin-Madison(UnitedStates);AntonioJ.Plaza,Univ.ofExtremadura(Spain) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8514-19]
spie.org/opadvance · TEL:+13606763290 · help@spie.org 177
Symposium-Wide Plenary Session . . . . . . . . . . . . . . . . . . . . Sun. 6:00 to 7:25 pm6:00pm: Introduction and Opening Remarks
6:05pm: The Exciting Science of Light with Metamaterials, VladimirM.Shalaev,PurdueUniv.(USA)
6:45pm:Future of Optics and Photonics, BahaaE.A.Saleh,CREOL,TheCollegeofOpitcsandPhotonicsattheUniv.ofCentralFlorida(USA)
Monday 13 AugustSESSION 5 . . . . . . . . . . . . . . . . . . . . . . . . .Mon. 8:30 to 10:10 am
Processing IISession Chair: Chulhee Lee, YonseiUniv.(Korea,Republicof)
OpenCL versus NVidia CUDA for remotely sensed hyperspectral image unmixing on graphics processing units,JoseM.Rodriguez-Alves,AntonioJ.Plaza,Univ.deExtremadura(Spain). . . . . . . . . . . . . . . . . . . . . . . . . . . [8514-20]
Retrieval of snow depth in Northeast China using FY-3B/MWRI passive microwave remote sensing data,RuizhiRen,LingJiaGu,HaipengChen,HaofengWang,JilinUniv.(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8514-21]
A new technique for hyperspectral compressive sensing using spectral unmixing,GabrielMartin,Univ.deExtremadura(Spain);JoséM.Bioucas-Dias,Univ.TécnicadeLisboa(Portugal);AntonioJ.Plaza,Univ.deExtremadura(Spain). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8514-22]
Speeding up the computation of WRF double-moment 6-class microphysics scheme with GPU,MuhammadT.Satria,BorminHuang,Hung-LungA.Huang,Univ.ofWisconsin-Madison(UnitedStates);MitchellD.Goldberg,NationalOceanicandAtmosphericAdministration(UnitedStates) . . . . . . . . . . [8514-23]
Research on data fusion method for historic site identification,LijunYu,YuepingNie,InstituteofRemoteSensingApplications(China). . . . . . [8514-24]
SESSION 6 . . . . . . . . . . . . . . . . . . . . Mon. 10:40 am to 12:00 pm
ClassificationSession Chair: Roberto Camarero, Ctr.Nationald’ÉtudesSpatiales
(France)
Semi-supervised active learning approach for hyperspectral image classification: application to multinomial logistic regression and support vector machines,InmaculadaDopido,JunLi,AntonioJ.Plaza,Univ.deExtremadura(Spain) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8514-25]
Learning sparse discriminative representations for land cover classification in the Arctic,DanielaI.Moody,StevenP.Brumby,JoelRowland,ChandanaGangodagamag,LosAlamosNationalLab.(UnitedStates). . . . . . . . . [8514-26]
A new web-based system for unsupervised classification of satellite images from the Google Maps engine,AngelFerran,SergioBernabe,PabloGarcia-Rodriguez,AntonioJ.Plaza,Univ.deExtremadura(Spain). . . . . . . . . [8514-27]
Hyperspectral image classification using nearest feature line embedding approach,Chin-ChuanHan,NationalUnitedUniv.(Taiwan);Jin-NanLiu,NationalTaipeiUniv.ofTechnology(Taiwan);Ying-NongChen,NationalCentralUniv.(Taiwan);Yang-LangChang,Tung-JuHsieh,NationalTaipeiUniv.ofTechnology(Taiwan);BorminHuang,Univ.ofWisconsin-Madison(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8514-28]
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:00to1:30pm
SESSION 7 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 1:30 to 3:10 pm
Compression IISession Chair: Jordi Serra-Ruiz, Univ.ObertadeCatalunya(Spain)
The rate control scheme for JPEG-LS with high bit rate,JingZhang,YunsongLi,KaiLiu,JieGuo,XidianUniv.(China). . . . . . . . . . . . . . . . . . . . . . . . [8514-29]
Video compression based on frequency sensitivity,GuiwonSeo,SungwookYoun,ChulheeLee,YonseiUniv.(Korea,Republicof). . . . . . . . . . . . . [8514-30]
Classification-based spectral decorrelation and adaptive directional spatial transform for hyperspectral images compression,KeyanWang,YunsongLi,JingZhang,JieGuo,KaiLiu,ChengkeWu,XidianUniv.(China). . . . . [8514-31]
New regions of interest compression algorithm and its applications for high-spatial resolution remote sensing image,Li-BaoZhang,Xian-ChuanYu,BeijingNormalUniv.(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8514-32]
The classified vector quantization for AVIRIS hyperspectral imagery compression,JingZhang,YunsongLi,KeyanWang,HaiyingLiu,XidianUniv.(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8514-33]
SESSION 8 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 3:40 to 5:40 pm
Processing IIISession Chair: LingJia Gu, JilinUniv.(China)
Further investigation of GPU-based implementation of the N-FINDR algorithm for hyperspectral endmember extraction,HaoDuan,YongFang,NorthwestA&FUniv.(China);BorminHuang,Univ.ofWisconsin-Madison(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8514-34]
Reversible data hiding for tampering detection in remote sensing images using histogram shifting,JordiSerra-Ruiz,DavidMegias,Univ.ObertadeCatalunya(Spain) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8514-35]
Spectral unmixing of multispectral satellite images with dimensionality expansion using morphological profiles,SergioBernabe,Univ.deExtremadura(Spain);PrashanthR.Marpu,MasdarInstituteofScienceandTechnology(UnitedArabEmirates);AntonioJ.Plaza,Univ.deExtremadura(Spain);JonAtliBenediktsson,TheUniv.ofIceland(Iceland) . . . . . . . [8514-36]
Scalable simulations for WRF Thompson microphysics scheme with the use of GPU parallel computing,ChangheSong,BorminHuang,Univ.ofWisconsin-Madison(UnitedStates);YunsongLi,XidianUniv.(China);Hung-LungA.Huang,MitchellD.Goldberg,Univ.ofWisconsin-Madison(UnitedStates). . . [8514-37]
An efficient file reading platform for high-resolution remote sensing image,Li-BaoZhang,Kai-NaYang,Xian-ChuanYu,BeijingNormalUniv.(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8514-38]
A new digital repository for remotely sensed hyperspectral imagery with unmixing-based retrieval functionality,JorgeSevilla,SergioBernabe,PabloGarcia-Rodriguez,AntonioJ.Plaza,Univ.deExtremadura(Spain). . . [8514-39]
Conference 8514
178 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Conference 8515Monday-Tuesday 13-14 August 2012 • Proceedings of SPIE Vol. 8515
Imaging Spectrometry XVIIConference Chairs:Sylvia S. Shen, TheAerospaceCorp.(UnitedStates);Paul E. Lewis, NationalGeospatial-IntelligenceAgency(UnitedStates)
Program Committee:Christoph C. Borel, AirForceInstituteofTechnology(UnitedStates);Chein-I Chang, Univ.ofMaryland,BaltimoreCounty(UnitedStates);François Chateauneuf,InstitutNationald’Optique(Canada);Thomas Cooley, AirForceResearchLab.(UnitedStates);Eustace L. Dereniak, CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates);Kevin C. Gross, AirForceInstituteofTechnology(UnitedStates);Robert T. Kroutil, DynamacCorp.(UnitedStates);Pantazis Mouroulis, JetPropulsionLab.(UnitedStates);Thomas S. Pagano, JetPropulsionLab.(UnitedStates);Luc Rochette, LRTech(Canada);John R. Schott, RochesterInstituteofTechnology(UnitedStates);John F. Silny, RaytheonSpace&AirborneSystems(UnitedStates)
Sunday 12 AugustSymposium-Wide Plenary Session . . . . . . . . . . . . . . . . . . . . Sun. 6:00 to 7:25 pm6:00pm: Introduction and Opening Remarks
6:05pm: The Exciting Science of Light with Metamaterials, VladimirM.Shalaev,PurdueUniv.(USA)
6:45pm:Future of Optics and Photonics, BahaaE.A.Saleh,CREOL,TheCollegeofOpitcsandPhotonicsattheUniv.ofCentralFlorida(USA)
Monday 13 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . Mon. 10:20 am to 12:00 pm
Advancements in Spectrometer Systems ISession Chair: Paul E. Lewis, NationalGeospatial-IntelligenceAgency
(UnitedStates)
High-sensitivity optical bench for portable explosives detection system (Invited Paper),GregoryNeece,Avantes,Inc.(UnitedStates). . . . . . . [8515-01]
Detection of chemical pollutants by passive LWIR hyperspectral imaging(Invited Paper),HugoLavoie,Jean-MarcThériault,FrancoisBouffard,EldonPuckrin,DenisDube,DefenceResearchandDevelopmentCanada,Valcartier(Canada) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8515-02]
Imaging spectroscopy with the Hyperspectral Thermal Emission Spectrometer (HyTES),WilliamR.Johnson,SimonJ.Hook,BjornT.Eng,VincentRealmuto,JetPropulsionLab.(UnitedStates) . . . . . . . . . . . . [8515-03]
Modular hyperspectral imager enables multiple research applications,NicolasHo,FlorentM.Prel,ABBAnalyticalMeasurement(Canada);HugoLavoie,FrançoisBouffard,DenisDubé,Jean-MarcThériault,DefenceResearchandDevelopmentCanada,Valcartier(Canada);ChristianA.Vallieres,ClaudeB.Roy,ABBAnalyticalMeasurement(Canada) . . . . . . . . . . . . . . . . . . . . [8515-04]
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:00to1:30pm
SESSION 2 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 1:30 to 3:10 pm
Atmospheric and Environmental Spectroscopy ISession Chair: Thomas S. Pagano, JetPropulsionLab.(UnitedStates)
The Geostationary Fourier Transform Spectrometer,RichardKey,StanleyP.Sander,AnnmarieEldering,JetPropulsionLab.(UnitedStates). . . . . [8515-05]
Optical design of the SWIR spectrometer for Sentinel 5 precursor: methane detection,IanjitBhatti,DanielR.Lobb,JimGrant,SurreySatelliteTechnologyLtd.(UnitedKingdom);DavidM.Woods,SurreySatelliteTechnologyLtd.(UnitedStates);RuudHoogeveen,SRONNationaalInstituutvoorRuimteonderzoek(Netherlands). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8515-06]
Global and regional seasonal variability of mid-tropospheric CO 2 as measured by the Atmospheric Infrared Sounder (AIRS),ThomasS.Pagano,JetPropulsionLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . [8515-07]
Determination of greenhouse gas profiles from ground-based infrared radiance measurements,WilliamL.Smith,Sr.,HamptonUniv.(UnitedStates);LucRochette,LRTech(Canada);R.B.Pierce,Univ.ofWisconsin-Madison(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8515-08]
Bounding the errors for quantitative chemical vapor species analysis using passive infrared remote sensing data,RobertT.Kroutil,DynamacCorp.(UnitedStates);PaulLewis,NationalGeospatial-IntelligenceAgency(UnitedStates);SylviaS.Shen,TheAerospaceCorp.(UnitedStates);DavidP.Miller,TASC,Inc.(UnitedStates);MarkJ.Thomas,U.S.EnvironmentalProtectionAgency(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8515-09]
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 3:40 to 5:00 pm
Spectral Methodologies and Applications ISession Chair: Kevin C. Gross, AirForceInstituteofTechnology(United
States)
Algorithms for the detection and mapping of wildfires in SPOT 4 and 5 imagery,BryanBagnall,HeidiL.Buck,ElanSharghi,SPAWARSystemsCtr.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8515-10]
Automatic swimming pool identification for fire suppression,BoFitzsimmons,SPAWARSystemsCtr.(UnitedStates). . . . . . . . . . . . . . [8515-11]
Low-cost near-real-time automated geo-registration of commercial-off-the-shelf (COTS) digital camera and spectrometer sensor data with camera link standard data streams,PaulE.Lewis,NationalGeospatial-IntelligenceAgency(UnitedStates);TimBratcher,DavidMiller,Ionetrics,Inc.(UnitedStates);SylviaS.Shen,TheAerospaceCorp.(UnitedStates);RobertT.Kroutil,DynamacCorp.(UnitedStates);MarkJ.Thomas,U.S.EnvironmentalProtectionAgency(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8515-12]
Detection of mines/caves using airborne LWIR hyperspectral data,SylviaS.Shen,KurtA.Roettiger,TheAerospaceCorp.(UnitedStates). . . . . . . [8515-13]
Posters-Monday . . . . . . . . . . . . . . . . . . . . Mon. 5:30 to 7:30 pmConference attendees are invited to attend the poster session on Monday
evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
Design and performance evaluation of the convex grating hyperspectral imaging spectrometer,SeoHyunKim,HongjinKong,HanaKu,KAIST(Korea,Republicof);Jun-HoLee,KongjuNationalUniv.(Korea,Republicof). [8515-32]
Tuesday 14 AugustSESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . Tues. 8:20 to 10:00 am
Advancements in Spectrometer Systems IISession Chair: Pantazis Mouroulis, JetPropulsionLab.(UnitedStates)
Latest developments in active remote sensing at INO,FrançoisBabin,RosalieForest,BrunoBourliaguet,DanielCantin,PierreCottin,OvidiuPancrati,SimonTurbide,SimonLambert-Girard,FélixCayer,Jean-FrançoisCormier,FrançoisChâteauneuf,INO(Canada). . . . . . . . . . . . . . . . . . . . . . . . . . [8515-14]
Hadamard transform imaging spectrometer for rapid data collection,RalphR.Berggren,RogerR.Petrin,LosAlamosNationalLab.(UnitedStates)[8515-15]
Portable Remote Imaging Spectrometer (PRISM): laboratory and field calibration,PantazisMouroulis,ByronVanGorp,BrandonS.Richardson,RobertO.Green,JoseI.Rodriguez,EugenioUrquiza,DanielW.Wilson,JetPropulsionLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8515-16]
Ultra-compact Imaging Spectrometer (UCIS) for in-situ planetary mineralogy: laboratory and field calibration,ByronVanGorp,PantazisMouroulis,RobertO.Green,JoseI.Rodriguez,DianaL.Blaney,DanielW.Wilson,R.GlennSellar,BrandonS.Richardson,JetPropulsionLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8515-17]
Research on imaging spectrometry using LC-based tunable filter,ZhixueShen,ChinaAcademyofEngineeringPhysics(China). . . . . . . . . . . . . [8515-18]
spie.org/opadvance · TEL:+13606763290 · help@spie.org 179
SESSION 5 . . . . . . . . . . . . . . . . . . . . Tues. 10:30 am to 12:10 pm
Spectral Data Analysis TechniquesSession Chair: Christoph C. Borel, AirForceInstituteofTechnology
(UnitedStates)
False alarm characterization in hyperspectral gas detection applications,RobertS.DiPietro,MITLincolnLab.(UnitedStates);EricTruslow,NortheasternUniv.(UnitedStates);DimitrisG.Manolakis,MITLincolnLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8515-19]
Range-invariant anomaly detection applied to imaging Fourier transform spectrometry data,ChristophC.Borel,AirForceInstituteofTechnology(UnitedStates);DaltonS.Rosario,U.S.ArmyResearchLab.(UnitedStates);JoaoM.Romano,U.S.ArmyArmamentResearch,DevelopmentandEngineeringCtr.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8515-20]
Background suppression for feature-based spectroscopy and statistical methods of sub-pixel material identification,RobertS.Rand,NationalGeospatial-IntelligenceAgency(UnitedStates);JohnM.Grossmann,TheMITRECorp.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8515-21]
Target detection within hyperspectral images under varying collection geometries,RyanR.Close,Univ.ofFlorida(UnitedStates);DmitriDranishnikov,Univ.ofFlorida(UnitedStates);PaulGader,Univ.ofFlorida(UnitedStates);AlinaZare,Univ.ofMissouri-Columbia(UnitedStates) . . . . . . . . . . . . [8515-22]
Linear unmixing-based feature extraction for hyperspectral data in a high-performance computing environment,StefanA.Robila,MontclairStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8515-23]
Lunch/Exhibition Break.............................. 12:10to1:40pm
SESSION 6 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 1:40 to 3:00 pm
Atmospheric and Environmental Spectroscopy IISession Chair: Robert T. Kroutil, DynamacCorp.(UnitedStates)
Conceptual optical design and system engineering of the CLARREO/RS (reflected solar) instrument suite,PatrickL.Thompson,PeterC.Hill,NASAGoddardSpaceFlightCtr.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . [8515-24]
The point response functions of CERES instruments aboard the Terra and Aqua spacecrafts over the mission to date,JanetL.Daniels,SusanThomas,GeorgeL.Smith,ScienceSystemsandApplications,Inc.(UnitedStates);KoryJ.Priestley,NASALangleyResearchCtr.(UnitedStates). . . . . . . . . . . . [8515-25]
Observing system simulation experiments to assess the impact of remotely sensed data on hurricane prediction,RobertM.Atlas,NationalOceanicandAtmosphericAdministration(UnitedStates). . . . . . . . . . . . . . . . . . . . . [8515-26]
Exploring aerosol and atmospheric polarimetric techniques using unconventional polarized sources,BrandonG.Zimmerman,Univ.ofRochester(UnitedStates)andUniv.ofMaryland,BaltimoreCounty(UnitedStates)andNASAGoddardSpaceFlightCtr.(UnitedStates);ThomasG.Brown,Univ.ofRochester(UnitedStates);JoseVanderleiMartins,Univ.ofMaryland,BaltimoreCounty(UnitedStates);PerAdamson,Univ.ofRochester(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8515-27]
SESSION 7 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 3:30 to 4:50 pm
Spectral Methodologies and Applications IISession Chair: Sylvia S. Shen, TheAerospaceCorp.(UnitedStates)
Evolution of the infrared spectral measurements of rocket and missile emissions: a DRDC Valcartier perspective,TracyL.Smithson,PierreFournier,DanielSt-Germain,DefenceResearchandDevelopmentCanada,Valcartier(Canada) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8515-28]
Polarimetric HSI for improved radioactive source detection sensitivity and localization accuracy,EvanJ.Carlson,KevinC.Gross,AirForceInstituteofTechnology(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8515-29]
Physically constrained datacube estimation of binary stars observed with snapshot hyperspectral imaging systems,JamesF.Scholl,HnuPhotonics(UnitedStates);E.KeithHege,MKSImagingTechnology,LLC(UnitedStates);DanielG.O’Connell,HnuPhotonics(UnitedStates) . . . . . . . . . . . . . . [8515-30]
Self-adaptive road tracking in hyperspectral data for C-IED,HendrikSchilling,WolfgangJ.Gross,WolfgangMiddelmann,Fraunhofer-InstitutfürOptronik,SystemtechnikundBildauswertung(Germany) . . . . . . . . . . [8515-31]
Conference 8515
Make SPIE your resource. Join or renew online today.
spie.org/membership
help@spie.org+13606763290
membership
A long-term investment that pays off
10 SPIE Digital Library downloads
Complimentary online SPIE Journal
1 Complimentary online course
Networking and access to information
Discounts on events, courses, and publications
Career advancement and peer recognition
Join or renew your SPIE membership1 year $105 | 3 years $297 | Lifetime $995
Discounts for students and early career professionals
180 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Conference 8516Sunday-Monday 12-13 August 2012 • Proceedings of SPIE Vol. 8516
Remote Sensing System Engineering IVConference Chairs:Philip E. Ardanuy, RaytheonIntelligence&InformationSystems(UnitedStates);Jeffery J. Puschell, RaytheonSpace&AirborneSystems(UnitedStates)
Conference Co-Chair:Hal J. Bloom, EarthResourcesTechnology,Inc.(UnitedStates)
Program Committee:Richard A. Anthes, NationalCtr.forAtmosphericResearch(UnitedStates);Robert M. Atlas, NationalOceanicandAtmosphericAdministration(UnitedStates);Stephen A. Cota, TheAerospaceCorp.(UnitedStates);Gerald J. Dittberner, HarrisCorp.(UnitedStates);R. Patrick Earhart, BallCorp.(UnitedStates);William B. Gail, MicrosoftCorp.(UnitedStates);Om P. Gupta, IridiumSatelliteLLC(UnitedStates);M. Gregory Hammann, GeoEye,Inc.(UnitedStates);Wei-Min Hao, U.S.ForestService(UnitedStates);Allen H.-L. Huang, Univ.ofWisconsin-Madison(UnitedStates);Gerard Jansson, IntelsatGlobalServiceCorp.(UnitedStates);K. Dieter Klaes, EuropeanOrganisationfortheExploitationofMeteorologicalSatellites(Germany);Stephen A. Mango, NOAA/NESDISOfficeofSatelliteOperations(UnitedStates);Jens Nieke, EuropeanSpaceResearchandTechnologyCtr.(Netherlands);John C. Petheram, LockheedMartinSpaceSystemsCo.(UnitedStates);Carl F. Schueler, OrbitalSciencesCorp.(UnitedStates);Song Yang, NASAGoddardSpaceFlightCtr.(UnitedStates)
Sunday 12 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 8:50 to 10:30 am
Future Earth Observing SystemsSession Chair: Jeffery J. Puschell, RaytheonSpace&Airborne
Systems(UnitedStates)
Test plan for a calibration demonstration system for the reflected solar instrument for the Climate Absolute Radiance and Refractivity Observatory,KurtisJ.Thome,JoelMcCorkel,JasonH.Hair,BrendanMcAndrew,AdrianDaw,DonaldE.Jennings,DouglasM.Rabin,NASAGoddardSpaceFlightCtr.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8516-01]
Verification of the ENMAP focal plane detector matrix,HorstSchwarzer,RalfReulke,DeutschesZentrumfürLuft-undRaumfahrte.V.(Germany).. [8516-02]
Projected performance of an enhanced VIIRS with spectral bands near 6.7 microns for measuring atmospheric water vapor distribution,JefferyJ.Puschell,RaytheonSpace&AirborneSystems(UnitedStates). . . . . . [8516-03]
Next-generation along-track scanning radiometer: SLSTR,JohannesFrerick,JensNieke,ConstantinE.Mavrocordatos,BrunoBerruti,EuropeanSpaceResearchandTechnologyCtr.(Netherlands). . . . . . . . . . . . . . . . . . . . [8516-04]
Expected performance of the Visible Infrared Imager Radiometer Suite (VIIRS) without detector sample aggregation,ThomasF.Lee,U.S.NavalResearchLab.(UnitedStates);JefferyJ.Puschell,RaytheonSpaceandAirborneSystems(UnitedStates);CarlF.Schueler,OrbitalSciencesCorp.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8516-05]
SESSION 2 . . . . . . . . . . . . . . . . . . . . . Sun. 11:00 am to 12:00 pm
Lessons LearnedSession Chair: Philip E. Ardanuy, RaytheonIntelligence&Information
Systems(UnitedStates)
FD-CHIRP: hosted payload system engineering lessons,CarlF.Schueler,OrbitalSciencesCorp.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . [8516-06]
Lessons learned from the 705-km fleet,MarkA.Vincent,RaytheonIntelligence&InformationSystems(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . [8516-07]
Best practices and lessons learned implementing a repeatable system engineering process for the transition of algorithms from research to operations,PhilipE.Ardanuy,KennethA.Jensen,RaytheonIntelligence&InformationSystems(UnitedStates);WalterW.Wolf,NationalOceanicandAtmosphericAdministration(UnitedStates). . . . . . . . . . . . . . . . . . . . . [8516-08]
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:00to1:30am
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 1:30 to 3:10 pm
New Tools, New ApproachesSession Chair: Carl F. Schueler, OrbitalSciencesCorp.(UnitedStates)
The EIP: a standard experimenter interface panel for NASA airborne science,JoshuaB.Forgione,NASAAmesResearchCtr.(UnitedStates);CarlSorenson,JeffreyS.Myers,JeffGrose,Univ.ofCalifornia,SantaCruz(UnitedStates);RoyVogler,ASRCAerospace(UnitedStates). . . . . . . . . . . . . [8516-09]
Day/night band imager for a CubeSat,EricStanton,CaliforniaPolytechnicStateUniv.,SanLuisObispo(UnitedStates);JefferyJ.Puschell,RaytheonSpace&AirborneSystems(UnitedStates). . . . . . . . . . . . . . . . . . . . . . [8516-10]
CubeSat modules for multispectral environmental imaging from polar orbit,JefferyJ.Puschell,RaytheonSpace&AirborneSystems(UnitedStates);EricStanton,CaliforniaPolytechnicStateUniv.,SanLuisObispo(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8516-11]
A real-time multispectral imaging system for low- or mid-altitude remote sensing,LinghuaKong,ZuoWeiScience&TechnologyLtd.(China);MingzhenRen,XiaoliMa,GeorgiaInstituteofTechnology(UnitedStates);DingrongYi,MoticChinaGroupCo.Ltd.(China) . . . . . . . . . . . . . . . . . . . . . . . . . . . [8516-12]
Study of bonding positions of isostatic mounts on a lightweight primary mirror,Chia-YenChan,InstrumentTechnologyResearchCtr.(Taiwan)[8516-13]
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . . Sun. 3:40 to 4:40 pm
Active Remote SensingSession Chair: Jeffery J. Puschell, RaytheonSpace&Airborne
Systems(UnitedStates)
Polarization effects induced by a two-mirror laser beam scanner,ScottA.Gimbal,QiaochuLi,AnnaI.Petrova-Mayor,CaliforniaStateUniv.,Chico(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8516-14]
High-stability, energy-efficient laser-induced plasma shutter for high-spatial resolution CO 2-TEA-based DIAL,TaiebGasmi,SaintLouisUniv.-MadridCampus(Spain);KhaledGasmi,KingFahdUniv.ofPetroleum&Minerals(SaudiArabia) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8516-15]
Level-crossing time statistics in signal detection,MariaG.Serikova,EvgeniG.Lebedko,IgorA.Konyakhin,VadimV.Zuzin,NationalResearchUniv.ofInformationTechnologies,MechanicsandOptics(RussianFederation)[8516-16]
Symposium-Wide Plenary Session . . . . . . . . . . . . . . . . . . . . Sun. 6:00 to 7:25 pm6:00pm: Introduction and Opening Remarks
6:05pm: The Exciting Science of Light with Metamaterials, VladimirM.Shalaev,PurdueUniv.(USA)
6:45pm:Future of Optics and Photonics, BahaaE.A.Saleh,CREOL,TheCollegeofOpitcsandPhotonicsattheUniv.ofCentralFlorida(USA)
Monday 13 AugustPosters-Monday . . . . . . . . . . . . . . . . . . . . Mon. 5:30 to 7:30 pm
Conference attendees are invited to attend the poster session on Monday evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
Optical system for detection and tracking objects on low Earth orbit (LEO),JerzyH.Lukasiewicz,JoannaLubieniecka,AirForceInstituteofTechnology(Poland);WieslawSarna,Kenbitsp.j.(Poland). . . . . . . . . . . . . . . . . . . [8516-17]
Some new experimental results in Fresnel telescope imaging ladar,EnwenDai,JianfengSun,YapengWu,YananZhi,YuZhou,LirenLiu,ShanghaiInstituteofOpticsandFineMechanics(China) . . . . . . . . . . . . . . . . . . . . . . . . . [8516-18]
RSI Sun exposure survivability,CynthiaLiu,JerLing,NationalSpaceOrganization(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8516-19]
Photonic services, their enablers and applications,JosefVojtech,VladimirSmotlacha,PavelSkoda,CESNET(CzechRepublic);AlexanderKuna,InstituteofPhotonicsandElectronicsoftheASCR,v.v.i.(CzechRepublic);MiloslavHula,StanislavSima,CESNET(CzechRepublic). . . . . . . . . . . . . . . . . . . . . . [8516-20]
spie.org/opadvance · TEL:+13606763290 · help@spie.org 181
Conference 8517Monday-Wednesday 13-15 August 2012 • Proceedings of SPIE Vol. 8517
Laser Communication and Propagation through the Atmosphere and OceansConference Chairs:Alexander M. J. van Eijk, TNODefence,SecurityandSafety(Netherlands);Christopher C. Davis, Univ.ofMaryland,CollegePark(UnitedStates);Stephen M. Hammel, SpaceandNavalWarfareSystemsCommand(UnitedStates);Arun K. Majumdar, NavalAirWarfareCtr.WeaponsDiv.(UnitedStates)
Program Committee:Larry C. Andrews, Univ.ofCentralFlorida(UnitedStates);Jaime A. Anguita, Univ.deLosAndes(Chile);Shlomi Arnon, Ben-GurionUniv.oftheNegev(Israel);Mikhail S. Belen’kii, TrexEnterprisesCorp.(UnitedStates);Matthew M. Bold, LockheedMartinSpaceSystemsCo.(UnitedStates);Hennes Henniger, DeutschesZentrumfürLuft-undRaumfahrte.V.(Germany);Warren Lewis, MetOffice(UnitedKingdom);Vladimir B. Markov, AdvancedSystems&Technologies,Inc.(UnitedStates);Vincent Michau, ONERA(France);Stuart D. Milner, Univ.ofMaryland,CollegePark(UnitedStates);Dominic C. O’Brien, Univ.ofOxford(UnitedKingdom);Jacobus M. Oschmann, Jr., BallAerospace&TechnologiesCorp.(UnitedStates);Ronald L. Phillips, FloridaSpaceInstitute(UnitedStates);William S. Rabinovich, U.S.NavalResearchLab.(UnitedStates);Karin Stein, Fraunhofer-InstitutfürOptronik,SystemtechnikundBildauswertung(Germany);Michael T. Valley, SandiaNationalLabs.(UnitedStates);Thomas Weyrauch, Univ.ofDayton(UnitedStates);Otakar Wilfert, BrnoUniv.ofTechnology(CzechRepublic)
Monday 13 AugustPosters-Monday . . . . . . . . . . . . . . . . . . . . Mon. 5:30 to 7:30 pm
Conference attendees are invited to attend the poster session on Monday evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
High-data rate laser communication field experiment in the turbulence channel,JianfengSun,YananZhi,WeiLu,PeipeiHou,EnwenDai,LirenLiu,ShanghaiInstituteofOpticsandFineMechanics(China) . . . . . . . . . . [8517-39]
Technological research of differential phase shift keying receiver in the satellite-to-ground laser communication system,XiaopingMa,JianfengSun,ZhuLuan,Ya’nanZhi,LirenLiu,ShanghaiInstituteofOpticsandFineMechanics(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8517-40]
Polarization phase-shifting cyclic Jamin shearing interferometer,LijuanWang,LirenLiu,JianfengSun,YuZhou,EnwenDai,YapengWu,ShanghaiInstituteofOpticsandFineMechanics(China)................... [8517-41]
Physical and statistical modeling of attenuation due to atmospheric hydrometeors on free-space optical links at 850 and 1550 nm,MartinGrabner,VaclavKvicera,CzechMetrologyInstitute(CzechRepublic) [8517-42]
Phase-space analysis of laser beam propagation within atmospheric turbulence,WeiLu,JianfengSun,DeyanXu,YapengWu,XiaopingMa,BingLi,LirenLiu,ShanghaiInstituteofOpticsandFineMechanics(China). . . [8517-43]
Tuesday 14 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 1:00 to 3:10 pm
Free-Space Optical Demonstration and AnalysisSession Chair: Christopher C. Davis, Univ.ofMaryland,CollegePark
(UnitedStates)
Free-Space Optical Experimental Network Experiment (FOENEX) (Invited Paper),RichardRidgway,DefenseAdvancedResearchProjectsAgency(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8517-01]
Communication system technology for demonstration of BB84 quantum key distribution in optical aircraft downlinks,FlorianMoll,DeutschesZentrumfürLuft-undRaumfahrte.V.(Germany);SebastianNauerth,Ludwig-Maximilians-Univ.München(Germany);ChristianFuchs,JoachimHorwath,DeutschesZentrumfürLuft-undRaumfahrte.V.(Germany);MarkusRau,HaraldWeinfurter,Ludwig-Maximilians-Univ.München(Germany). . . . . . . . . . . . . . . . . . [8517-02]
A dual PTZ-stereo tracking and surveillance system with two dynamic cameras operating in a master-slave relationship,MohammedA.Eslami,ChristopherC.Davis,JohnRzasa,Univ.ofMaryland,CollegePark(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8517-03]
Predicting topology (re)-configurations in mobile directional wireless networks using potential energy surfaces,DavidM.Coleman,StuartD.Milner,ChristopherC.Davis,Univ.ofMaryland,CollegePark(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8517-04]
Transportable optical ground station for high-speed free-space laser communication,AmitaShrestha,MartinBrechtelsbauer,DeutschesZentrumfürLuft-undRaumfahrte.V.(Germany). . . . . . . . . . . . . . . . . . . . . . . . . . . [8517-05]
Measurements of probability density and covariance functions of IR laser beam intensity fluctuations in a hot air turbulence emulator and comparison with the maritime environment,CharlesNelson,U.S.NavalAcademy(UnitedStates);FredericDavidson,JohnsHopkinsUniv.(UnitedStates);RaymondSova,JohnsHopkinsUniv.AppliedPhysicsLab.(UnitedStates). . . . . . . . . [8517-06]
SESSION 2 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 3:40 to 6:20 pm
Free-Space Optical Models and DevicesSession Chair: Arun K. Majumdar, NavalAirWarfareCtr.WeaponsDiv.
(UnitedStates)
Demonstration of multi-user laser communication using orbital-angular-momentum channels,JaimeA.Anguita,CamiloQuezada,JoaquinHerreros,Univ.deLosAndes(Chile) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8517-07]
NLOS UV channel modeling using numerical integration and an approximate closed-form path loss model,AnkitGupta,MohammadNoshad,MaiteBrandt-Pearce,Univ.ofVirginia(UnitedStates). . . . . . . . . . . . . [8517-08]
Spectral analysis of encrypted chaotic signals using fast Fourier transforms and laboratory spectral analyzers,MonishR.Chatterjee,AbhinayKundur,Univ.ofDayton(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8517-09]
Long distance ultraviolet scattering channel test and simulation,GangChen,QunfengHe,Univ.ofCalifornia,Riverside(UnitedStates);BrianM.Sadler,U.S.ArmyResearchLab.(UnitedStates);ZhengyuanXu,Univ.ofCalifornia,Riverside(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8517-10]
LDPC coded NLOS UV communication performance,QunfengHe,GangChen,ZhengyuanXu,BrianM.Sadler,Univ.ofCalifornia,Riverside(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8517-11]
On outage capacity bounds for multihop MIMO free-space optical communications over turbulence-induced fading,QianGao,GangChen,YingboHua,Univ.ofCalifornia,Riverside(UnitedStates). . . . . . . . . . [8517-12]
A novel design of free-space receiver for long distance optical measurement,Yen-RuHuang,NationalTaiwanUniv.ofScienceandTechnology(Taiwan);Wei-ChengLin,NationalAppliedResearchLabs.(Taiwan);JingshownWu,NationalTaiwanUniv.(Taiwan);San-LiangLee,NationalTaiwanUniv.ofScienceandTechnology(Taiwan);Hen-WaiTsao,NationalTaiwanUniv.(Taiwan);Shenq-TsongChang,NationalAppliedResearchLabs.(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8517-13]
High-data rate differential phase shift keying receiver for satellite-to-ground optical communication link,YananZhi,ZhuLuan,JianfengSun,YuZhou,EnwenDai,LirenLiu,ShanghaiInstituteofOpticsandFineMechanics(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8517-14]
182 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Wednesday 15 AugustSESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . .Wed. 8:00 to 10:00 am
Optical Propagation in TurbulenceSession Chairs: Stephen M. Hammel, SpaceandNavalWarfare
SystemsCommand(UnitedStates);Jaime Anguita, Univ.deLosAndes(Chile)
Long- and short-term scintillation of focused beams and point spread functions in the turbulent atmosphere,MikhailI.Charnotskii,NationalOceanicandAtmosphericAdministration(UnitedStates)andZelTechnologies,LLC(UnitedStates);GaryBaker,LockheedMartinSpaceSystemsCo.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8517-15]
Simulation of beam propagation through turbulent media for diverse turbulence regimes,HebaYuksel,BogaziçiÜniv.(Turkey)andBilkentUniv.(Turkey)andMarmaraUniv.(Turkey);HasimMeric,BilkentUniv.(Turkey);FulyaC.Kunter,MarmaraUniv.(Turkey) . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8517-16]
Study of strong turbulence effects for optical wireless links,HebaYuksel,BogaziçiÜniv.(Turkey);HasimMeric,BilkentUniv.(Turkey);FulyaC.Kunter,MarmaraUniv.(Turkey). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8517-17]
Estimation of the atmospheric blurring function using blind image quality metrics,JeremyP.Bos,MichaelC.Roggemann,MichiganTechnologicalUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8517-18]
Investigation of seasonal and diurnal cycles on the height dependence of optical turbulence in the lower atmospheric boundary layer,DetlevSprung,PeterGrossmann,ErikSucher,KarinStein,Fraunhofer-InstitutfürOptronik,SystemtechnikundBildauswertung(Germany) . . . . . . . . . . . . . . . . . . [8517-19]
Improved vertical refractive-index structure parameter model for the maritime atmosphere based on local bulk meteorological measurements,ColinN.Reinhardt,SPAWARSystemsCtr.(UnitedStates);StephenHammel,DimitrisTsintikidis,SpaceandNavalWarfareSystemsCommand(UnitedStates);KevinMcBryde,SPAWARSystemsCtr.(UnitedStates). . . . . [8517-20]
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . .Wed. 10:30 to 11:50 am
Turbulence Models and MitigationSession Chairs: Alexander M. J. van Eijk, TNODefence,Securityand
Safety(Netherlands);Mikhail I. Charnotskii, NationalOceanicandAtmosphericAdministration(UnitedStates)
Reciprocity-enhanced optical communication through atmospheric turbulence part I: reciprocity proofs and far-field power transfer optimization,JeffreyH.Shapiro,MassachusettsInstituteofTechnology(UnitedStates);AndrewPuryear,MITLincolnLab.(UnitedStates) . . . . . . . . . [8517-21]
Reciprocity-enhanced optical communication through atmospheric turbulence part II: communication architectures and performance,AndrewPuryear,MITLincolnLab.(UnitedStates);JeffreyH.Shapiro,MassachusettsInstituteofTechnology(UnitedStates);RonaldR.Parenti,MITLincolnLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8517-22]
Optical propagation in a turbulent atmosphere using the split step method,HebaYuksel,BogaziçiÜniv.(Turkey);FulyaC.Kunter,MarmaraUniv.(Turkey). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8517-23]
Propagation of Gaussian beams through a modified von Karman phase screen,EricaWhitfield,ParthaP.Banerjee,JosephHaus,Univ.ofDayton(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8517-24]
Lunch/Exhibition Break........................... 11:50amto1:00pm
SESSION 5 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 1:00 to 3:10 pm
Atmospheric Channel Modeling and OptimizationSession Chairs: Matthew M. Bold, LockheedMartinSpaceSystemsCo.(UnitedStates);Gang Chen, Univ.ofCalifornia,Riverside(United
States)
Optical phase-conjugate enhanced free-space optical communication (Invited Paper),VladimirB.Markov,AnatoliyKhizhnyak,AdvancedSystems&Technologies,Inc.(UnitedStates)............................. [8517-25]
Experimental observations of channel reciprocity in single-mode free-space optical links,RonaldR.Parenti,JeffreyM.Roth,MITLincolnLab.(UnitedStates);JeffreyH.Shapiro,MassachusettsInstituteofTechnology(UnitedStates);FrederickG.Walther,JosephA.Greco,MITLincolnLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8517-26]
Using a plenoptic camera to measure distortions in wavefronts affected by atmospheric turbulence,MohammedA.Eslami,ChristopherDavis,Univ.ofMaryland,CollegePark(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . [8517-27]
Analysis of optical communications through the random air-water interface: feasibility for under-water communications,ArunK.Majumdar,JohnSiegenthaler,DavidO’Connor,PhillipLand,NavalAirWarfareCtr.WeaponsDiv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8517-28]
Highly validated atmospheric water vapor vertical profiles using Raman lidar technique,WatheqAl-Basheer,KevinB.Strawbridge,EnvironmentCanada(Canada). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8517-29]
Modeling off-axis laser scattering: effects from aerosol distributions,JohndeGrassie,SPAWARSystemsCtr.(UnitedStates). . . . . . . . . . . . . . . . [8517-30]
SESSION 6 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 3:40 to 6:20 pm
Adaptive Techniques and Channel CompensationSession Chairs: Heba Yuksel, BogaziçiÜniv.(Turkey);Christopher C.
Davis, Univ.ofMaryland,CollegePark(UnitedStates)
Reduced noise propagation from least squares wavefront reconstruction using a post-processing congruence reconstruction technique,MichaelJ.Steinbock,MiloW.Hyde,AirForceInstituteofTechnology(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8517-31]
Capacity of adaptive free-space optical channel using bidirectional links,AfsanaKhatoon,WilliamG.Cowley,NickLetzepis,Univ.ofSouthAustralia(Australia). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8517-32]
Adaptive optics testbed with interferometric wavefront sensor for mobile communications,RamonMata-Calvo,FlorianMoll,DeutschesZentrumfürLuft-undRaumfahrte.V.(Germany) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8517-33]
Beacon-defined performance of adaptive optics,AnatoliyKhizhnyak,VladimirMarkov,AdvancedSystems&Technologies,Inc.(UnitedStates). . . . [8517-34]
Heterogeneous optical networking using hybrid orthogonal OAM multimode modulation,IvanB.Djordjevic,TheUniv.ofArizona(UnitedStates);JaimeAnguita,Univ.deLosAndes(Chile) . . . . . . . . . . . . . . . . . . . . . . . . . . . [8517-35]
Probability distributions of link durations with n disruptive channels: application to ground-space optical communications,NicolasPerlot,FlorianMoll,DeutschesZentrumfürLuft-undRaumfahrte.V.(Germany). . . . [8517-36]
Extended model of restricted beam for FSO links,JurajPoliak,JiříKomrska,OtakarWilfert,BrnoUniv.ofTechnology(CzechRepublic). [8517-37]
Estimation of turbulence characteristic scales in a water cell,VictorA.Kulikov,MariaS.Andreeva,VictorI.Shmalhausen,LomonosovMoscowStateUniv.(RussianFederation)................................... [8517-38]
Conference 8517
spie.org/opadvance · TEL:+13606763290 · help@spie.org 183
Conference 8518Wednesday-Thursday 15-16 August 2012 • Proceedings of SPIE Vol. 8518
Quantum Communications and Quantum Imaging XConference Chairs:Ronald E. Meyers, U.S.ArmyResearchLab.(UnitedStates);Yanhua Shih, Univ.ofMaryland,BaltimoreCounty(UnitedStates);Keith S. Deacon, U.S.ArmyResearchLab.(UnitedStates)
Program Committee:Stefania Anna Castelletto, SwinburneUniv.ofTechnology(Australia);Milena D’Angelo, Univ.degliStudidiBari(Italy);Mark T. Gruneisen, AirForceResearchLab.(UnitedStates);Richard J. Hughes, LosAlamosNationalLab.(UnitedStates);Yoon-Ho Kim, PohangUniv.ofScienceandTechnology(Korea,Republicof);Patricia J. Lee, U.S.ArmyResearchLab.(UnitedStates);Todd B. Pittman, Univ.ofMaryland,BaltimoreCounty(UnitedStates);Barry C. Sanders, Univ.ofCalgary(Canada);Alexander V. Sergienko, BostonUniv.(UnitedStates);Dmitry V. Strekalov, JetPropulsionLab.(UnitedStates);Shigeki Takeuchi, HokkaidoUniv.(Japan);Xiao Tang, NationalInstituteofStandardsandTechnology(UnitedStates);Arnold Tunick, U.S.ArmyResearchLab.(UnitedStates)
Monday 13 AugustPosters-Monday . . . . . . . . . . . . . . . . . . . . Mon. 5:30 to 7:30 pm
Conference attendees are invited to attend the poster session on Monday evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
Positive-negative turbulence-free ghost imaging,RonaldE.Meyers,KeithS.Deacon,ArnoldTunick,U.S.ArmyResearchLab.(UnitedStates);YanhuaShih,Univ.ofMaryland,BaltimoreCounty(UnitedStates). . . . . . . . . . . . . . [8518-30]
Narrow bandwidth SPDC correlated photon source using volume Bragg grating,OliverT.Slattery,NationalInstituteofStandardsandTechnology(UnitedStates)andUniv.ofLimerick(Ireland);PaulinaS.Kuo,XiaoTang,NationalInstituteofStandardsandTechnology(UnitedStates) . . . . . [8518-31]
A “plug-in” source of polarization-entangled photon pairs for practical quantum information applications,ZacharyH.Levine,FranciscoE.Becerra,JingyunFan,AlanL.Migdall,NationalInstituteofStandardsandTechnology(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8518-32]
Experimental demonstration of an entanglement microscope,TakafumiOno,RyoOkamoto,ShigekiTakeuchi,HokkaidoUniv.(Japan). . . . . . . . . . [8518-33]
Quantum processing through a manifold of dark states,DeepakKumar,SantoshKumar,JawaharlalNehruUniv.(India) . . . . . . . . . . . . . . . . . . [8518-34]
Wednesday 15 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 1:45 to 3:25 pm
Quantum ImagingSession Chairs: Ronald E. Meyers, U.S.ArmyResearchLab.(UnitedStates);Keith S. Deacon, U.S.ArmyResearchLab.(UnitedStates)
Subwavelength lithography and microscopy (Invited Paper),M.SuhailZubairy,TexasA&MUniv.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . [8518-01]
Quantum superresolution imaging in fluorescence microscopy (Invited Paper),OsipSchwartz,JonathanM.Levitt,DanOron,WeizmannInstituteofScience(Israel) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8518-02]
The first observation of a ghost image with sunlight (Invited Paper),SanjitKarmakar,Univ.ofMaryland,BaltimoreCounty(UnitedStates);RonaldE.Meyers,U.S.ArmyResearchLab.(UnitedStates);YanhuaShih,Univ.ofMaryland,BaltimoreCounty(UnitedStates). . . . . . . . . . . . . . . . . . . . . [8518-03]
Virtual ghost imaging with Bessel beam illumination (Invited Paper),RonaldE.Meyers,KeithS.Deacon,ArnoldTunick,U.S.ArmyResearchLab.(UnitedStates);YanhuaShih,Univ.ofMaryland,BaltimoreCounty(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8518-04]
SESSION 2 . . . . . . . . . . . . . . . . . . . . . . . . . Wed. 3:55 to 5:50 pm
Quantum Communications ISession Chairs: Ronald E. Meyers, U.S.ArmyResearchLab.(UnitedStates);Keith S. Deacon, U.S.ArmyResearchLab.(UnitedStates)
Limit of security evaluation of quantum key distribution (Invited Paper),OsamuHirota,KentaroKato,FumioFutami,TamagawaUniv.(Japan) [8518-05]
Photon information efficient communication through atmospheric turbulence,NiveditaChandrasekaran,JeffreyH.Shapiro,LigongWang,MassachusettsInstituteofTechnology(UnitedStates). . . . . . . . . . . . [8518-06]
Quantum channel capacity for OAM-based free-space optical communications,IvanB.Djordjevic,YequnZhang,TheUniv.ofArizona(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8518-07]
Remote communication of quantum state information without entanglement (Invited Paper),Shi-YaoZhu,BeijingComputationalScienceResearchCtr.(China) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8518-08]
Qudit communication network (Invited Paper),JaewanKim,KoreaInstituteforAdvancedStudy(Korea,Republicof). . . . . . . . . . . . . . . . . . . . . . . . . . [8518-09]
Thursday 16 AugustSESSION 3 . . . . . . . . . . . . . . . . . . . . . . . Thurs. 8:00 to 10:05 am
Quantum Communications IISession Chairs: Ronald E. Meyers, U.S.ArmyResearchLab.(UnitedStates);Keith S. Deacon, U.S.ArmyResearchLab.(UnitedStates)
Experimental realization of Qkd innovative protocols (Invited Paper),MarcoGenovese,IstitutoNazionalediRicercaMetrologica(Italy) . . . . . . . . . [8518-10]
Experimental aircraft to ground BB84 quantum key distribution (Invited Paper),SebastianNauerth,Ludwig-Maximilians-Univ.München(Germany);FlorianMoll,DeutschesZentrumfürLuft-undRaumfahrte.V.(Germany);MarkusRau,Ludwig-Maximilians-Univ.München(Germany);JoachimHorwath,ChristianFuchs,DeutschesZentrumfürLuft-undRaumfahrte.V.(Germany);HaraldWeinfurter,Ludwig-Maximilians-Univ.München(Germany)andMax-Planck-InstitutfürQuantenoptik(Germany). . . . . . . . . . . . . . . . . . . . . [8518-11]
Techniques for performing a quantum communication uplink to satellites (Invited Paper),ThomasD.Jennewein,EvanMeyer-Scott,BrendonL.Higgins,Jean-PhilippeBourgoin,ChristopherErven,ZhizhongYan,Univ.ofWaterloo(Canada);BettinaHeim,Univ.ofWaterloo(Canada)andMaxPlanckInstitutefortheScienceofLight(Germany)andFriedrich-Alexander-Univ.Erlangen-Nürnberg(Germany);HannesHübel,StockholmUniv.(Sweden)andUniv.ofWaterloo(Canada);GregorWeihs,Leopold-Franzens-Univ.Innsbruck(Austria)andUniv.ofWaterloo(Canada);MorioToyoshima,NationalInstituteofInformationandCommunicationsTechnology(Japan)............. [8518-12]
Quantum simulation of Josephson effect in trapped ions (Invited Paper),PatriciaJ.Lee,U.S.ArmyResearchLab.(UnitedStates) . . . . . . . . . . [8518-13]
A quantum network with atoms and photons (Invited Paper),RonaldE.Meyers,PatriciaJ.Lee,QudsiaQuraishi,KeithS.Deacon,ArnoldTunick,U.S.ArmyResearchLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . [8518-14]
184 spie.org/opadvance · TEL:+13606763290 · help@spie.org
SESSION 4 . . . . . . . . . . . . . . . . . . . Thurs. 10:25 am to 12:05 pm
Entangelment and Multiphoton InterferenceSession Chairs: Ronald E. Meyers, U.S.ArmyResearchLab.(UnitedStates);Keith S. Deacon, U.S.ArmyResearchLab.(UnitedStates)
New features of two-photon states (Invited Paper),RonFolman,Ben-GurionUniv.oftheNegev(Israel). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8518-15]
Experimental study of symmetric single photon heralding efficiency in a type-II spontaneous parametric down-conversion process in a PPKTP crystal (Invited Paper),FranciscoE.Becerra,NationalInstituteofStandardsandTechnology(UnitedStates);BorisL.Glebov,CollegeofOpticalSciences,TheUniv.ofArizona(UnitedStates);ThomasGerrits,AdrianaE.Lita,JingyunFan,SaeWooNam,AlanL.Migdall,NationalInstituteofStandardsandTechnology(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8518-16]
Generation of spatially pure photon pairs in a multimode nonlinear waveguide using intermodal dispersion (Invited Paper),MichalKarpinski,CzeslawRadzewicz,KonradBanaszek,Univ.ofWarsaw(Poland) . . . [8518-17]
Preparation of N-photon qubits from incoherent thermal fields (Invited Paper),HuiChen,TaoPeng,YanhuaShih,Univ.ofMaryland,BaltimoreCounty(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8518-18]
Lunch/Exhibition Break.............................. 12:05to1:05pm
SESSION 5 . . . . . . . . . . . . . . . . . . . . . . . . Thurs. 1:05 to 3:05 pm
Quantum Technology ISession Chairs: Ronald E. Meyers, U.S.ArmyResearchLab.(UnitedStates);Keith S. Deacon, U.S.ArmyResearchLab.(UnitedStates)
Quantum-inspired bio-sensing with nitrogen-vacancy color centers in diamond (Invited Paper),PhilipR.Hemmer,TexasA&MUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8518-19]
Experimental investigation of the X-shaped spatio-temporal correlation of twin photons via sum frequency generation,OttaviaJedrkiewicz,AlessandraGatti,EnricoBrambilla,LuigiA.Lugiato,PaoloDiTrapani,Univ.degliStudidell’Insubria(Italy). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8518-20]
Experimental realization of an approximate partial transpose for photonic two-qubit systems (Invited Paper),Hyang-TagLim,Yong-SuKim,Young-SikRa,PohangUniv.ofScienceandTechnology(Korea,Republicof);JoonwooBae,KoreaInstituteforAdvancedStudy(Korea,Republicof);Yoon-HoKim,PohangUniv.ofScienceandTechnology(Korea,Republicof). . . . . . [8518-21]
Demonstration of adaptive quantum estimation with photons (Invited Paper),RyoOkamoto,TheInstituteofScientificandIndustrialResearch(Japan);MinakoIefuji,KoichiYamagata,OsakaUniv.(Japan);HiroshiImai,Univ.degliStudidiPavia(Italy);MasazumiFujiwara,Hong-QuanZhao,TheInstituteofScientificandIndustrialResearch(Japan);AkioFujiwara,OsakaUniv.(Japan);ShigekiTakeuchi,TheInstituteofScientificandIndustrialResearch(Japan). . [8518-22]
Quantum limits in compressed sensing of optical images (Invited Paper),MikhailKolobov,Univ.desSciencesetTechnologiesdeLille(France);HuiWang,ShanghaiInstituteofOpticsandFineMechanics(China)andUniv.desSciencesetTechnologiesdeLille(France);ShenshengHan,ShanghaiInstituteofOpticsandFineMechanics(China) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8518-23]
Conference 8518
SESSION 6 . . . . . . . . . . . . . . . . . . . . . . . . Thurs. 3:25 to 5:55 pm
Quantum Technology IISession Chairs: Ronald E. Meyers, U.S.ArmyResearchLab.(UnitedStates);Keith S. Deacon, U.S.ArmyResearchLab.(UnitedStates)
Precise determination of a coherence vortex using a triangular aperture (Invited Paper),EduardoJ.Fonseca,AlcenisioJ.Jesus-Silva,JandirMiguelHickmann,Univ.FederaldeAlagoas(Brazil) . . . . . . . . . . . . . . . . . . . . [8518-24]
Production of multiple diamond-based sources of single photons (Invited Paper),StefaniaA.Castelletto,MacquarieUniv.(Australia). . . . . . . . . [8518-25]
Achievable precision for optical ranging systems (Invited Paper),BruceMoision,BarisI.Erkmen,JetPropulsionLab.(UnitedStates). . . . . . . [8518-26]
Tomography of a high-purity narrowband photon from four-wave mixing in atomic vapour (Invited Paper),TravisBrannan,AndrewJ.MacRae,RoshanAchal,AlexanderI.Lvovsky,Univ.ofCalgary(Canada). . . . . . . . . . . . [8518-27]
Dual-channel, single-photon upconversion detector near 1300 nm (Invited Paper),PaulinaS.Kuo,NationalInstituteofStandardsandTechnology(UnitedStates);JasonS.Pelc,StanfordUniv.(UnitedStates);OliverT.Slattery,LijunMa,NationalInstituteofStandardsandTechnology(UnitedStates);MartinM.Fejer,StanfordUniv.(UnitedStates);XiaoTang,NationalInstituteofStandardsandTechnology(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8518-28]
Photonic quantum technologies (Invited Paper),JeremyL.O’Brien,Univ.ofBristol(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8518-29]
spie.org/opadvance · TEL:+13606763290 · help@spie.org 185
Conference 8519Monday-Tuesday 13-14 August 2012 • Proceedings of SPIE Vol. 8519
Nanophotonics and Macrophotonics for Space Environments VIConference Chairs:Edward W. Taylor, InternationalPhotonicsConsultants,Inc.(UnitedStates);David A. Cardimona, AirForceResearchLab.(UnitedStates)
Conference Co-Chairs:Ronald G. Pirich, NorthropGrummanAerospaceSystems(UnitedStates);Narasimha S. Prasad, NASALangleyResearchCtr.(UnitedStates)
Program Committee:Mansoor Alam, Nufern(UnitedStates);Koen Clays, KatholiekeUniv.Leuven(Belgium);Vincent M. Cowan, AirForceResearchLab.(UnitedStates);Douglas M. Craig, AirForceResearchLab.(UnitedStates);Michael J. Hayduk, AirForceResearchLab.(UnitedStates);Mark G. Kuzyk, WashingtonStateUniv.(UnitedStates);Anthony D. Sanchez, AirForceResearchLab.(UnitedStates)
Monday 13 AugustWelcome and Opening Remarks . . . . . . . .Mon. 8:00 to 8:10 am
Conference Chair: Edward W. Taylor,InternationalPhotonicsConsultants,Inc.(UnitedStates)
SESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . .Mon. 8:10 to 10:15 am
Novel Materials and Components for Space Applications ISession Chair: Narasimha S. Prasad, NASALangleyResearchCtr.
(UnitedStates)
Versatile photonic sensor systems for space applications (Invited Paper),JohnMatthews,LeonidBukshpun,RanjitD.Pradhan,PhysicalOpticsCorp.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8519-01]
Gamma-ray irradiation of ohmic MEMS switches (Invited Paper),JohnJ.Maciel,JamesL.Lampen,RadantMEMS,Inc.(UnitedStates);EdwardW.Taylor,InternationalPhotonicsConsultants,Inc.(UnitedStates). . . . . [8519-02]
Advanced materials and device technology for photonic electric field sensors (Invited Paper),JamesE.Toney,VincentE.Stenger,SriSriram,SRICOInc.(UnitedStates);EdwardW.Taylor,InternationalPhotonicsConsultants,Inc.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8519-03]
Biopolymer-based dielectric materials for space environments (Invited Paper),JamesG.Grote,AirForceResearchLab.(UnitedStates);EdwardW.Taylor,InternationalPhotonicsConsultants,Inc.(UnitedStates);FahimaOuchen,AirForceResearchLab.(UnitedStates);GuruSubramanyam,Univ.ofDayton(UnitedStates);NarayananVenkat,Univ.ofDaytonResearchInstitute(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8519-04]
Hot-electron microbolometers based on disordered GaN heterostructures for high resolution THz spectroscopy (Invited Paper),BorisS.Karasik,JohnJ.Gill,ImranMehdi,JetPropulsionLab.(UnitedStates);VictorA.Pogrebnyak,VladimirV.Mitin,AndreiV.Sergeev,Univ.atBuffalo(UnitedStates);DaroldC.Wobschall,Esensors,Inc.(UnitedStates);RemisGaska,SensorElectronicTechnology,Inc(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8519-05]
SESSION 2 . . . . . . . . . . . . . . . . . . . . Mon. 10:45 am to 12:15 pm
Novel Materials and Components for Space Applications IISession Chair: Edward W. Taylor, InternationalPhotonicsConsultants,
Inc.(UnitedStates)
Nanoengineered quantum dot medium for space optoelectronic devices,SergeOktyabrsky,VadimE.Tokranov,MichaelYakimov,Univ.atAlbany(UnitedStates);AndreiV.Sergeev,VladimirV.Mitin,Univ.atBuffalo(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8519-06]
Enabling an all-guided-wave mid-IR laser source (Invited Paper),F.KennethHopkins,DarnellE.Diggs,AirForceResearchLab.(UnitedStates) . . [8519-07]
Terahertz nanophotonics for space applications (Invited Paper),EricDonkor,Univ.ofConnecticut(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . [8519-08]
Lunch Break. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12:15to1:20pm
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 1:20 to 3:00 pm
Advancement of New and Emerging Quantum MaterialsSession Chairs: Javier Pérez-Moreno, KatholiekeUniv.Leuven
(Belgium);Mark G. Kuzyk, WashingtonStateUniv.(UnitedStates)
Polymer frontier orbital and morphology engineering for nanophotonics (Invited Paper),Sam-ShajingSun,ThuongH.Nguyen,TanyaDavid,JaleesaBrooks,AmandaHarding,NorfolkStateUniv.(UnitedStates);ChengZhang,SouthDakotaStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . [8519-09]
Enhancing local field and microscopic cascading contributions to higher-order nonlinear-optical responses through forced geometric constraints (Invited Paper),NathanJ.Dawson,JamesH.Andrews,YoungstownStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8519-10]
An all-optical protocol to determine the molecular origin of radiation damage/enhancement in electro-optic polymeric materials (Invited Paper),JavierPérez-Moreno,StijnJ.VanCleuvenbergen,KoenClays,KatholiekeUniv.Leuven(Belgium);EdwardW.Taylor,InternationalPhotonicsConsultants,Inc.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8519-11]
Potential energy optimization and Monte Carlo simulations of the first hyperpolarizability: a comparative study (Invited Paper),ShoreshShafei,MarkG.Kuzyk,WashingtonStateUniv.(UnitedStates). . . . . . . . . . . . . . . . [8519-12]
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . Mon. 3:30 to 5:35 pm
Self-Healing Materials for Space ApplicationsSession Chair: Nathan J. Dawson, YoungstownStateUniv.(United
States)
Correlated aggregate model of self healing in dye-doped polymers (Invited Paper),MarkG.Kuzyk,ShivaK.Ramini,WashingtonStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8519-13]
Correlation between molecular structure and self healing in a series of anthraquinone derivatives doped in PMMA polymer (Invited Paper),PrabodhDhakal,ShivaK.Ramini,MarkG.Kuzyk,WashingtonStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8519-14]
Reversible photodegradation through chromophore-polymer interactions in Disperse Orange 11 dye-doped PMMA thin films (Invited Paper),ShivaK.Ramini,MarkG.Kuzyk,WashingtonStateUniv.(UnitedStates). . . . . [8519-15]
Testing theories of self healing using photoconductivity as a probe of photodegradation and recovery (Invited Paper),BenjaminR.Anderson,Sheng-TingHung,MarkG.Kuzyk,WashingtonStateUniv.(UnitedStates). . [8519-16]
Azobenzene compound-based photomechanical actuator devices (Invited Paper),XianjunYe,MarkG.Kuzyk,WashingtonStateUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8519-17]
Posters-Monday . . . . . . . . . . . . . . . . . . . . Mon. 5:30 to 7:30 pmConference attendees are invited to attend the poster session on Monday
evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
Radiation hardened DNA-based coatings,EdwardW.Taylor,InternationalPhotonicsConsultants,Inc.(UnitedStates). . . . . . . . . . . . . . . . . . . . . [8519-28]
186 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Tuesday 14 AugustWelcome and Opening Remarks . . . . . . . Tues. 8:00 to 8:05 am
Conference Chair:David A. Cardimona, AirForceResearchLab.(UnitedStates)
SESSION 5 . . . . . . . . . . . . . . . . . . . . . . . . Tues. 8:05 to 10:00 am
Advances in Photonic Components for Space ISession Chair: David A. Cardimona, AirForceResearchLab.(United
States)
Monovalent-barrier photodiodes for infrared photodetection,ThomasE.Vandervelde,TuftsUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . [8519-18]
The use of small x-ray detectors for deep space relative navigation,PatrickDoyle,DemozGebre-Egziabher,Univ.ofMinnesota,TwinCities(UnitedStates);SuneelSheikh,ASTERLabs,Inc.(UnitedStates). . . . . . . . . . . . . . . . . [8519-19]
3D sensor development to support EDL (entry, descent, and landing) for autonomous missions to Mars (Invited Paper),BodoSchmidt,StewartTuvey,PaulBanks,Tetravue(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . [8519-20]
Femtosecond fiber laser-based micro- and nano-processing (Invited Paper),HuanHuang,Lih-MeiYang,JianLiu,PolarOnyx,Inc.(UnitedStates). [8519-21]
Single-frequency gain-switched Ho-doped fiber laser at 2.05 micron (Invited Paper),JihongGeng,AdValuePhotonics,Inc.(UnitedStates). . . . . . . [8519-22]
SESSION 6 . . . . . . . . . . . . . . . . . . . . Tues. 10:30 am to 12:30 pm
Advances in Photonic Components for Space IISession Chairs: Anthony D. Sanchez, AirForceResearchLab.(United
States);Douglas M. Craig, AirForceResearchLab.(UnitedStates)
Performance testing of lidar components subjected to space exposure in space via MISSE 7 mission (Invited Paper),NarasimhaS.Prasad,NASALangleyResearchCtr.(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . [8519-23]
Next-generation photonic true time delay devices as enabled by a new electro-optic architecture: suitability for space deployment (Invited Paper),ScottR.Davis,SethJohnson,ScottD.Rommel,MichaelH.Anderson,VescentPhotonicsInc.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8519-24]
Effect of low energy He + ions irradiation on single layer InAs/GaAs quantum dot heterostructures,ArjunMandal,IndianInstituteofTechnologyBombay(India);M.R.Misra,S.V.L.S.Rao,P.Singh,BhabhaAtomicResearchCtr.(India);SubhanandaChakrabarti,IndianInstituteofTechnologyBombay(India). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8519-25]
Fiber lasers for remote sensing, imaging and communication (Invited Paper),MehmetcanAkbulut,DorukEngin,YoumingChen,FrankKimpel,ShantanuGupta,HoracioR.Verdun,Fibertek,Inc.(UnitedStates). . . . . . . . . . . [8519-26]
Gamma ray induced attenuation of high-power all-fiber optical amplifier pump combiners (Invited Paper),AnthonyD.Sanchez,AirForceResearchLab.(UnitedStates);EdwardW.Taylor,InternationalPhotonicsConsultants,Inc.(UnitedStates);NigelHolehouse,ITFLabs./AvensysTech(Canada). . [8519-27]
Conference 8519
spie.org/opadvance · TEL:+13606763290 · help@spie.org 187
Conference 8520Monday-Tuesday 13-14 August 2012 • Proceedings of SPIE Vol. 8520
Unconventional Imaging and Wavefront Sensing VIIIConference Chairs:Jean J. Dolne, TheBoeingCo.(UnitedStates);Thomas J. Karr, Consultant(UnitedStates);Victor L. Gamiz, AirForceResearchLab.(UnitedStates)
Conference Co-Chair:David C. Dayton, AppliedTechnologyAssociates(UnitedStates)
Program Committee:Stephen C. Cain, AirForceInstituteofTechnology(UnitedStates);James Fienup, Univ.ofRochester(UnitedStates);Wes D. Freiwald, PacificDefenseSolutions,LLC(UnitedStates);Richard B. Holmes, BoeingLTSInc.(UnitedStates);Liren Liu, ShanghaiInstituteofOpticsandFineMechanics(China);Zhaowei Liu, Univ.ofCalifornia,SanDiego(UnitedStates);Sergio R. Restaino, U.S.NavalResearchLab.(UnitedStates);Michael C. Roggemann, MichiganTechnologicalUniv.(UnitedStates);Robert K. Tyson, TheUniv.ofNorthCarolinaatCharlotte(UnitedStates);David G. Voelz, NewMexicoStateUniv.(UnitedStates)
Monday 13 AugustPosters-Monday . . . . . . . . . . . . . . . . . . . . Mon. 5:30 to 7:30 pm
Conference attendees are invited to attend the poster session on Monday evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
Retractable imaging system on Cessna T-206,RudolphNolasco,DavidC.Dayton,AppliedTechnologyAssociates(UnitedStates);GregoryFertig,MichaelMyers,John-PaulSena,ChristopherGuida,AirForceResearchLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8520-23]
Image-based deformable mirror calibration using phase diversity for adaptive optics,NorihideMiyamura,TheUniv.ofTokyo(Japan). . . . [8520-24]
Hyperspectral measurements using a compact SWIR camera,DavidC.Dayton,AppliedTechnologyAssociates(UnitedStates);MichaelMyers,GregoryFertig,ChristopherGuida,John-PaulSena,AirForceResearchLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8520-25]
Phase error correction by phase differential algorithm for synthetic aperture imaging ladar,Ya’nanZhi,JianfengSun,YuZhou,EnwenDai,LirenLiu,ShanghaiInstituteofOpticsandFineMechanics(China) . . . . . . . . . . [8520-26]
Laser speckle effect overcome using multireceiver method in the synthetic aperture laser imaging ladar,JianfengSun,YuZhou,Ya’nanZhi,EnwenDai,LirenLiu,ShanghaiInstituteofOpticsandFineMechanics(China). . . [8520-27]
The impact and reduction of space-time speckle on synthetic aperture imaging ladar,QianXu,LirenLiu,YuZhou,JianfengSun,YapengWu,ShanghaiInstituteofOpticsandFineMechanics(China)................... [8520-28]
A large-angle high-speed scanner based on electro-optic crystal for Fresnel telescope synthetic aperture imaging ladar,JunXu,Ya’nanZhi,JianfengSun,YuZhou,EnwenDai,LirenLiu,ShanghaiInstituteofOpticsandFineMechanics(China). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8520-29]
Tuesday 14 AugustSESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 8:00 to 9:40 am
Wavefront Sensing and ControlSession Chair: David C. Dayton, AppliedTechnologyAssociates(United
States)
Multiple laser guide stars (LGS) for multiple conjugate adaptive optics (MCAO),KatharineJ.Jones,WBAOConsultantGroup(UnitedStates)[8520-01]
The aggregate behavior of branch points: verification in wave optical simulation II,DenisW.Oesch,SAIC(UnitedStates);CarolynM.Tewksbury-Christle,DarrylJ.Sanchez,PatrickR.Kelly,AirForceResearchLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8520-02]
A means to measure the size of the elements in the slope discrepancy Hilbert space,DarrylJ.Sanchez,AirForceResearchLab.(UnitedStates);DenisW.Oesch,SAIC(UnitedStates);PatrickR.Kelly,AirForceResearchLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8520-03]
Low-cost high-speed adaptive optical system with stacked actuator deformable mirror to correct for atmospheric turbulence,AlexisV.Kudryashov,AlexeyRukosuev,VadimSamarkin,AlexanderAlexandrov,ActiveOpticsNightNLtd.(RussianFederation). . . . . . . . . . . . . . . . . . . . . . . [8520-04]
An investigation of stair mode in optical phased arrays using tiled apertures,MarkF.Spencer,AirForceInstituteofTechnology(UnitedStates);MiloW.HydeIV,AirForceInstituteofTechnolgy(UnitedStates) . . . . [8520-05]
SESSION 2 . . . . . . . . . . . . . . . . . . . . . . . . Tues. 9:40 to 10:40 am
Adaptive Coded Aperture ImagingSession Chair: Stanley Rogers, AirForceResearchLab.(UnitedStates)
An efficient and novel computation method for simulating diffraction patterns from large-scale coded apertures on large-scale focal plane arrays,AbrahamShrekenhamer,StephenR.Gottesman,NorthropGrummanElectronicSystems(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . [8520-06]
A systematic investigation of large-scale diffractive coded aperture designs,StephenR.Gottesman,AbrahamShrekenhamer,AbrahamIsser,GeorgeGigioli,Jr.,NorthropGrummanElectronicSystems(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8520-07]
Adaptive compressive detection and classification using mixture of Gaussian priors,AmitAshok,MichaelW.Marcellin,TheUniv.ofArizona(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8520-08]
SESSION 3 . . . . . . . . . . . . . . . . . . . . Tues. 11:00 am to 12:30 pm
Novel Systems ISession Chair: James R. Fienup, Univ.ofRochester(UnitedStates)
Novel optical imaging techniques enabled by plasmonics (Invited Paper),ZhaoweiLiu,Univ.ofCalifornia,SanDiego(UnitedStates). . . . . . . . . [8520-09]
Looking through an opaque screen,JacopoBertolotti,Univ.Twente(Netherlands)andUniv.Florence(Italy);ElbertvanPutten,Univ.Twente(Netherlands);AdLagendijk,AMOLF(Netherlands);WillemVos,AllardMosk,Univ.Twente(Netherlands). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8520-10]
Turbulence compensation for laser communication and imaging on horizontal path and non-natural turbulence using direct and iterative procedures,GabrieleMarchi,CorinneScheifling,AndreasZepp,Fraunhofer-InstitutfürOptronik,SystemtechnikundBildauswertung(Germany). . [8520-11]
A polychromatic approach to far field superlensing in the visible,FabriceLemoult,MathiasFink,GeoffroyLerosey,L’InstitutLangevin(France) [8520-12]
Lunch/Exhibition Break.............................. 12:30to1:40pm
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 1:40 to 3:00 pm
ExploitationSession Chair: Richard B. Holmes, BoeingLTSInc.(UnitedStates)
Maximum a posteriori ladar imaging in the presence of speckle and scintillation noise,DavidC.Dayton,RudolphNolasco,AppliedTechnologyAssociates(UnitedStates);GregoryFertig,MichaelMyers,John-PaulSena,ChristopherGuida,AirForceResearchLab.(UnitedStates). . . . . . . . [8520-13]
Multiframe fusion of undersampled 3D imagery,StephenC.Cain,AirForceInstituteofTechnology(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . [8520-14]
Comparison of fast correlation algorithms for ladar tracking,DavidC.Dayton,RudolphNolasco,AppliedTechnologyAssociates(UnitedStates);GregoryFertig,MichaelMyers,John-PaulSena,ChristopherGuida,AirForceResearchLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8520-15]
Understanding the physics of optical deep turbulence at the Earth’s boundary layer,ThomasC.Farrell,DarrylSanchez,JulieSmith,JasonHolzman,PatrickKelly,AirForceResearchLab.(UnitedStates);AnnSlavin,Boeing-SVS,Inc.(UnitedStates);AnitaGallegos,SAIC(UnitedStates). . . . . . . . . . [8520-16]
188 spie.org/opadvance · TEL:+13606763290 · help@spie.org
SESSION 5 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 3:20 to 5:30 pm
Novel Systems IISession Chair: Stephen C. Cain, AirForceInstituteofTechnology
(UnitedStates)
Very high resolution interferometric imaging of geostationary objects from the ground (Invited Paper),MichaelHart,HartScientificConsultingInternationalL.L.C.(UnitedStates);JeffreyKingsley,WarrenDavison,TheUniv.ofArizona(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8520-17]
Intensity interferometry experiments and simulations,RichardB.Holmes,BoeingLTSInc.(UnitedStates);CaseyPellizzari,KeithKnox,AirForceResearchLab.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8520-18]
Infrared transform spectral imager,PajoVujkovic-Cvijin,JamineLee,BrianGregor,NeilGoldstein,MarshaFox,SpectralSciences,Inc.(UnitedStates) . . .[8520-19]
Image restoration technique for motion-compensated frame averaged data collected by 3D flash ladar imaging system,BrianJ.Neff,StephenCain,AirForceInstituteofTechnology(UnitedStates). . . . . . . . . . . . . . . . . . . . [8520-20]
Spatiotemporal focusing-based widefield multiphoton microscopy for fast optical sectioning of thick tissues,Li-ChungCheng,Shean-JenChen,NationalChengKungUniv.(Taiwan). . . . . . . . . . . . . . . . . . . . . . . . . . . [8520-21]
Widefield multiphoton microscopy with image-based adaptive optics,Chia-YuanChang,Shean-JenChen,NationalChengKungUniv.(Taiwan) . [8520-22]
Conference 8520
Contact:LauraSharik,EducationServices
lauras@spie.org|Tel:+13606763290
spie.org/inco
In-Company Training
Bring Live SPIE Courses to Your Company
Have a group to train?Any SPIE course can be taught live at your company— anytime, anywhere.
Save Time and moneyBringindustryexpertstoyourfacilityforaprivatecourse.Yourteamwillacquirenewknowledgeandskillswithoutstafftravel.
Expert Instructors, relevant TrainingSPIEcoursesaretaughtbyworld-renownedexpertsfromindustryandacademia.Coursesrunfromonetothreedaysofconcentratedinstruction.
spie.org/opadvance · TEL:+13606763290 · help@spie.org 189
Conference 8521Tuesday-Wednesday 14-15 August 2012 • Proceedings of SPIE Vol. 8521
Instruments, Methods, and Missions for Astrobiology XVConference Chairs:Richard B. Hoover, NASAMarshallSpaceFlightCtr.(UnitedStates);Gilbert V. Levin, ArizonaStateUniv.(UnitedStates);Alexei Yu. Rozanov, PaleontologicalInstitute(RussianFederation);Paul C. W. Davies, ArizonaStateUniv.(UnitedStates)
Program Committee:Marina M. Astafieva, PaleontologicalInstitute(RussianFederation);Michael H. Engel, TheUniv.ofOklahoma(UnitedStates);George E. Fox, Univ.ofHouston(UnitedStates);Todd Holden, QueensboroughCommunityCollege(UnitedStates);Vera M. Kolb, Univ.ofWisconsin-Parkside(UnitedStates);David S. McKay, NASAJohnsonSpaceCtr.(UnitedStates);Joseph D. Miller, TheUniv.ofSouthernCalifornia(UnitedStates);Prasanta K. Mukhopadhyay, GlobalGeoenergyResearchLtd.(Canada);Elena V. Pikuta, NationalSpaceScienceandTechnologyCtr.(UnitedStates);Nilton O. Rennó, Univ.ofMichigan(UnitedStates);Charles V. Rice, TheUniv.ofOklahoma(UnitedStates);Dongok Ryu, YonseiUniv.(Korea,Republicof);Birgit I. Sattler, Leopold-Franzens-Univ.Innsbruck(Austria);Robert B. Sheldon, NASAMarshallSpaceFlightCtr.(UnitedStates);Michael C. Storrie-Lombardi, KinohiInstitute(UnitedStates);George Tremberger, Jr., QueensboroughCommunityCollege(UnitedStates);N. Chandra Wickramasinghe, CardiffUniv.(UnitedKingdom)
Monday 13 August
Posters-Monday . . . . . . . . . . . . . . . . . . . . Mon. 5:30 to 7:30 pmConference attendees are invited to attend the poster session on Monday
evening. Come view the posters, enjoy light refreshments, ask questions, and network with colleagues in your field. Authors of poster papers will be present to answer questions concerning their papers. Attendees are required to wear
their conference registration badges to the poster sessions. Poster authors, view poster presentation guidelines at http://spie.org/x30293.xml.
Wavelet analysis of the Viking LR data, JessicaTsay,MonicaGobrial,JosephD.Miller,TheUniv.ofSouthernCalifornia(UnitedStates) . . . . . . . . . [8521-26]
Tuesday 14 AugustChairs’ Welcome and Introductions . . . . Tues. 8:00 to 8:10 am
Session Chairs: Richard B. Hoover, NASAMarshallSpaceFlightCtr.(UnitedStates);Gilbert V. Levin, ArizonaStateUniv.(UnitedStates);Alexei Yu. Rozanov, PaleontologicalInstitute(RussianFederation)
SESSION 1 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 8:10 to 9:10 am
Astrobiology of MarsSession Chair: Michael H. Engel, TheUniv.ofOklahoma(UnitedStates)
Stealth life detection instruments aboard Curiosity (Invited Paper),GilbertV.Levin,ArizonaStateUniv.(UnitedStates)andUniv.ofBuckingham(UnitedKingdom). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8521-01]
Evidence of oil and gas hydrates within planet Mars: early biogenic or thermogenic sources from the Martian soils and deeper sediments near the deltas (Invited Paper),PrasantaK.Mukhopadhyay,GlobalGeoenergyResearchLtd.(Canada). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8521-02]
SESSION 2 . . . . . . . . . . . . . . . . . . . . . . . . Tues. 9:10 to 10:30 am
Biomolecules, Microfossils, and Microorganisms in Carbonaceous Meteorites
Session Chair: Gilbert V. Levin, ArizonaStateUniv.(UnitedStates)
Origins of the L-amino acid excess in carbonaceous meteorites (Invited Paper),MichaelH.Engel,TheUniv.ofOklahoma(UnitedStates). . . . [8521-03]
Microbiological study of the Murchison CM2 meteorite,ElenaV.Pikuta,RichardB.Hoover,NationalSpaceScienceandTechnologyCtr.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8521-04]
Microfossils and biomolecules in carbonaceous meteorites: implications to the origin of life on Earth (Invited Paper),RichardB.Hoover,NASAMarshallSpaceFlightCtr.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8521-05]
SESSION 3 . . . . . . . . . . . . . . . . . . . . . . . Tues. 11:00 to 11:50 am
Microfossils and Microorganisms in Ancient RocksSession Chair: N. Chandra Wickramasinghe, CardiffUniv.(United
Kingdom)
Early Precambrian weathering crusts of Baltic shield from bacterial-paleontological point of view (Invited Paper),MarinaM.Astafieva,AlexeiY.Rozanov,PaleontologicalInstitute(RussianFederation);RichardB.Hoover,NASAMarshallSpaceFlightCtr.(UnitedStates). . . . . . . . . . . . . . . . . [8521-06]
Microscopic and microbiological investigations of Mississippian sylvite,RichardB.Hoover,NASAMarshallSpaceFlightCtr.(UnitedStates) . [8521-07]
Lunch/Exhibition Break........................... 11:50amto1:40pm
SESSION 4 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 1:40 to 3:10 pm
Prebiotic Chemistry and the Origin of Life ISession Chairs: Marina M. Astafieva, PaleontologicalInstitute(Russian
Federation);Robert B. Sheldon, NASAMarshallSpaceFlightCtr.(UnitedStates)
On the laws for the emergence of life from the abiotic matter (Invited Paper),VeraM.Kolb,Univ.ofWisconsin-Parkside(UnitedStates). . . . . . . . . [8521-08]
Big Bang or Continuous Creation: does life have multiple origins?,GregoryA.Konesky,K-PlasmaLtd.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . [8521-09]
Fluid mechanics leads to life in the universe,CarlH.Gibson,Univ.ofCalifornia,SanDiego(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . [8521-10]
The importance of horizontal gene transfer in evolution,W.BrighamKlyce,Jr.,AstrobiologyResearchTrust(UnitedStates) . . . . . . . . . . . . . . . . . [8521-11]
SESSION 5 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 3:40 to 4:30 pm
Prebiotic Chemistry and the Origin of Life IISession Chair: Elena V. Pikuta, NationalSpaceScienceand
TechnologyCtr.(UnitedStates)
Application of the organic “on water” reactions to prebiotic chemistry (Invited Paper),VeraM.Kolb,Univ.ofWisconsin-Parkside(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8521-12]
Coacervates and their prebiotic potential,VeraM.Kolb,Univ.ofWisconsin-Parkside(UnitedStates);FredricM.Menger,EmoryUniv.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8521-13]
190 spie.org/opadvance · TEL:+13606763290 · help@spie.org
SESSION 6 . . . . . . . . . . . . . . . . . . . . . . . . . Tues. 4:30 to 5:30 pm
Exoplanets and AstrobiologySession Chair: George E. Fox, Univ.ofHouston(UnitedStates)
Improvement of 3D BRDF integrated atmosphere model in Earthlike exoplanet using ray-tracing-based method (Invited Paper),DongokRyu,Sug-WhanKim,SehyunSeong,YonseiUniv.(Korea,Republicof). . . . . . . [8521-14]
When did Earth appear habitable? (Invited Paper),GregoryA.Konesky,K-PlasmaLtd.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8521-15]
Life in the Cosmos . . . . . . . . . . . . . . . Tues. 8:00 to 10:00 pm
Panel Moderators: Richard B. Hoover, NASAMarshallSpaceFlightCtr.(UnitedStates);N. Chandra Wickramasinghe, Cardiff
Univ.(UnitedKingdom)
Panelists:Michael H. Engel,TheUniv.ofOklahoma;George E. Fox, Univ.ofHouston(UnitedStates); Gilbert V. Levin, ArizonaStateUniv.; Joseph D. Miller,TheUniv.ofSouthernCalifornia(UnitedStates);Alexei Yu. Rozanov,PaleontologicalInstitute(Russian
Federation); Charles V. Rice, TheUniv.ofOklahoma;Michael C. Storrie-Lombardi,KinohiInstitute(UnitedStates)
DoeslifeexistonlyonEarth,orisitacosmicimperativeandwidelydistributedthroughouttheCosmos?ThisisthefundamentalquestionofAstrobiology.ItisnowwellestablishedthatlifeexistsinEarthwhereverliquidwater,biogenicelementsandasourceofenergyco-exist.ArecentstudyofreddwarfstarscarriedoutattheEuropeanSouthernObservatoryhasrevealedthattensofbillionsofrocky,Earth-sizedplanetswiththepotentialforliquidwaterprobablyexistintheMilkyWaygalaxyalone.Astrobiologists,biochemists,microbiologists,andpaleontologistscontinuetoinvestigatetheoriginofpre-bioticandchiralbiomoleculesandlifeandthedistributionofwaterandlifeonEarthandintheCosmos.The2012SPIELifeintheCosmosPanelwillreviewrecentdiscoveriesinAstronomy,Microbiology,andAstrobiologyanddiscusstheirimplicationswithmembersoftheaudience.
Wednesday 15 AugustSESSION 7 . . . . . . . . . . . . . . . . . . . . . . . . .Wed. 8:00 to 10:00 am
Microbial ExtremophilesSession Chairs: Prasanta K. Mukhopadhyay, GlobalGeoenergy
ResearchLtd.(Canada);Carl H. Gibson, Univ.ofCalifornia,SanDiego(UnitedStates)
Evolution of Archaea in 3D modeling (Invited Paper),ElenaV.Pikuta,NationalSpaceScienceandTechnologyCtr.(UnitedStates);DraganaTankosic,NASAMarshallSpaceFlightCtr.(UnitedStates);RobertB.Sheldon,NationalSpaceScienceandTechnologyCtr.(UnitedStates). . . . . . . . . . . . . . . . . . . . [8521-16]
Cryoprotection from lipoteichoic acid (Invited Paper),CharlesV.Rice,TheUniv.ofOklahoma(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8521-17]
Nucleotide fluctuation in extremophilic cold adapted sequences and their degradation codes (Invited Paper),ToddHolden,GeorgeTremberger,Jr.,TakD.Cheung,QueensboroughCommunityCollege(UnitedStates) . . . . [8521-18]
The ribosome: insights to early events in the evolution of life as we know it (Invited Paper),QuyenTran,GeorgeE.Fox,Univ.ofHouston(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8521-23]
Conference 8521
SESSION 8 . . . . . . . . . . . . . . . . . . . . Wed. 10:30 am to 12:00 pm
Comets, Moons, Primordial Planets, and AstrobiologySession Chairs: Todd Holden, QueensboroughCommunityCollege
(UnitedStates);Charles V. Rice, TheUniv.ofOklahoma(UnitedStates)
Role of primordial planets in the present epoch (Invited Paper),N.ChandraWickramasinghe,Univ.ofBuckingham(UnitedKingdom);CarlH.Gibson,Univ.ofCalifornia,SanDiego(UnitedStates);RudolphE.Schild,Harvard-SmithsonianCtr.forAstrophysics(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . [8521-19]
Extraterrestrial life contradicts dark energy,CarlH.Gibson,Univ.ofCalifornia,SanDiego(UnitedStates) . . . . . . . . . . . . . . . . . . . . . . . . . . [8521-20]
Carbonaceous chondrites as bioengineered comets,RobertB.Sheldon,RichardB.Hoover,NASAMarshallSpaceFlightCtr.(UnitedStates) . [8521-21]
Measurements of charging of individual micron-size dust grains by electron impact,MianM.Abbas,DraganaTankosic,AndreC.LeClair,NASAMarshallSpaceFlightCtr.(UnitedStates). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . [8521-22]
12:00pm:Origins of life and biological evolution: the symbiogenic connection, FranciscoJ.Carrapico,Univ.deLisboa(Portugal);LuisaPereira,EscolaSecundáriaFernandoLopes-Graça(Portugal);TelmaRodrigues,EscolaSecundáriaDr.JoséAfonso(Portugal). . . . . . . . . . . . . . . . . . . . . . . . . [8521-24]
12:20pm:Comets as parent bodies of CI1 carbonaceous meteorites and possible habitats of ice-microbiota,RichardB.Hoover,NASAMarshallSpaceFlightCtr.(UnitedStates);N.ChandraWickramasinghe,CardiffUniv.(UnitedKingdom);AlexeiY.Rozanov,PaleontologicalInstitute(RussianFederation);JamieWallis,CardiffUniv.(UnitedKingdom).................... [8521-25]
spie.org/opadvance · TEL:+13606763290 · help@spie.org 191
Money-back GuaranteeWeareconfidentthatonceyouexperienceanSPIEcourseforyourselfyouwilllooktousforyourfutureeducationneeds.However,ifforanyreasonyouaredissatisfied,wewillgladlyrefundyourmoney.Wejustaskthatyoutelluswhatyoudidnotlike;suggestionsforimprovementarealwayswelcome.
Continuing Education UnitsSPIEhasbeenapprovedasanauthorizedproviderofCEUsbyIACET,TheInternationalAssociationforContinuingEducationandTraining(Provider#1002091).Inobtainingthisapproval,SPIEhasdemonstratedthatitcomplieswiththeANSI/IACETStandardswhicharewidelyrecognizedasstandardsofgoodpractice.
SPIE reserves the right to cancel a course due to insufficient advance registration.
spie.org/education
Theeducationyouneedtostaycompetitiveintoday’sjobmarket
-Takeadvantageofdirectinstructionfromsomeofthebiggestnamesinresearchandindustry—learnfromrecognizedexperts
-Relevantcoursesonessentialopticalengineeringtopicsandcurrentresearch&developmentareas,includingnanotechnology,imageprocessing,illumination,solar,remotesensing,andmore
- 8newcoursesandworkshopsfor2012
-EarnCEUstofulfillongoingprofessionaleducationrequirements
Courses, relevant training, proven instructors.
SPIE Courses__
192 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Course Daily Schedule Sunday monday Tuesday Wednesday Thursday friday
NEWSC468Image Enhancement, Deblurring and Super-Resolution(Rabbani)8:30amto5:30pm,$525/$640,p.199
NEWSC967High Dynamic Range Imaging: Sensors and Architectures(Darmont)1:30to5:30pm,$345/$400,p.200
Atmospheric and Space Optical SystemsNEWSC1071Understanding Diffractive Optics(Soskind)1:30to5:30pm,$335/$390,p.201
SC916Digital Camera and Sensor Evaluation Using Photon Transfer(Janesick)8:30amto5:30pm,$575/$690,p.200
SC1043Shaping Light, with applications in Advanced Microscopy and Optical Trapping(Dholakia, Spalding)1:30to5:30pm,$300/$355,p.202
NEWSC1080Modeling and Simulation with Computational Fourier Optics(Voelz)8:30amto5:30pm,$525/$640,p.201
SC915Radiometry Revealed(Shaw)8:30amto12:30pm,$300/$355,p.199
SC567Introduction to Optical Remote Sensing Systems(Shaw)1:30to5:30pm,$300/$355,p.199
Advanced MetrologySC213Introduction to Interferometric Optical Testing(Wyant)8:30amto12:30pm,$330/$385,p.197
SC017Principles of Fourier Optics and Diffraction(Gaskill)8:30amto5:30pm,$630/$745,p.198
SC492Predicting, Modeling, and Interpreting Light Scattered by Surfaces(Germer)1:30to5:30pm,$300/$355,p.197
NEWSC1080Modeling and Simulation with Computational Fourier Optics(Voelz)8:30amto5:30pm,$525/$640,p.198
SC211Practical Interferometry and Fringe Analysis(Creath)8:30amto5:30pm,$525/$640,p.196
SC1003Optical Scatter Metrology for Industry(Stover)1:30to5:30pm,$360/$415,p.196
Detectors and Imaging DevicesSC504Introduction to CCD and CMOS Imaging Sensors and Applications(Janesick)8:30amto5:30pm,$665/$780,p.203
NEWSC967High Dynamic Range Imaging: Sensors and Architectures(Darmont)1:30to5:30pm,$345/$400,p.202
SC916Digital Camera and Sensor Evaluation Using Photon Transfer(Janesick)8:30amto5:30pm,$575/$690,p.203
SC194Multispectral and Hyperspectral Image Sensors(Lomheim)8:30amto12:30pm,$380/$435,p.204
SC915Radiometry Revealed(Shaw)8:30amto12:30pm,$300/$355,p.205
SC567Introduction to Optical Remote Sensing Systems(Shaw)1:30to5:30pm,$300/$355,p.204
Illumination EngineeringNEWSC1071Understanding Diffractive Optics(Soskind)1:30to5:30pm,$335/$390,p.206
SC388Non-Imaging Optics(Winston)1:30to5:30pm,$300/$355,p.205
SC915Radiometry Revealed(Shaw)8:30amto12:30pm,$300/$355,p.206
SC011Design of Efficient Illumination Systems(Cassarly)8:30amto12:30pm,$300/$355,p.205
Image and Signal ProcessingNEWSC1071Understanding Diffractive Optics(Soskind)1:30to5:30pm,$335/$390,p.208
NEWSC468Image Enhancement, Deblurring and Super-Resolution(Rabbani)8:30amto5:30pm,$525/$640,p.207
NEWSC967High Dynamic Range Imaging: Sensors and Architectures(Darmont)1:30to5:30pm,$345/$400,p.207
SC916Digital Camera and Sensor Evaluation Using Photon Transfer(Janesick)8:30amto5:30pm,$575/$690,p.208
SC017Principles of Fourier Optics and Diffraction(Gaskill)8:30amto5:30pm,$630/$745,p.209
NEWSC1080Modeling and Simulation with Computational Fourier Optics(Voelz)8:30amto5:30pm,$525/$640,p.208
spie.org/opadvance · TEL:+13606763290 · help@spie.org 193
LegendforEducationProducts:
Price=SPIEMember/Non-MemberSC000=CourseNumberWS000=WorkshopNumber
Course Daily Schedule Sunday monday Tuesday Wednesday Thursday friday
NanoEngineeringNEWSC1003Optical Scatter Metrology for Industry(Stover)1:30to5:30pm,$360/$415,p.210
NEWSC1082Nanophotonicsand Metaphotonics (Prasad)2:00to6:00pm,$300/$355,p.209
NanoscienceNEWSC1082Nanophotonicsand Metaphotonics (Prasad)2:00to6:00pm,$300/$355,p.211
SC1043Shaping Light, with applications in Advanced Microscopy and Optical Trapping(Dholakia, Spalding)1:30to5:30pm,$300/$355,p.210
SC727Nanoplasmonics(Stockman)8:30amto5:30pm,$525/$640,p.211
Optical Design and Systems EngineeringSC690Optical System Design: Layout Principles and Practice(Greivenkamp)8:30amto5:30pm,$635/$750,p.212
NEWSC1071Understanding Diffractive Optics(Soskind)1:30to5:30pm,$335/$390,p.215
SC835Infrared Systems - Technology & Design(Daniels)8:30amto5:30pm,$1145/$1400,p.214
SC010Introduction to Optical Alignment Techniques(Ruda)8:30amto5:30pm,$1000/$1255,p.218
SC221Optomechanics and Tolerancing of Instruments(Hatheway)8:30amto5:30pm,$525/$640,p.218
SC321Thin Film Optical Coatings(Macleod)8:30amto5:30pm,$525/$640,p.214
SC388Non-Imaging Optics(Winston)1:30to5:30pm,$300/$355,p.215
SC1003Optical Scatter Metrology for Industry(Stover)1:30to5:30pm,$360/$415,p.217
SC156Basic Optics for Engineers(Boreman)8:30amto5:30pm,$565/$680,p.213
SC947Cost-Conscious Tolerancing of Optical Systems(Youngworth, Contreras)8:30amto5:30pm,$525/$640,p.218
SC017Principles of Fourier Optics and Diffraction(Gaskill)8:30amto5:30pm,$630/$745,p.216
WS609Basic Optics for Non-Optics Personnel(Harding)1:30to4:00pm,$100/$150,p.220
SC492Predicting, Modeling, and Interpreting Light Scattered by Surfaces(Germer)1:30to5:30pm,$300/$355,p.217
SC1043Shaping Light, with applications in Advanced Microscopy and Optical Trapping(Dholakia, Spalding)1:30to5:30pm,$300/$355,p.219
NEWSC912Intermediate Lens Design(Bentley)8:30amto5:30pm,$610/$725,p.213
NEWSC1080Modeling and Simulation with Computational Fourier Optics(Voelz)8:30amto5:30pm,$525/$640,p.216
SC211Practical Interferometry and Fringe Analysis(Creath)8:30amto5:30pm,$525/$640,p.223
SC003Practical Optical System Design(Youngworth)8:30amto5:30pm,$605/$725,p.212
SC915Radiometry Revealed(Shaw)8:30amto12:30pm,$300/$355,p.215
SC567Introduction to Optical Remote Sensing Systems(Shaw)1:30to5:30pm,$300/$355,p.219
194 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Course Daily Schedule
Optomechanics and Optical ManufacturingSC014Introduction to Optomechanical Design(Vukobratovich)8:30amto5:30pm,$1000/$1255,p.220
SC010Introduction to Optical Alignment Techniques(Ruda)8:30amto5:30pm,$1000/$1255,p.220
Sunday monday Tuesday Wednesday Thursday friday
SC221Optomechanics and Tolerancing of Instruments(Hatheway)8:30amto5:30pm,$525/$640,p.222
SC015Structural Adhesives for Optical Bonding(Daly)8:30amto12:30pm,$300/$355,p.221
SC321Thin Film Optical Coatings(Macleod)8:30amto5:30pm,$525/$640,p.222
SC218Advanced Composite Materials for Optomechanical Systems(Zweben)8:30amto5:30pm,$525/$640,p.221
SC947Cost-Conscious Tolerancing of Optical Systems(Youngworth, Contreras)8:30amto5:30pm,$525/$640,p.221
SC213Introduction to Interferometric Optical Testing(Wyant)8:30amto12:30pm,$330/$385,p.223
SC211Practical Interferometry and Fringe Analysis(Creath)8:30amto5:30pm,$525/$640,p.223
Remote SensingSC835Infrared Systems - Technology & Design(Daniels)8:30amto5:30pm,$1145/$1400,p.226
SC156Basic Optics for Engineers(Boreman)8:30amto5:30pm,$565/$680,p.227
SC916Digital Camera and Sensor Evaluation Using Photon Transfer(Janesick)8:30amto5:30pm,$575/$690,p.226
SC194Multispectral and Hyperspectral Image Sensors(Lomheim)8:30amto12:30pm,$380/$435,p.225
SC915Radiometry Revealed(Shaw)8:30amto12:30pm,$300/$355,p.227
SC567Introduction to Optical Remote Sensing Systems(Shaw)1:30to5:30pm,$300/$355,p.223
Solar Energy + TechnologySC321Thin Film Optical Coatings(Macleod)8:30amto5:30pm,$525/$640,p.229
SC388Non-Imaging Optics(Winston)1:30to5:30pm,$300/$355,p.228
SC1003Optical Scatter Metrology for Industry(Stover)1:30to5:30pm,$360/$415,p.228
SC910Design and Reliability of Photovoltaic Modules(Dhere, Kempe)8:30amto12:30pm,$300/$355,p.228
SC492Predicting, Modeling, and Interpreting Light Scattered by Surfaces(Germer)1:30to5:30pm,$300/$355,p.229
SC915Radiometry Revealed(Shaw)8:30amto12:30pm,$300/$355,p.230
NEWSC468Image Enhancement, Deblurring and Super-Resolution(Rabbani)8:30amto5:30pm,$525/$640,p.224
SC504Introduction to CCD and CMOS Imaging Sensors and Applications(Janesick)8:30amto5:30pm,$665/$780,p.225
NEWSC967High Dynamic Range Imaging: Sensors and Architectures(Darmont)1:30to5:30pm,$345/$400,p.224
spie.org/opadvance · TEL:+13606763290 · help@spie.org 195
LegendforEducationProducts:
Price=SPIEMember/Non-MemberSC000=CourseNumberWS000=WorkshopNumber
Business and Professional DevelopmentNEWWS1058Critical Skills for Compelling Research Proposals(Diehl)1:30to5:30pm,$75/$125,p.232
WS897Effective Technical Presentations(Doumont)8:30amto12:30pm,$75/$125,p.233
WS908Effective Scientific Papers(Doumont)1:30to5:30pm,$75/$125,p.233
NEWWS1059Resumes to Interviews: Strategies for a Successful Job Search(Lawson, Krinsky)8:30amto12:30pm,$75/$125,p.233
WS609Basic Optics for Non-Optics Personnel(Harding)1:30to4:00pm,$100/$150,p.232
Course Daily Schedule Sunday monday Tuesday Wednesday Thursday friday
Workshops for Optics EducatorsNEWWS1081KHET in the Classroom - Teaching Optics Principles using The Laser Game: KHET 2.0(Larson)8:30amto12:30pm,$50/$75,p.234
WS961Optics Magic - Easy Demonstrations from the PHOTON Projects(Donnelly, Magnani)1:30to4:30pm,$10/$20,p.234
X-Ray, Gamma-Ray, and Particle TechnologiesSC1003Optical Scatter Metrology for Industry(Stover)1:30to5:30pm,$360/$415,p.230
SC213Introduction to Interferometric Optical Testing(Wyant)8:30amto12:30pm,$330/$385,p.232
SC492Predicting, Modeling, and Interpreting Light Scattered by Surfaces(Germer)1:30to5:30pm,$300/$355,p.231
SC211Practical Interferometry and Fringe Analysis(Creath)8:30amto5:30pm,$525/$640,p.231
196 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Courses
advanced metrology
Optical Scatter Metrology for IndustrySC1003Course level: IntermediateCEU .35 $360 / $415 USD Monday 1:30 to 5:30 pm
Optical scatter, originally usedalmost exclusively tocharacterize thestraylightgeneratedbyopticallysmoothsurfaces,isnowbeingusedasasensitive,economicalwaytomonitorthesurfacetexturerequirementsinavarietyofindustries.Forexample,thephoto-voltaicindustryusesspecifictypesoftextureonsurfacestoincreaseabsorptionandsystemefficiency. Texture is often an important requirement for the metalproducing industryand itchangeswith rollwear.Theappearanceofevery day appliances (from door hinges to computer cases) variesdramaticallywith texture. Thequalityofflatpaneldisplaysdependsonthescattercharacteristicsofthescreenandcomponentsbehindit.SEMIandASTMarerespondingtothenewapplicationswith“scatterstandards” to help communication between manufacturers, vendorsandcustomers.Thelowsignal(hardtomeasure)opticalapplicationsweresolvedfirstbecause the math was easy. Rougher surface scatter relationshipsare more complicated, but the signals are much larger - makinginstrumentationeasier.Thecoursestartswiththeopticalapplicationsandthenexploresthetransitiontorougherindustrysurfaces.Betweenagoodopticalmirrorandaconcretesidewalktherearethousandsofindustrysurfacesthatcanbemonitoredwithscattermetrology.Thereare twokeypoints for these “in-between”surfaces: (1) If the texturechanges - the scatter changes and (2) these changes (and productfunction)cannotbeadequatelymonitoredbyasinglevariable-suchasRMSRoughness,HazeorGloss.Thecourseemphasizesquantifying,measuring and understanding scatter. The modeling of scatter ismentioned,butisnotemphasizedhere.
LEARNING OUTCOMESThiscoursewillenableyouto:• quantifyandanalyzescatterintermsofBRDF,TIS,HazeandDSC
units• explaintheinstrumentationforobtainingscatterdataandevaluate
systemcalibration• describeandovercomethevariousdifficultiesincomparing
roughnessstatisticsfoundfromprofilometersandscatterometersforbothone-andtwo-dimensionalsamples
• convertscattertoroughnessstatisticswhenpossibleandunderstandwhenitisnotpossible
• evaluatetheuseofscattermeasurementforspecificapplicationssuchas:straysystemradiation,surfacemicro-roughness,particulatesizing,backgroundsensornoise
• explaintheuseofpolystyrenelatexspheredepositionsasanopticalscatteringstandard
• reviewscatteringstandardsforthesemiconductorandphoto-voltaicindustries
INTENDED AUDIENCEEngineers, scientists, and managers who need to understand andapply thebasicconceptsofscattermetrology to laboratory researchandindustrialprocesscontrol.Someknowledgeofcalculusishelpful,butthecoursedoesnotrequirethatthestudentfollowmathematicalderivations. The instructor has worked with Thomas Germer (SC492instructor)toavoidoverlapbetweenthetwocourses.
INSTRUCTORJohn Stover is President of The Scatter Works, Inc., a Tucson firmconcentratingonscatterbasedmetrologystandards,consulting,andmeasurementas theyapply todiverse industries.Hehasresearchedlight scatter related problems for over 30 years and led teams ofengineers who developed state-of-the-art scatterometers, verifiedtheoretical relationship between surface roughness and scatter andcharacterizedsurfacedefectstoimprovewafermetrology.Hehasbeeninvolvedwithinternationalstandardsorganizationsforover20years,isanSPIEFellow,andhasbeenactiveasanauthor,conferencechairman,andeditor,andhasoveronehundredpublications.COURSEPRICEINCLUDESthetext Optical Scattering: Measurement and Analysis, 2nd Edition(SPIEPress,1995)byJohnStover.
Practical Interferometry and Fringe AnalysisSC211Course level: IntermediateCEU .65 $525 / $640 USD Wednesday 8:30 am to 5:30 pm
You’venodoubtheardofinterferometrictestingandallthewonderfulthingsitcandotosolveyourmeasurementproblems.Youmayhaveattended an introduction to interferometry or been shopping for aninstrument.Buthowdoyougetstarted?Howdoyoudeterminewhichtypeofinterferometerwillsolveyourproblem?Doyoumakeyourownorbuyacommercialinstrument?Onceyou’vegotaninstrumenthowcanyoubesureyoualigneditcorrectlyandaregettingthebestdatayoucanforyourmeasurementproblem?Thisintermediate-levelcourseoffersanoverviewofthefundamentalsof interferometric testing and the analysis of interferometric fringepatterns applicable to many different areas of interferometry, opticaltesting, nondestructive testing, and metrology. It is geared towardstechnicallymindedtypeswhohavehadsomeexposuretothebasicsofinterferometryandwanttofindoutmoreaboutthepracticalnutsandboltsofusinginterferometryasatool.Wewillbeginwithanoverviewof the basic fundamentals of interferometry including formation ofinterference fringes fordifferent typesofsources, fringevisibilityandhowfringesrelatetobasicpropertiesoftheobjectbeingtested.Wethen will cover common interferometer types and phase modulationtechniques, essentials for creating, detecting and digitizing fringes,alignmentandenvironmentalconsiderationsandcalibration.Throughoutthiscoursereal-worldproblemswillbeusedasexamples.Thesecondhalfoftheclasswillfocusonthesesamequestionsfromthe aspect of fringe analysis techniques. We will outline the basictechniquesandthenbrainstormhowyoudeterminewhetheryougotgooddataandhowyouwouldbegin ifyouwereanalyzingyourownraw fringedata.During thisdiscussioncommonpitfalls and sourcesoferrorswillbepointedouttohelpstreamlineyourprocessofgettingup and running to take your own measurements. Attendees areencouragedtobringalongtheirreal-worldproblemsandofferthemasstartingpointsforourdiscussion.
LEARNING OUTCOMESThiscoursewillenableyouto:• understandthebasiccomponentsofmonochromatic,narrowband
andwhitelightinterferometers• ensurethatyouarechoosingtherighttypeofinterferometerfor
yourapplication• listthenecessarystepstosetupaninterferometerandtakea
measurement• differentiatetheprosandconsofvariousmeasurementandanalysis
techniques• evaluatethetradeoffsbetweentechniques• outlinesimpleteststodetermineifyouaregettinggood
measurements• helpyoudecidewhichtechniqueisbestforaparticularapplication
spie.org/opadvance · TEL:+13606763290 · help@spie.org 197
Courses
INTENDED AUDIENCEThiscourseisforengineersworkingwithopticalinterferometry,opticaltesting, surface metrology, experimental mechanics, nondestructivetesting,andMoiregratingtechniques.Itwillbeassumedthatattendeeshaveabasicknowledgeofgeometricalopticsandinterferometry.
INSTRUCTORKatherine Creath is an internationally recognized expert in opticaltesting, metrology and system design working as a Consultant, aSeniorResearchScientistfor4DTechnologyCorp,andasaResearchProfessorofOpticalSciencesandMedicineattheUniversityofArizona.Shehasmorethan25yearsofexperienceininterferometryandopticaltestingandisaFellowofSPIEandOSA.
Introduction to Interferometric Optical TestingSC213Course level: IntroductoryCEU .35 $330 / $385 USD Tuesday 8:30 am to 12:30 pm
Thisshortcourseintroducesthefieldofinterferometricopticaltesting.Topics covered include basic interferometers for optical testing, andconceptsofphase-shiftinginterferometryincludingerroranalysis.Longwavelength interferometry,testingofasphericsurfaces,measurementof surface microstructure, and the state-of-the-art of direct phasemeasurementinterferometersarealsodiscussed.
LEARNING OUTCOMESThiscoursewillenableyouto:• explainthebasicconceptsofinterferometricopticaltesting• describethepower,capabilities,andlimitationsofphase-shifting
interferometry• describetechniques,advantages,anddisadvantagesoflong-
wavelengthinterferometry• comparedifferentaspherictestingtechniques• listcapabilitiesandtechniquesformeasuringsurfacemicrostructure• describethecurrentstate-of-the-artofdirectphasemeasurement
interferometers
INTENDED AUDIENCEEngineers,scientists,andmanagerswhoneedtounderstandthebasicconceptsofinterferometricopticaltesting.
INSTRUCTORJames WyantisDeanoftheCollegeofOpticalSciencesandProfessorofOpticalSciencesattheUniversityofArizona.HewasafounderoftheWYKOCorporationandservedasitspresidentfrom1984to1997.Dr.Wyantwasthe1986PresidentofSPIE.
Predicting, Modeling, and Interpreting Light Scattered by SurfacesSC492Course level: IntermediateCEU .35 $300 / $355 USD Tuesday 1:30 to 5:30 pm
Themeasurementoflightscatteredbysurfacescanbeusedtolocateand identify roughness, particulates, and defects on a wide varietyof materials. Applications include the inspection of silicon wafers,optics, and storage media, characterization of thin film roughness,identification of objects in remote sensing, and prediction of opticalsystem performance. The aim of this course is to provide tools toengineers and scientists to enable them to predict scattering fordifferentsources,differentiateamongstdifferentscatteringsources,andto design instrumentation that maximizes sensitivity or differentiationamongstscatteringsourcesfortheirspecificapplication.EmphasiswillbeplacedontheuseoftheSCATMECHlibraryofscatteringcodesandthe Modeled Integrated Scatter Tool (MIST) in order to minimize themathematicsthatcanoftenbeabarriertothosewhowouldotherwisebe interested inusingopticalscatter. Themeasurementofscatter isemphasizedinSC020taughtbyJohnStover.
LEARNING OUTCOMESThiscoursewillenableyouto:• quantifyscatterintermsofintensityandpolarizationproperties• identifylikelysourcesofscatterfromamaterialorthinfilm• predictscatterfromspecificscattersources:roughness,particles,
andsubsurfacedefects• designexperimentsthatdifferentiateamongscatteringsources• useMISTtoevaluateorvisualizeopticalscatterinavarietyof
applications.• definethelimitationsoflightscattering
INTENDED AUDIENCEThiscourseisintendedforscientistsandengineerswhoareinterestedinmodeling,predicting,andinterpretinglightscatterfromsurfacesformaterialinspection,opticaldesign,orremotesensingapplications.TheinstructorhasdesignedthecoursetocomplementSC1003,workinginconjunctionwithSC1003’sinstructorJohnStovertocoordinatethematerial.
INSTRUCTORThomas Germer is a physicist specializing in measurements andmodelingoftheopticalpropertiesofmaterialsattheNationalInstituteofStandardsandTechnologyinGaithersburg,Maryland.Hehaspublishedover one hundred technical papers, covering topics of electron andultrafasttime-resolvedsurfacespectroscopy,diffuseopticalscatteringfrom particles, roughness, and defects near surfaces and thin films,polarimetry,criticaldimensionmetrologybygratingscatterometry,andbiomedical optics. He is thedeveloperof theSCATMECH libraryoflightscatteringcodesandtheassociatedMISTprogram.Dr.GermerreceivedaB.A.fromtheUniversityofCalifornia,Berkeley,andaM.S.andPh.D.fromCornellUniversity,andisaFellowofSPIE.Following the course, attendees will be provided with an electroniccopyofthepublicdomainSCATMECHlibrary,theMISTprogram,andalloftheexampleprogramsdiscussedintheclass.
198 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Courses
Modeling and Simulation with Computational Fourier OpticsSC1080 NEWCourse level: IntermediateCEU .65 $525 / $640 USD Wednesday 8:30 am to 5:30 pm
Thiscourseexplains the implementationofFourieroptics theoryandconceptsonthecomputer.Aprimaryobjectiveistoprovideattendeeswith the capability of programming their own basic wave (physical)optics simulations to model diffraction, beam propagation, lenses,gratings, and imaging.Thecourse includesa short reviewofFourieropticstheory,detailsofapplyingthefastFouriertransform(FFT),andapproachesforimplementingavarietyofwaveopticssimulations.Themethodsdiscussedcanbeappliedintechnicalsoftwareenvironmentssuch as MATLAB, Mathcad, IDL and C. Examples are presentedprimarilyinMATLABbutimplementationinotherenvironmentsisalsodiscussed.
LEARNING OUTCOMESThiscoursewillenableyouto:• modelsimplephysicalstructureswithalimitedsetofbasicanalytic
functions• choosetheparametersformodeling2-Dspatialandspectral
functionsonthecomputeranddeterminethescalingconstantsinvolvedwiththeuseoftheFFT
• modelopticalwaveswithcomplexexponentialnotation• createanopticalpropagation/diffractioncomputersimulation• buildwaveopticscomputermodelsoflensesandgratings• createimagesimulationsthatincludediffractionandaberrations
INTENDED AUDIENCEEngineersandscientistswhowishtolearnthedetailsofimplementingFourieropticstheoryonthecomputerandhowtocreatetheirownwaveopticssimulations.Also,anyonewhoislookingforaconcisereviewofFourier optical theory fromadifferent andpractical perspective. It issuggestedthatattendeeshaveabasicfamiliaritywithFourieroptics.
INSTRUCTORDavid Voelz is a professor of electrical engineering at New MexicoStateUniversityandholdsaPaulW.andValerieKlipschProfessorship.He received his Ph.D. degree in EE from the University of Illinoisin 1987. From 1986 to 2001 he worked as a research engineer andprojectmanagerattheAirForceResearchLaboratoryinAlbuquerque,NM. He was named a Fellow of SPIE in 1999 and has received anOSA Engineering Excellence Award, the Bromilow Award at NMSUfor research excellence, and the Giller Award at AFRL for technicalachievement. His research interests always seem to involve someaspectofFourieropticsandincludespectralandpolarimetricimaging,laser imaging and beam projection, laser communication, adaptiveoptics,andastronomicalinstrumentationdevelopment.COURSEPRICEINCLUDESthetext Computational Fourier Optics, A MATLAB Tutorial (SPIEPress,2011)byDavidVoelz.Attendeesarewelcometobringalaptopwithcomputationalsoftwaretothecoursetoexploresomeoftheconcepts.However,acomputerisnotrequiredforthelearningexperience.
Principles of Fourier Optics and DiffractionSC017Course level: IntermediateCEU .65 $630 / $745 USD Tuesday 8:30 am to 5:30 pm
Thiscourse introduces theapplicationofFourier theory indiffractionandimageformation.Thefirstpartofthecourseprovidesareviewofanumberofmathematicaltopics,includingconvolutionandtheFouriertransform.Next,thephenomenonofdiffractionisintroduced,theeffectsoflensesondiffractionarediscussed,andthepropagationofGaussianbeamsistreated.Finally,theeffectsofdiffractionontheperformanceofimage-formingsystemsandotheropticaldevicesarediscussed.
LEARNING OUTCOMESThiscoursewillenableyouto:• understandconvolutionandFouriertransformoperations• describethegeneraleffectsofdiffractionintheFresneland
Fraunhoferregions• understandtheeffectsoflensesondiffraction• predicttheFraunhoferdiffractionpatternsassociatedwithspecific
apertures• describethepropagationofGaussianbeams• understandtheeffectsofdiffractiononimageformationandimage
resolution• calculatethePoint-SpreadFunctions(PSF)andOpticalTransfer
Functions(OTF)forvariousimagingsystems
INTENDED AUDIENCEThis course is intended for scientists and engineers who need tounderstand the diffraction of optical wavefields and the effects ofdiffraction on the performance of image-forming systems and otheropticaldevices.
INSTRUCTORJack GaskillisProfessorEmeritusofOpticalSciencesattheUniversityofArizonawhere,formorethan30years,histeachingactivitiesweredevotedprimarilytotheapplicationsofFouriertheoryinoptics.Hehastaughtmore than40off-campusshort courses inFourier opticsandrelated subjects. Gaskill is author of the textbook, Linear Systems, Fourier Transforms, and Optics (Wiley,1978),and isaPastPresidentofSPIE.COURSE PRICE INCLUDES the text Linear Systems, Fourier Transforms, and Optics(Wiley,1978)byJackD.Gaskill.
spie.org/opadvance · TEL:+13606763290 · help@spie.org 199
Courses
atmospheric and Space Optical Systems
Introduction to Optical Remote Sensing SystemsSC567Course level: IntroductoryCEU .35 $300 / $355 USD Wednesday 1:30 to 5:30 pm
This course provides a broad introduction to optical remote sensingsystems,includingbothpassivesensors(e.g.,radiometersandspectralimagers) and active sensors (e.g., laser radars or LIDARs). A briefreviewofbasicprinciplesofradiometryandatmosphericpropagation(absorption, emission, and scattering) is followed by a system-leveldiscussion of a variety of ground-, air-, and space-based remotesensingsystems.Keyequationsarepresentedforpredictingtheopticalresolution and signal-to-noise performance of passive and activesensing systems. Sensor system examples discussed in the classinclude solar radiometers, passive spectrometers and hyperspectralimagers, airborne imaging spectrometers, thermal infrared imagers,polarizationimagers,andactivelaserradars(LIDARsandLADARs).Thecoursematerialisdirectlyrelevanttosensinginenvironmental,civilian,military,astronomical,andsolarenergyapplications.
LEARNING OUTCOMESThiscoursewillenableyouto:• reviewtheprinciplesofopticalradiometryusedtodescribeand
calculatetheflowofopticalenergyinanopticalsensorsystemorsolarenergysystem
• describehowtheatmosphereaffectsthepropagationofopticalradiation
• explainhowopticalatmosphericeffectsinfluenceremotesensingmeasurementsorsolarenergy
• usesystemparametersinbasicradiometriccalculationstopredictthesignalreceivedbypassiveandactivesensors
• comparesystemsattheblock-diagramlevelremotesensingmeasurements
• explainthedifferencebetweenpassiveimagingbasedonreflectionandemission
• acquiretheoperatingprinciplesoflaserradar(lidar/ladar)systemsfordistributedandsolidtargetsensing
INTENDED AUDIENCEScientists, engineers, technicians, or technical managers who findthemselves working on (or curious about) optical remote sensingsystemsordata.Undergraduate training inengineeringor science isassumed.
INSTRUCTORJoseph Shaw isaprofessorofelectricalengineeringandphysicsatMontanaStateUniversityandpreviouslyworkedattheNOAAresearchlabs.Heisarecognizedexpertindevelopment,calibration,andanalysisofopticaloptical remotesensingsystemsused inenvironmentalandmilitarysensing.Recognition forhiswork in thisfield includesNOAAresearchawards,aPresidentialEarlyCareerAwardforScientistsandEngineers,andtheWorldMeteorologicalOrganization’sVaisalaPrize.HeearnedaPh.D.inOpticalSciencesattheUniversityofArizona.Dr.ShawisaFellowofboththeOSAandSPIE.
Image Enhancement, Deblurring and Super-ResolutionSC468 NEWCourse level: AdvancedCEU .65 $525 / $640 USD Monday 8:30 am to 5:30 pm
This course discusses some of the advanced algorithms in the fieldof digital image processing. In particular, it familiarizes the audiencewith the understanding, design, and implementation of advancedalgorithms used in deblurring, contrast enhancement, sharpening,noisereduction,andsuper-resolution instill imagesandvideo.Someof the applications include medical imaging, entertainment imaging,consumer and professional digital still cameras/camcorders, forensicimaging, and surveillance. Many image examples complement thetechnicaldescriptions.
LEARNING OUTCOMESThiscoursewillenableyouto:• explainthevariousnonadaptiveandadaptivetechniquesused
inimagecontrastenhancement.ExamplesincludePhotoShopcommandssuchasBrightness/Contrast,AutoLevels,EqualizeandShadow/Highlights,orPizer’stechniqueandMoroney’sapproach
• explainthefundamentaltechniquesusedinimageDynamicRangeCompression(DRC).IllustrateusingthefastbilateralfilteringbyDorseyandDurandasanexample.
• explainthevarioustechniquesusedinimagenoiseremoval,suchasbilateralfiltering,sigmafilteringandK-NearestNeighbor
• explainthevarioustechniquesusedinimagesharpeningsuchasnonlinearunsharpmasking,etc.
• explainthebasictechniquesusedinimagedeblurring(restoration)suchasinversefilteringandWienerfiltering
• explainthefundamentalideasbehindachievingimagesuper-resolutionfrommultiplelowerresolutionimagesofthesamescene
• explainhowmotioninformationcanbeutilizedinimagesequencestoimprovetheperformanceofvariousenhancementtechniquessuchasnoiseremoval,sharpening,andsuper-resolution
INTENDED AUDIENCEScientists, engineers, and managers who need to understand and/or apply the techniques employed in digital image processing invarious products in a diverse set of applications such as medicalimaging, professional and consumer imaging, forensic imaging,etc. Prior knowledge of digital filtering (convolution) is necessary forunderstandingthe(Wienerfilteringandinversefiltering)conceptsusedindeblurring(about20%ofthecoursecontent).
INSTRUCTORMajid Rabbanihas30yearsofexperienceindigital imaging.HeisaKodak Fellow and Department Head and also an adjunct AssociateProfessor at Rochester Institute of Technology (RIT). He is the co-recipientofthe2005and1988KodakC.E.K.MeesAwardsandtheco-recipientof twoEmmyEngineeringAwards in1990and1996.Heistheco-authorofthebook“DigitalImageCompressionTechniques”publishedin1991andthecreatorofsixvideo/CDROMcoursesintheareaofdigitalimaging.Dr.RabbaniisaFellowofSPIE,aFellowofIEEE,andaKodakDistinguishedInventor.
200 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Courses
High Dynamic Range Imaging: Sensors and ArchitecturesSC967 NEWCourse level: IntermediateCEU .35 $345 / $400 USD Monday 1:30 to 5:30 pm
This course provides attendees with an intermediate knowledge ofhighdynamic range imagesensorsand techniques for industrialandnon-industrial applications.Thecoursedescribesvarioussensorandpixelarchitectures toachievehighdynamicrange imagingaswellassoftwareapproachestomakehighdynamicrangeimagesoutoflowerdynamicrangesensorsorimagesets.Thecoursefollowsamathematicapproach to define the amount of information that can be extractedfromtheimageforeachofthemethodsdescribed.Somemethodsforautomaticcontrolofexposureanddynamicrangeofimagesensorsandotherissueslikecolorandglarewillbeintroduced.
LEARNING OUTCOMESThiscoursewillenableyouto:• describevariousapproachestoachievehighdynamicrange
imaging• predictthebehaviorofagivensensororarchitectureonascene• specifythesensororsystemrequirementsforahighdynamicrange
application• classifyahighdynamicrangeapplicationintooneofseveral
standardtypes
INTENDED AUDIENCEThismaterial is intended for anyonewhoneeds to learnmoreaboutquantitative side of high dynamic range imaging. Optical engineers,electronicengineersandscientistswillfindusefulinformationfortheirnexthighdynamicrangeapplication.
INSTRUCTORArnaud Darmont isownerandCEOofAphesa,acompanyfoundedin 2008 and specialized in image sensor consulting, the EMVA1288standardandcamerabenchmarking.HeholdsadegreeinElectronicEngineering from the University of Liège (Belgium). Prior to foundingAphesa,heworkedforover7yearsinthefieldofCMOSimagesensorsandhighdynamicrangeimaging.COURSE PRICE INCLUDES the text High Dynamic Range Imaging: Sensors and Architectures(SPIEPress,2012)byArnaudDarmont.
Digital Camera and Sensor Evaluation Using Photon TransferSC916Course level: IntroductoryCEU .65 $575 / $690 USD Tuesday 8:30 am to 5:30 pm
Photon transfer (PT) is a popular and essential characterizationstandard employed in the design, operation, characterization,calibration, optimization, specification and application of digitalscientific and commercial camera systems. The PT user friendlytechniqueisbasedononlytwomeasurements-averagesignalandrmsnoisewhichtogetherproduceamultitudeof importantdataproductsinevaluatingdigitalcamerasystems(mostnotablyCCDandCMOS).PT is applicable to all imaging disciplines. Design and fabricationprocessengineersdevelopingimagersrelyheavilyonPTdataproductsin determining discrete performance parameters such as quantumefficiency (QE), quantum yield, read noise, full well, dynamic range,nonlinearity, fixed pattern noise, V/e- conversion gain, dark current ,image,etc..CamerausersroutinelyusethePTtechniquetodetermine
systemlevelperformanceparameterstoconvertrelativemeasurementsinto absolute electron and photon units, offset correction, flat fieldand image S/N, ADC quantizing noise, optimum encoding, minimumdetectable luminance, operating temperature to remove dark current, reliability,stability,etc. PT isalso thefirstgo/no-gotestperformedtodeterminethehealthofnewcamerasystemand/ordetectoraswellasprovideapowertoolintroubleshootingproblems.ThiscoursewillreviewtheseaspectsandmanyothersofferedbyPT.
LEARNING OUTCOMESThiscoursewillenableyouto:• describePTtheory• takePTdataanddetermineimportantCCDandCMOSperformance
parameters• showexamplePTdataproductsgeneratedbyCCDandCMOS
imagers• calibrateacamerasysteminabsolutephysicalunits• usePTtodeterminethebestcameraorCCD/CMOSimagerforthe
application• usePTtodemonstrateandverifythecamerasystemisreliableand
ingoodoperatingorder• discussguidelinesforthenoviceandadvanceduseringenerating
PT,ModulationandLuxTransfercurves• usePTtooptimallyremovefixedpatternnoisesourcesinimagesfor
thehighestS/Npossiblethroughflatfielding• comprehendsignal-to-noiseimagetheorythroughPT
INTENDED AUDIENCEEngineers,scientists,andtechnicalmanagersworkingwithcommercialandscientificdigitalcamerasystems.SomefamiliaritywithCCDandCMOSimagersisrecommended.
INSTRUCTORJames Janesick is currently the director of the CMOS advanceddevelopment group for Sarnoff Corporation. Previously he waswith Conexant Systems Inc. developing CMOS imaging arrays forcommercial applications. He was technology director of Pixel Vision,Inc.forfiveyearsdevelopinghighspeedbacksideilluminatedCCDsforscientificandcinemacameras.PriortothisJanesickwaswiththeJetPropulsionLaboratoryfor22yearswhereasgroupleaderhedesignedscientificgroundandflightbased imagingsystems.Hehasauthored75 publications and has contributed to many NASA Tech Briefs andpatents for various CCD and CMOS innovations. Janesick receivedNASA medals for Exceptional Engineering Achievement (1982 and1992)andwastherecipientoftheSPIEEducatorAward(2004)andwasSPIE/IS&TImagingScientistoftheYear(2007).COURSE PRICE INCLUDES the text Photon Transfer (SPIE Press,2007)byJamesR.Janesick.
Watch for this icon next to conferences and courses discussing innovative ways to help our planet.
GREEN PHOTONICS
SPIE Optics + Photonics is a leading conference on green photonics technologies such as energy, sustainability, conservation, and environmental monitoring.
spie.org/opadvance · TEL:+13606763290 · help@spie.org 201
Courses
Radiometry RevealedSC915Course level: IntroductoryCEU .35 $300 / $355 USD Wednesday 8:30 am to 12:30 pm
This course explains basic principles and applications of radiometryand photometry. A primary goal of the course is to reveal the logic,systematicorder,andmethodologybehindwhatsometimesappearstobeaconfusingbranchofopticalscienceandengineering.Examplesaretakenfromtheultravioletthroughthelong-waveinfraredportionsoftheelectromagneticspectrum.Anyonewhowantstoanswerquestionssuchas,“howmanywattsorphotonsdoIhave?”or“howmuchopticalenergyorradiationdoIneed?”willbenefitfromtakingthiscourse.
LEARNING OUTCOMESThiscoursewillenableyouto:• describethefundamentalunitsandquantitiesusedtoquantify
electromagneticradiationatwavelengthsfromtheultravioletthroughthevisibleandinfrared
• use,understand,andconvertbetweenradiometricandphotometricquantities
• applyradiometrytotypicalapplications,suchascalibratinganimagingsystem,determininghuman-perceivedbrightnessofadisplay,orcalculatingelectricityproducedbyasolarcell
• calculateareasandsolidanglestodeterminetheenergy,energydensity,orbrightnessinanopticalsystem
• explaintheroleofrays,stops,andpupilsindefiningthefieldofviewandlight-gatheringcapabilityofanopticalsystem
• determinethethroughputofanopticalsystemanduseitinradiometriccalculations
• quantifytheradiantenergyinopticalimagesfrompointandextendedsources
• transferradiantenergyintoandthroughoutopticalsystems• identifyradiometricstandardsandcalibrationmethods• befamiliarwithradiometersandphotometers
INTENDED AUDIENCEScientists, engineers, technicians, or technical managers who wishto learnmoreabouthow toquantify radiantenergy inopticalsystemsandmeasurements.Undergraduatetraininginengineeringorscienceisassumed.
INSTRUCTORJoseph ShawisDirectoroftheOpticalTechnologyCenterandProfessorof Electrical Engineering and Physics at Montana State University inBozeman,Montana.HepreviouslyworkedattheNOAAresearchlabsinBoulder,Colorado.Heisawidelyrecognizedexpertinthedevelopment,calibration,andanalysisofopticalsystemsused inenvironmentalandmilitary sensing. Recognition for his work in this field includes NOAAresearch awards, a Presidential Early Career Award for Scientists andEngineers,andtheWorldMeteorologicalOrganization’sVaisalaPrize.HeearnedaPh.D.inOpticalSciencesattheUniversityofArizonaandisaFellowofboththeOSAandSPIE.
Understanding Diffractive OpticsSC1071 NEWCourse level: IntroductoryCEU .35 $335 / $390 USD Sunday 1:30 to 5:30 pm
Thefirstportionofthecoursewillcoverthefundamentalprinciplesofdiffractionphenomena.Qualitativeexplanationofdiffractionbytheuseoffielddistributionsandgraphswillprovidethebasisforunderstandingthe fundamental relations and the important trends. Attendees willalsolearntheimportantterminologyemployedinthefieldofdiffractiveoptics.Next, the instructor will provide a comprehensive overview of themain typesofdiffractiveopticalcomponents, includingphaseplates,diffraction gratings, binary optics, diffractive kinoforms, holographicoptical elements, and photonic crystals. Finally, based on practicalexamplesprovidedbytheinstructor,attendeeswilllearnhowmodernoptical andphotonics instrumentationcanbenefit from incorporatingdiffractiveopticalcomponents.
LEARNING OUTCOMESThiscoursewillenableyouto:• acquirethefundamentalsofdiffraction,FresnelandFraunhofer
diffraction,theTalboteffect,apodization,diffractionbymultipleapertures,andsuperresolutionphenomena
• becomefamiliarwithterminologyinthefieldofdiffractiveoptics,• gainanoverviewofthemainfabricationtechniques• describetheoperationalprinciplesofthemajortypesofdiffractive
opticalcomponentsinthescalarandtheresonantdomains,diffractionefficiency,andtheblazingcondition
• getanoverviewofthevariousfunctionsperformedbydiffractiveopticscomponentsinopticalsystems
• comparethebenefitsandlimitationsofdiffractivecomponents
INTENDED AUDIENCEThismaterialisintendedforengineers,scientists,collegestudents,andphotonicsenthusiastswhowouldliketobroadentheirknowledgeandunderstandingofdiffractive optics, aswell as to learn thenumerouspractical applications of diffractive optical components in modernopticalinstruments.
INSTRUCTORYakov Soskind is the Principal Systems Engineer with DHPCTechnologies in Woodbridge, NJ. He has been involved in opticalsystems’designanddevelopmentforover30years.Dr.Soskindhasbeenawardedmore than20domesticand internationalpatents,andhasauthoredandco-authoredseveralpublications.HisFieldGuidetoDiffractiveOpticswasrecentlypublishedbySPIEPress(2011).COURSEPRICEINCLUDESthe Field Guide to Diffractive Optics,FG21(SPIEPress,2011)byYakovSoskind.
Modeling and Simulation with Computational Fourier OpticsSC1080 NEWCourse level: IntermediateCEU .65 $525 / $640 USD Wednesday 8:30 am to 5:30 pm
Thiscourseexplains the implementationofFourieroptics theoryandconceptsonthecomputer.Aprimaryobjectiveistoprovideattendeeswith the capability of programming their own basic wave (physical)optics simulations to model diffraction, beam propagation, lenses,gratings, and imaging.Thecourse includesa short reviewofFourieropticstheory,detailsofapplyingthefastFouriertransform(FFT),andapproachesforimplementingavarietyofwaveopticssimulations.Themethodsdiscussedcanbeappliedintechnicalsoftwareenvironmentssuch as MATLAB, Mathcad, IDL and C. Examples are presentedprimarilyinMATLABbutimplementationinotherenvironmentsisalsodiscussed.
202 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Courses
LEARNING OUTCOMESThiscoursewillenableyouto:• modelsimplephysicalstructureswithalimitedsetofbasicanalytic
functions• choosetheparametersformodeling2-Dspatialandspectral
functionsonthecomputeranddeterminethescalingconstantsinvolvedwiththeuseoftheFFT
• modelopticalwaveswithcomplexexponentialnotation• createanopticalpropagation/diffractioncomputersimulation• buildwaveopticscomputermodelsoflensesandgratings• createimagesimulationsthatincludediffractionandaberrations
INTENDED AUDIENCEEngineersandscientistswhowishtolearnthedetailsofimplementingFourieropticstheoryonthecomputerandhowtocreatetheirownwaveopticssimulations.Also,anyonewhoislookingforaconcisereviewofFourier optical theory fromadifferent andpractical perspective. It issuggestedthatattendeeshaveabasicfamiliaritywithFourieroptics.
INSTRUCTORDavid Voelz is a professor of electrical engineering at New MexicoStateUniversityandholdsaPaulW.andValerieKlipschProfessorship.He received his Ph.D. degree in EE from the University of Illinoisin 1987. From 1986 to 2001 he worked as a research engineer andprojectmanagerattheAirForceResearchLaboratoryinAlbuquerque,NM. He was named a Fellow of SPIE in 1999 and has received anOSA Engineering Excellence Award, the Bromilow Award at NMSUfor research excellence, and the Giller Award at AFRL for technicalachievement. His research interests always seem to involve someaspectofFourieropticsandincludespectralandpolarimetricimaging,laser imaging and beam projection, laser communication, adaptiveoptics,andastronomicalinstrumentationdevelopment.COURSEPRICEINCLUDESthetextComputational Fourier Optics, A MATLAB Tutorial(SPIEPress,2011)byDavidVoelz.Attendeesarewelcometobringalaptopwithcomputationalsoftwaretothecoursetoexploresomeoftheconcepts.However,acomputerisnotrequiredforthelearningexperience.
Shaping Light, with applications in Advanced Microscopy and Optical TrappingSC1043Course level: IntroductoryCEU .35 $300 / $355 USD Tuesday 1:30 to 5:30 pm
Wavefrontcorrectionandgenerationareimportanttopicsinmanyareas.Thisintroductorycoursewillcover:thebasicGaussianbeam,theneedfor other beams such as: Hermite-Gaussian and Laguerre-Gaussianlasermodes,Besselbeams,Airybeams,andothernotablebeamsandhowtheymaybegenerated.Inaddition,wewillcoversomeapproachesusedforadaptiveoptics/wavefrontcorrection.WewillconsiderusesofDeformableMirrorArrays,SpatialLightModulators,Acousto-OpticDeflectors,etc. Applications includesub-diffraction imaging /super-resolutionmicroscopy,OCT,opticaltrapping,multi-photonmicroscopyatenhanceddepth,andoptimalexcitationofplasmonicstructures.
LEARNING OUTCOMESThiscoursewillenableyouto:• assessavarietyofapproachestobeamshapingandwavefront
correction• explainsimplealignmentprotocolsforoptimizingsomeoptical
beamtypesofbroadinterest• describevariousaspectsofdataanalysisforsomewavefront
correctionalgorithms• identifykeyoptionsforenhanceddegreesofbeamcontrol,
resolution,andsensitivity
INTENDED AUDIENCEThismaterial isappropriate to researcherswhoareconsideringworkinawidevarietyofareaswherewavefrontcorrectionorgenerationofnovelbeamsisofinterest.
INSTRUCTORSKishan Dholakia is a Professor of Physics at the University of St.Andrews(Scotland)andco-ChairoftheConferenceonOpticalTrappingandOpticalMicromanipulation.Gabriel Spalding is a Professor of Physics at Illinois Wesleyanand co-Chair of the Conference on Optical Trapping and OpticalMicromanipulation.
Detectors and Imaging Devices
High Dynamic Range Imaging: Sensors and ArchitecturesSC967 NEWCourse level: IntermediateCEU .35 $345 / $400 USD Monday 1:30 to 5:30 pm
This course provides attendees with an intermediate knowledge ofhighdynamic range imagesensorsand techniques for industrialandnon-industrial applications.Thecoursedescribesvarioussensorandpixelarchitectures toachievehighdynamicrange imagingaswellassoftwareapproachestomakehighdynamicrangeimagesoutoflowerdynamicrangesensorsorimagesets.Thecoursefollowsamathematicapproach to define the amount of information that can be extractedfromtheimageforeachofthemethodsdescribed.Somemethodsforautomaticcontrolofexposureanddynamicrangeofimagesensorsandotherissueslikecolorandglarewillbeintroduced.
LEARNING OUTCOMESThiscoursewillenableyouto:• describevariousapproachestoachievehighdynamicrange
imaging• predictthebehaviorofagivensensororarchitectureonascene• specifythesensororsystemrequirementsforahighdynamicrange
application• classifyahighdynamicrangeapplicationintooneofseveral
standardtypes
INTENDED AUDIENCEThismaterial is intended for anyonewhoneeds to learnmoreaboutquantitative side of high dynamic range imaging. Optical engineers,electronicengineersandscientistswillfindusefulinformationfortheirnexthighdynamicrangeapplication.
INSTRUCTORArnaud Darmont isownerandCEOofAphesa,acompanyfoundedin 2008 and specialized in image sensor consulting, the EMVA1288standardandcamerabenchmarking.HeholdsadegreeinElectronicEngineering from the University of Liège (Belgium). Prior to foundingAphesa,heworkedforover7yearsinthefieldofCMOSimagesensorsandhighdynamicrangeimaging.COURSE PRICE INCLUDES the text High Dynamic Range Imaging: Sensors and Architectures(SPIEPress,2012)byArnaudDarmont.
spie.org/opadvance · TEL:+13606763290 · help@spie.org 203
Courses
Introduction to CCD and CMOS Imaging Sensors and ApplicationsSC504Course level: IntroductoryCEU .65 $665 / $780 USD Monday 8:30 am to 5:30 pm
ThiscourseprovidesareviewofgeneraltheoryandoperationforCCDand CMOS imaging technologies looking at the development andapplicationstatusesofboth.PerformancedifferencesbetweenCMOSandCCDimagingarraysarecovered.Fundamentalperformancelimitsbehind major sensor operations are presented in addition to imagedefects,shorts,deviceyield,popularchipfoundries,chipcost;customdesigned and off-the-shelf sensors. We discuss operation principlesbehind popular commercial and scientific CMOS pixel architectures,and various array readout schemes. We cover backside illuminatedarraysforUV,EUVandx-rayapplications;highQEfrontsideilluminatedsensors;deepdepletionCCDs,ultralargeCMOSandCCDarrays;highspeed/ low noise parallel readout sensors. We describe the photontransfertechniqueinmeasuringperformanceandcalibratingcameraandchipsystems,andchargetransfermechanisms.Wereviewcorrelateddouble sampling theory used to achieve low noise performance andconclude with a look at future research and development trends foreachtechnology.
LEARNING OUTCOMESThiscoursewillenableyouto:• describeoperatingCMOSandCCDarraysandcamerasystemsfor
commercialandscientificimagingapplications• explainhowCCDandCMOSarraysaredesigned,fabricated,tested
andcalibrated• knowhowtoapplytestmethodologiesandperformancestandards• listspecificationsandrequirementstoselectasensorforyour
imagingapplication• recognizeperformancedifferencesbetweenCMOSandCCD
technologies• understandhowvideosignalsareprocessedforoptimumsignal-to-
noiseperformance• becomefamiliarwithcurrentandfutureimagingtechnologiesand
applications
INTENDED AUDIENCEThiscourseisforscientists,engineers,andmanagersinvolvedwithhighperformanceCCDandCMOSimagingsensorsandcamerasystems.
INSTRUCTORJames Janesick is currently the director of the CMOS advanceddevelopment group for Sarnoff Corporation. Previously he waswith Conexant Systems Inc. developing CMOS imaging arrays forcommercial applications. He was technology director of Pixel Vision,Inc.forfiveyearsdevelopinghighspeedbacksideilluminatedCCDsforscientificandcinemacameras.PriortothisJanesickwaswiththeJetPropulsionLaboratoryfor22yearswhereasgroupleaderhedesignedscientificgroundandflightbased imagingsystems.Hehasauthored75 publications and has contributed to many NASA Tech Briefs andpatents for various CCD and CMOS innovations. Janesick receivedNASA medals for Exceptional Engineering Achievement (1982 and1992)andwastherecipientoftheSPIEEducatorAward(2004)andwasSPIE/IS&TImagingScientistoftheYear(2007).COURSE PRICE INCLUDES the texts Scientific Charge Coupled Devices(SPIEPress,2001),and Photon Transfer(SPIEPress,2007)byJamesJanesick.
Digital Camera and Sensor Evaluation Using Photon TransferSC916Course level: IntroductoryCEU .65 $575 / $690 USD Tuesday 8:30 am to 5:30 pm
Photon transfer (PT) is a popular and essential characterizationstandard employed in the design, operation, characterization,calibration, optimization, specification and application of digitalscientific and commercial camera systems. The PT user friendlytechniqueisbasedononlytwomeasurements-averagesignalandrmsnoisewhichtogetherproduceamultitudeof importantdataproductsinevaluatingdigitalcamerasystems(mostnotablyCCDandCMOS).PT is applicable to all imaging disciplines. Design and fabricationprocessengineersdevelopingimagersrelyheavilyonPTdataproductsin determining discrete performance parameters such as quantumefficiency (QE), quantum yield, read noise, full well, dynamic range,nonlinearity, fixed pattern noise, V/e- conversion gain, dark current ,image,etc..CamerausersroutinelyusethePTtechniquetodeterminesystemlevelperformanceparameterstoconvertrelativemeasurementsinto absolute electron and photon units, offset correction, flat fieldand image S/N, ADC quantizing noise, optimum encoding, minimumdetectable luminance, operating temperature to remove dark current, reliability,stability,etc. PT isalso thefirstgo/no-gotestperformedtodeterminethehealthofnewcamerasystemand/ordetectoraswellasprovideapowertoolintroubleshootingproblems.ThiscoursewillreviewtheseaspectsandmanyothersofferedbyPT.
LEARNING OUTCOMESThiscoursewillenableyouto:• describePTtheory• takePTdataanddetermineimportantCCDandCMOSperformance
parameters• showexamplePTdataproductsgeneratedbyCCDandCMOS
imagers• calibrateacamerasysteminabsolutephysicalunits• usePTtodeterminethebestcameraorCCD/CMOSimagerforthe
application• usePTtodemonstrateandverifythecamerasystemisreliableand
ingoodoperatingorder• discussguidelinesforthenoviceandadvanceduseringenerating
PT,ModulationandLuxTransfercurves• usePTtooptimallyremovefixedpatternnoisesourcesinimagesfor
thehighestS/Npossiblethroughflatfielding• comprehendsignal-to-noiseimagetheorythroughPT
INTENDED AUDIENCEEngineers,scientists,andtechnicalmanagersworkingwithcommercialandscientificdigitalcamerasystems.SomefamiliaritywithCCDandCMOSimagersisrecommended.
INSTRUCTORJames Janesick is currently the director of the CMOS advanceddevelopment group for Sarnoff Corporation. Previously he waswith Conexant Systems Inc. developing CMOS imaging arrays for
204 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Courses
commercial applications. He was technology director of Pixel Vision,Inc.forfiveyearsdevelopinghighspeedbacksideilluminatedCCDsforscientificandcinemacameras.PriortothisJanesickwaswiththeJetPropulsionLaboratoryfor22yearswhereasgroupleaderhedesignedscientificgroundandflightbased imagingsystems.Hehasauthored75 publications and has contributed to many NASA Tech Briefs andpatents for various CCD and CMOS innovations. Janesick receivedNASA medals for Exceptional Engineering Achievement (1982 and1992)andwastherecipientoftheSPIEEducatorAward(2004)andwasSPIE/IS&TImagingScientistoftheYear(2007).COURSE PRICE INCLUDES the text Photon Transfer (SPIE Press,2007)byJamesR.Janesick.
Multispectral and Hyperspectral Image SensorsSC194Course level: AdvancedCEU .35 $380 / $435 USD Wednesday 8:30 am to 12:30 pm
Thiscoursewilldescribetheimagingcapabilitiesandapplicationsoftheprincipal typesofmultispectral (MS)andhyperspectral (HS) sensors.The focus will be on sensors that work in the visible, near-infraredandshortwave-infraredspectralregimes,butthecoursewilltouchonlongwave-infrared applications. A summary of the salient features ofclassicalcolorimaging(humanobservation)willalsobeprovidedinanappendix.
LEARNING OUTCOMESThiscoursewillenableyouto:• understandmanyoftheapplicationsandadvantagesof
multispectral(MS)andhyperspectral(HS)imaging• describeandcategorizethepropertiesoftheprincipalMS/
HSdesigntypes(multi-bandscanner,starerswithfilterwheels,dispersive,wedge,andFouriertransformimagerswith2Darrays,etc.)
• listanddefinetherelevantradiometricradiometricquantities,conceptsandphenomenology
• understandtheprocessoftranslatingsystemrequirementsintosensorhardwareconstraintsandspecifications
• analyzesignal-to-noiseratio,modulation-transfer-function,andspatial/spectralsamplingforMSandHSsensors
• define,understandandapplytherelevantnoise-equivalentfigures-of-merit(Noise-equivalentreflectancedifference,Noise-equivalenttemperaturedifference,Noise-equivalentspectralradiance,Noise-equivalentirradiance,etc.)
• describetheelementsoftheimagechainfromphotons-intobits-out(photondetection,videosignalmanipulation,analogprocessing,anddigitization)
• listandreviewkeyimagersubsystemtechnologyelements(optical,focalplane,videoelectronics,andthermal)
• formulateadetailedend-to-enddesignexampleofasatelliteimagingscanningHSsensor
• provideanappendixthatsummarizescolorimagingprinciplesandsensorassociatedelementsforhumanobservationapplications(e.g.colortelevision,stillcameras,etc.)
INTENDED AUDIENCEEngineers, scientists, and technical managers who are interested inunderstandingandapplyingmultispectralandhyperspectralsensorsinadvancedmilitary,civil,scientificandcommercialapplications.
INSTRUCTORTerrence LomheimholdsthepositionofDistinguishedEngineeratTheAerospaceCorp.Hehas32yearsofhardwareandanalysisexperienceinvisibleandinfraredelectro-opticalsystems,focalplanetechnology,andappliedoptics,andhasauthoredandco-authored53publicationsinthesetechnicalareas.HeisaFellowoftheSPIE.COURSEPRICEINCLUDESthetext CMOS/CCD Sensors and Camera Systems, 2nd edition (SPIE Press, 2011) by Terrence Lomheim andGeraldHolst.
Introduction to Optical Remote Sensing SystemsSC567Course level: IntroductoryCEU .35 $300 / $355 USD Wednesday 1:30 to 5:30 pm
This course provides a broad introduction to optical remote sensingsystems,includingbothpassivesensors(e.g.,radiometersandspectralimagers) and active sensors (e.g., laser radars or LIDARs). A briefreviewofbasicprinciplesofradiometryandatmosphericpropagation(absorption, emission, and scattering) is followed by a system-leveldiscussion of a variety of ground-, air-, and space-based remotesensingsystems.Keyequationsarepresentedforpredictingtheopticalresolution and signal-to-noise performance of passive and activesensing systems. Sensor system examples discussed in the classinclude solar radiometers, passive spectrometers and hyperspectralimagers, airborne imaging spectrometers, thermal infrared imagers,polarizationimagers,andactivelaserradars(LIDARsandLADARs).Thecoursematerialisdirectlyrelevanttosensinginenvironmental,civilian,military,astronomical,andsolarenergyapplications.
LEARNING OUTCOMESThiscoursewillenableyouto:• reviewtheprinciplesofopticalradiometryusedtodescribeand
calculatetheflowofopticalenergyinanopticalsensorsystemorsolarenergysystem
• describehowtheatmosphereaffectsthepropagationofopticalradiation
• explainhowopticalatmosphericeffectsinfluenceremotesensingmeasurementsorsolarenergy
• usesystemparametersinbasicradiometriccalculationstopredictthesignalreceivedbypassiveandactivesensors
• comparesystemsattheblock-diagramlevelremotesensingmeasurements
• explainthedifferencebetweenpassiveimagingbasedonreflectionandemission
• acquiretheoperatingprinciplesoflaserradar(lidar/ladar)systemsfordistributedandsolidtargetsensing
INTENDED AUDIENCEScientists, engineers, technicians, or technical managers who findthemselves working on (or curious about) optical remote sensingsystemsordata.Undergraduate training inengineeringor science isassumed.
INSTRUCTORJoseph Shaw isaprofessorofelectricalengineeringandphysicsatMontanaStateUniversityandpreviouslyworkedattheNOAAresearchlabs.Heisarecognizedexpertindevelopment,calibration,andanalysisofopticaloptical remotesensingsystemsused inenvironmentalandmilitarysensing.Recognition forhiswork in thisfield includesNOAAresearchawards,aPresidentialEarlyCareerAwardforScientistsandEngineers,andtheWorldMeteorologicalOrganization’sVaisalaPrize.HeearnedaPh.D.inOpticalSciencesattheUniversityofArizona.Dr.ShawisaFellowofboththeOSAandSPIE.
spie.org/opadvance · TEL:+13606763290 · help@spie.org 205
Courses
Radiometry RevealedSC915Course level: IntroductoryCEU .35 $300 / $355 USD Wednesday 8:30 am to 12:30 pm
This course explains basic principles and applications of radiometryand photometry. A primary goal of the course is to reveal the logic,systematic order, and methodology behind what sometimes appearstobeaconfusingbranchofopticalscienceandengineering.Examplesaretakenfromtheultravioletthroughthelong-waveinfraredportionsoftheelectromagneticspectrum.Anyonewhowantstoanswerquestionssuchas,“howmanywattsorphotonsdoIhave?”or“howmuchopticalenergyorradiationdoIneed?”willbenefitfromtakingthiscourse.
LEARNING OUTCOMESThiscoursewillenableyouto:• describethefundamentalunitsandquantitiesusedtoquantify
electromagneticradiationatwavelengthsfromtheultravioletthroughthevisibleandinfrared
• use,understand,andconvertbetweenradiometricandphotometricquantities
• applyradiometrytotypicalapplications,suchascalibratinganimagingsystem,determininghuman-perceivedbrightnessofadisplay,orcalculatingelectricityproducedbyasolarcell
• calculateareasandsolidanglestodeterminetheenergy,energydensity,orbrightnessinanopticalsystem
• explaintheroleofrays,stops,andpupilsindefiningthefieldofviewandlight-gatheringcapabilityofanopticalsystem
• determinethethroughputofanopticalsystemanduseitinradiometriccalculations
• quantifytheradiantenergyinopticalimagesfrompointandextendedsources
• transferradiantenergyintoandthroughoutopticalsystems• identifyradiometricstandardsandcalibrationmethods• befamiliarwithradiometersandphotometers
INTENDED AUDIENCEScientists, engineers, technicians, or technical managers who wishtolearnmoreabouthowtoquantifyradiantenergyinopticalsystemsandmeasurements.Undergraduate training inengineeringorscienceisassumed.
INSTRUCTORJoseph Shaw is Director of the Optical Technology Center andProfessor of Electrical Engineering and Physics at Montana StateUniversity inBozeman,Montana.Hepreviouslyworkedat theNOAAresearchlabsinBoulder,Colorado.Heisawidelyrecognizedexpertinthedevelopment,calibration,andanalysisofopticalsystemsused inenvironmentalandmilitarysensing.RecognitionforhisworkinthisfieldincludesNOAAresearchawards,aPresidentialEarlyCareerAwardforScientistsandEngineers,andtheWorldMeteorologicalOrganization’sVaisalaPrize.HeearnedaPh.D.inOpticalSciencesattheUniversityofArizonaandisaFellowofboththeOSAandSPIE.
Illumination Engineering
Design of Efficient Illumination SystemsSC011Course level: IntermediateCEU .35 $300 / $355 USD Tuesday 8:30 am to 12:30 pm
Illuminationsystemsare includedinfiber illuminators,projectors,andlithography systems. The design of an illumination system requiresbalancing uniformity, maximizing the collection efficiency from thesource,andminimizingthesizeoftheopticalpackage.Thesechoicesare examined for systems using lightpipes, lens arrays, facetedoptics, tailorededgeraysdesigns,and integratingspheres throughacombination of computer simulations, hardware demonstrations anddiscussions.
LEARNING OUTCOMESThiscoursewillenableyouto:• describethedifferencesbetweenilluminance,intensityand
luminance• computetherequiredsourceluminancegiventypicalillumination
systemspecifications• computethechangeinluminanceintroducedbyanintegrating
sphere• distinguishbetweenaKohlerilluminatorandanAbbeilluminator• explainthedifferenceinuniformityperformancebetweenatailored
edgerayreflectorandastandardconicreflector• designalightpipesystemtoprovideuniformilluminance• designalensarraysystemtocreateauniformilluminance
distribution• designareflectorwithfacetstocreateauniformilluminance
distribution
INTENDED AUDIENCEIndividualswhodesign illuminationsystemsorneedto interfacewiththosedesignerswill find thiscourseappropriate. PreviousexposuretoOpticalFundamentals(Reflection,Refraction,Lenses,Reflectors)isexpected.
INSTRUCTORWilliam CassarlyisaSeniorScientistwithSynopsys(formerlyOpticalResearch Associates). Before joining ORA 14 years ago, CassarlyworkedatGEfor13years,holds46patents,andhasworkedextensivelyin theareasof illuminationsystemdesign,sources,photometry, lightpipes, and non-imaging optics. Bill was awarded the GE Corporate‘D.R.MackAdvancedCourseSupervisorAward’forhiseffortsinthetrainingofGEEngineersandisanSPIEFellow.
Non-Imaging OpticsSC388Course level: IntroductoryCEU .35 $300 / $355 USD Monday 1:30 to 5:30 pm
Nonimaging optics departs from the methods of traditional opticaldesignbyinsteaddevelopingtechniquesformaximizingthecollectingpower of illumination elements and systems. Nonimaging designsexceedtheconcentrationattainablewithfocusingtechniquesbyfactorsoffourormoreandapproachthetheoreticallimit(idealconcentrators).Thiscoursedevelops theconceptual foundationsand isanexcellentcompaniontoDr.DavidJenkins’coursewhichemphasizesapplications.
206 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Courses
LEARNING OUTCOMESThiscoursewillenableyouto:• formulatethelimittolightcollectionposedbyaparticular
application• distinguishbetweenimagingandnonimagingsolutions• classifythenonimagingalgorithms• solvethenonimagingprobleminparticularcontexts• computespecificnonimagingdesigns• estimatetheperformanceofanonimagingdesign• comparetherelativeperformanceofnonimagingandimaging
designs• identifytheapplicationofnonimagingdesignsinavarietyof
applications
INTENDED AUDIENCEThecourseisdesignedforopticaldesigners,engineers,andscientistswhose work encounters demanding problems of light collection orillumination. The course is self-contained. No specialized technicalbackgroundrequired.
INSTRUCTORRoland WinstonisProfessor,AboveScaleintheSchoolsofEngineering&NaturalScience,UniversityofCalifornia,Merced;andDirector,UCSolar comprising five University of California campuses: Berkeley,Santa Barbara, Davis, San Diego and Merced. He founded the fieldofnonimagingopticsand,workingwithstudentsandcolleagues,hasapplied it toavarietyofproblems in radiationdetection, illumination,andsolarenergyconcentration.Heauthored,withJ.C.MinanoandP.Benitez,thetext Nonimaging Optics(Elsevier-AcademicPress,2005).
Understanding Diffractive OpticsSC1071 NEWCourse level: IntroductoryCEU .35 $335 / $390 USD Sunday 1:30 to 5:30 pm
Thefirstportionofthecoursewillcoverthefundamentalprinciplesofdiffractionphenomena.Qualitativeexplanationofdiffractionbytheuseoffielddistributionsandgraphswillprovidethebasisforunderstandingthe fundamental relations and the important trends. Attendees willalsolearntheimportantterminologyemployedinthefieldofdiffractiveoptics.Next, the instructor will provide a comprehensive overview of themain typesofdiffractiveopticalcomponents, includingphaseplates,diffraction gratings, binary optics, diffractive kinoforms, holographicoptical elements, and photonic crystals. Finally, based on practicalexamplesprovidedbytheinstructor,attendeeswilllearnhowmodernoptical andphotonics instrumentationcanbenefit from incorporatingdiffractiveopticalcomponents.
LEARNING OUTCOMESThiscoursewillenableyouto:• acquirethefundamentalsofdiffraction,FresnelandFraunhofer
diffraction,theTalboteffect,apodization,diffractionbymultipleapertures,andsuperresolutionphenomena
• becomefamiliarwithterminologyinthefieldofdiffractiveoptics,• gainanoverviewofthemainfabricationtechniques• describetheoperationalprinciplesofthemajortypesofdiffractive
opticalcomponentsinthescalarandtheresonantdomains,diffractionefficiency,andtheblazingcondition
• getanoverviewofthevariousfunctionsperformedbydiffractiveopticscomponentsinopticalsystems
• comparethebenefitsandlimitationsofdiffractivecomponents
INTENDED AUDIENCEThismaterialisintendedforengineers,scientists,collegestudents,andphotonicsenthusiastswhowouldliketobroadentheirknowledgeandunderstandingofdiffractiveoptics, aswell as to learn thenumerouspractical applications of diffractive optical components in modernopticalinstruments.
INSTRUCTORYakov Soskind is the Principal Systems Engineer with DHPCTechnologies in Woodbridge, NJ. He has been involved in opticalsystems’designanddevelopmentforover30years.Dr.Soskindhasbeenawardedmore than20domesticand internationalpatents,andhasauthoredandco-authoredseveralpublications.HisFieldGuidetoDiffractiveOpticswasrecentlypublishedbySPIEPress(2011).COURSEPRICEINCLUDESthe Field Guide to Diffractive Optics,FG21(SPIEPress,2011)byYakovSoskind.
Radiometry RevealedSC915Course level: IntroductoryCEU .35 $300 / $355 USD Wednesday 8:30 am to 12:30 pm
This course explains basic principles and applications of radiometryand photometry. A primary goal of the course is to reveal the logic,systematic order, and methodology behind what sometimes appearstobeaconfusingbranchofopticalscienceandengineering.Examplesaretakenfromtheultravioletthroughthelong-waveinfraredportionsoftheelectromagneticspectrum.Anyonewhowantstoanswerquestionssuchas,“howmanywattsorphotonsdoIhave?”or“howmuchopticalenergyorradiationdoIneed?”willbenefitfromtakingthiscourse.
LEARNING OUTCOMESThiscoursewillenableyouto:• describethefundamentalunitsandquantitiesusedtoquantify
electromagneticradiationatwavelengthsfromtheultravioletthroughthevisibleandinfrared
• use,understand,andconvertbetweenradiometricandphotometricquantities
• applyradiometrytotypicalapplications,suchascalibratinganimagingsystem,determininghuman-perceivedbrightnessofadisplay,orcalculatingelectricityproducedbyasolarcell
• calculateareasandsolidanglestodeterminetheenergy,energydensity,orbrightnessinanopticalsystem
• explaintheroleofrays,stops,andpupilsindefiningthefieldofviewandlight-gatheringcapabilityofanopticalsystem
• determinethethroughputofanopticalsystemanduseitinradiometriccalculations
• quantifytheradiantenergyinopticalimagesfrompointandextendedsources
• transferradiantenergyintoandthroughoutopticalsystems• identifyradiometricstandardsandcalibrationmethods• befamiliarwithradiometersandphotometers
INTENDED AUDIENCEScientists, engineers, technicians, or technical managers who wishtolearnmoreabouthowtoquantifyradiantenergyinopticalsystemsandmeasurements.Undergraduate training inengineeringorscienceisassumed.
INSTRUCTORJoseph Shaw is Director of the Optical Technology Center andProfessor of Electrical Engineering and Physics at Montana StateUniversity inBozeman,Montana.Hepreviouslyworkedat theNOAAresearchlabsinBoulder,Colorado.Heisawidelyrecognizedexpertinthedevelopment,calibration,andanalysisofopticalsystemsused inenvironmentalandmilitarysensing.RecognitionforhisworkinthisfieldincludesNOAAresearchawards,aPresidentialEarlyCareerAwardforScientistsandEngineers,andtheWorldMeteorologicalOrganization’sVaisalaPrize.HeearnedaPh.D.inOpticalSciencesattheUniversityofArizonaandisaFellowofboththeOSAandSPIE.
spie.org/opadvance · TEL:+13606763290 · help@spie.org 207
Courses
Image and Signal Processing
Image Enhancement, Deblurring and Super-ResolutionSC468 NEWCourse level: AdvancedCEU .65 $525 / $640 USD Monday 8:30 am to 5:30 pm
This course discusses some of the advanced algorithms in the fieldof digital image processing. In particular, it familiarizes the audiencewith the understanding, design, and implementation of advancedalgorithms used in deblurring, contrast enhancement, sharpening,noisereduction,andsuper-resolution instill imagesandvideo.Someof the applications include medical imaging, entertainment imaging,consumer and professional digital still cameras/camcorders, forensicimaging, and surveillance. Many image examples complement thetechnicaldescriptions.
LEARNING OUTCOMESThiscoursewillenableyouto:• explainthevariousnonadaptiveandadaptivetechniquesused
inimagecontrastenhancement.ExamplesincludePhotoShopcommandssuchasBrightness/Contrast,AutoLevels,EqualizeandShadow/Highlights,orPizer’stechniqueandMoroney’sapproach
• explainthefundamentaltechniquesusedinimageDynamicRangeCompression(DRC).IllustrateusingthefastbilateralfilteringbyDorseyandDurandasanexample.
• explainthevarioustechniquesusedinimagenoiseremoval,suchasbilateralfiltering,sigmafilteringandK-NearestNeighbor
• explainthevarioustechniquesusedinimagesharpeningsuchasnonlinearunsharpmasking,etc.
• explainthebasictechniquesusedinimagedeblurring(restoration)suchasinversefilteringandWienerfiltering
• explainthefundamentalideasbehindachievingimagesuper-resolutionfrommultiplelowerresolutionimagesofthesamescene
• explainhowmotioninformationcanbeutilizedinimagesequencestoimprovetheperformanceofvariousenhancementtechniquessuchasnoiseremoval,sharpening,andsuper-resolution
INTENDED AUDIENCEScientists, engineers, and managers who need to understand and/or apply the techniques employed in digital image processing invarious products in a diverse set of applications such as medicalimaging, professional and consumer imaging, forensic imaging,etc. Prior knowledge of digital filtering (convolution) is necessary forunderstandingthe(Wienerfilteringandinversefiltering)conceptsusedindeblurring(about20%ofthecoursecontent).
INSTRUCTORMajid Rabbanihas30yearsofexperienceindigital imaging.HeisaKodak Fellow and Department Head and also an adjunct AssociateProfessor at Rochester Institute of Technology (RIT). He is the co-recipientofthe2005and1988KodakC.E.K.MeesAwardsandtheco-recipientof twoEmmyEngineeringAwards in1990and1996.Heistheco-authorofthebook“DigitalImageCompressionTechniques”publishedin1991andthecreatorofsixvideo/CDROMcoursesintheareaofdigitalimaging.Dr.RabbaniisaFellowofSPIE,aFellowofIEEE,andaKodakDistinguishedInventor.
High Dynamic Range Imaging: Sensors and ArchitecturesSC967 NEWCourse level: IntermediateCEU .35 $345 / $400 USD Monday 1:30 to 5:30 pm
This course provides attendees with an intermediate knowledge ofhighdynamic range imagesensorsand techniques for industrialandnon-industrial applications.Thecoursedescribesvarioussensorandpixelarchitectures toachievehighdynamicrange imagingaswellassoftwareapproachestomakehighdynamicrangeimagesoutoflowerdynamicrangesensorsorimagesets.Thecoursefollowsamathematicapproach to define the amount of information that can be extractedfromtheimageforeachofthemethodsdescribed.Somemethodsforautomaticcontrolofexposureanddynamicrangeofimagesensorsandotherissueslikecolorandglarewillbeintroduced.
LEARNING OUTCOMESThiscoursewillenableyouto:• describevariousapproachestoachievehighdynamicrange
imaging• predictthebehaviorofagivensensororarchitectureonascene• specifythesensororsystemrequirementsforahighdynamicrange
application• classifyahighdynamicrangeapplicationintooneofseveral
standardtypes
INTENDED AUDIENCEThismaterial is intended for anyonewhoneeds to learnmoreaboutquantitative side of high dynamic range imaging. Optical engineers,electronicengineersandscientistswillfindusefulinformationfortheirnexthighdynamicrangeapplication.
INSTRUCTORArnaud Darmont isownerandCEOofAphesa,acompanyfoundedin 2008 and specialized in image sensor consulting, the EMVA1288standardandcamerabenchmarking.HeholdsadegreeinElectronicEngineering from the University of Liège (Belgium). Prior to foundingAphesa,heworkedforover7yearsinthefieldofCMOSimagesensorsandhighdynamicrangeimaging.Note: COURSE PRICE INCLUDES the text High Dynamic Range Imaging: Sensors and Architectures (SPIE Press, 2012) by ArnaudDarmont.
208 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Courses
Digital Camera and Sensor Evaluation Using Photon TransferSC916Course level: IntroductoryCEU .65 $575 / $690 USD Tuesday 8:30 am to 5:30 pm
Photon transfer (PT) is a popular and essential characterizationstandard employed in the design, operation, characterization,calibration, optimization, specification and application of digitalscientific and commercial camera systems. The PT user friendlytechniqueisbasedononlytwomeasurements-averagesignalandrmsnoisewhichtogetherproduceamultitudeof importantdataproductsinevaluatingdigitalcamerasystems(mostnotablyCCDandCMOS).PT is applicable to all imaging disciplines. Design and fabricationprocessengineersdevelopingimagersrelyheavilyonPTdataproductsin determining discrete performance parameters such as quantumefficiency (QE), quantum yield, read noise, full well, dynamic range,nonlinearity, fixed pattern noise, V/e- conversion gain, dark current ,image,etc..CamerausersroutinelyusethePTtechniquetodeterminesystemlevelperformanceparameterstoconvertrelativemeasurementsinto absolute electron and photon units, offset correction, flat fieldand image S/N, ADC quantizing noise, optimum encoding, minimumdetectable luminance, operating temperature to remove dark current, reliability,stability,etc. PT isalso thefirstgo/no-gotestperformedtodeterminethehealthofnewcamerasystemand/ordetectoraswellasprovideapowertoolintroubleshootingproblems.ThiscoursewillreviewtheseaspectsandmanyothersofferedbyPT.
LEARNING OUTCOMESThiscoursewillenableyouto:• describePTtheory• takePTdataanddetermineimportantCCDandCMOSperformance
parameters• showexamplePTdataproductsgeneratedbyCCDandCMOS
imagers• calibrateacamerasysteminabsolutephysicalunits• usePTtodeterminethebestcameraorCCD/CMOSimagerforthe
application• usePTtodemonstrateandverifythecamerasystemisreliableand
ingoodoperatingorder• discussguidelinesforthenoviceandadvanceduseringenerating
PT,ModulationandLuxTransfercurves• usePTtooptimallyremovefixedpatternnoisesourcesinimagesfor
thehighestS/Npossiblethroughflatfielding• comprehendsignal-to-noiseimagetheorythroughPT
INTENDED AUDIENCEEngineers,scientists,andtechnicalmanagersworkingwithcommercialandscientificdigitalcamerasystems.SomefamiliaritywithCCDandCMOSimagersisrecommended.
INSTRUCTORJames Janesick is currently the director of the CMOS advanceddevelopment group for Sarnoff Corporation. Previously he waswith Conexant Systems Inc. developing CMOS imaging arrays forcommercial applications. He was technology director of Pixel Vision,Inc.forfiveyearsdevelopinghighspeedbacksideilluminatedCCDsforscientificandcinemacameras.PriortothisJanesickwaswiththeJetPropulsionLaboratoryfor22yearswhereasgroupleaderhedesignedscientificgroundandflightbased imagingsystems.Hehasauthored75 publications and has contributed to many NASA Tech Briefs andpatents for various CCD and CMOS innovations. Janesick receivedNASA medals for Exceptional Engineering Achievement (1982 and1992)andwastherecipientoftheSPIEEducatorAward(2004)andwasSPIE/IS&TImagingScientistoftheYear(2007).COURSE PRICE INCLUDES the text Photon Transfer (SPIE Press,2007)byJamesR.Janesick.
Understanding Diffractive OpticsSC1071 NEWCourse level: IntroductoryCEU .35 $335 / $390 USD Sunday 1:30 to 5:30 pm
Thefirstportionofthecoursewillcoverthefundamentalprinciplesofdiffractionphenomena.Qualitativeexplanationofdiffractionbytheuseoffielddistributionsandgraphswillprovidethebasisforunderstandingthe fundamental relations and the important trends. Attendees willalsolearntheimportantterminologyemployedinthefieldofdiffractiveoptics.Next, the instructor will provide a comprehensive overview of themain typesofdiffractiveopticalcomponents, includingphaseplates,diffraction gratings, binary optics, diffractive kinoforms, holographicoptical elements, and photonic crystals. Finally, based on practicalexamplesprovidedbytheinstructor,attendeeswilllearnhowmodernoptical andphotonics instrumentationcanbenefit from incorporatingdiffractiveopticalcomponents.
LEARNING OUTCOMESThiscoursewillenableyouto:• acquirethefundamentalsofdiffraction,FresnelandFraunhofer
diffraction,theTalboteffect,apodization,diffractionbymultipleapertures,andsuperresolutionphenomena
• becomefamiliarwithterminologyinthefieldofdiffractiveoptics,• gainanoverviewofthemainfabricationtechniques• describetheoperationalprinciplesofthemajortypesofdiffractive
opticalcomponentsinthescalarandtheresonantdomains,diffractionefficiency,andtheblazingcondition
• getanoverviewofthevariousfunctionsperformedbydiffractiveopticscomponentsinopticalsystems
• comparethebenefitsandlimitationsofdiffractivecomponents
INTENDED AUDIENCEThismaterialisintendedforengineers,scientists,collegestudents,andphotonicsenthusiastswhowouldliketobroadentheirknowledgeandunderstandingofdiffractive optics, aswell as to learn thenumerouspractical applications of diffractive optical components in modernopticalinstruments.
INSTRUCTORYakov Soskind is the Principal Systems Engineer with DHPCTechnologies in Woodbridge, NJ. He has been involved in opticalsystems’designanddevelopmentforover30years.Dr.Soskindhasbeenawardedmore than20domesticand internationalpatents,andhasauthoredandco-authoredseveralpublications.HisFieldGuidetoDiffractiveOpticswasrecentlypublishedbySPIEPress(2011).COURSEPRICEINCLUDESthe Field Guide to Diffractive Optics,FG21(SPIEPress,2011)byYakovSoskind.
Modeling and Simulation with Computational Fourier OpticsSC1080 NEWCourse level: IntermediateCEU .65 $525 / $640 USD Wednesday 8:30 am to 5:30 pm
Thiscourseexplains the implementationofFourieroptics theoryandconceptsonthecomputer.Aprimaryobjectiveistoprovideattendeeswith the capability of programming their own basic wave (physical)optics simulations to model diffraction, beam propagation, lenses,gratings, and imaging.Thecourse includesa short reviewofFourieropticstheory,detailsofapplyingthefastFouriertransform(FFT),andapproachesforimplementingavarietyofwaveopticssimulations.Themethodsdiscussedcanbeappliedintechnicalsoftwareenvironmentssuch as MATLAB, Mathcad, IDL and C. Examples are presentedprimarilyinMATLABbutimplementationinotherenvironmentsisalsodiscussed.
spie.org/opadvance · TEL:+13606763290 · help@spie.org 209
Courses
LEARNING OUTCOMESThiscoursewillenableyouto:• modelsimplephysicalstructureswithalimitedsetofbasicanalytic
functions• choosetheparametersformodeling2-Dspatialandspectral
functionsonthecomputeranddeterminethescalingconstantsinvolvedwiththeuseoftheFFT
• modelopticalwaveswithcomplexexponentialnotation• createanopticalpropagation/diffractioncomputersimulation• buildwaveopticscomputermodelsoflensesandgratings• createimagesimulationsthatincludediffractionandaberrations
INTENDED AUDIENCEEngineersandscientistswhowishtolearnthedetailsofimplementingFourieropticstheoryonthecomputerandhowtocreatetheirownwaveopticssimulations.Also,anyonewhoislookingforaconcisereviewofFourier optical theory fromadifferent andpractical perspective. It issuggestedthatattendeeshaveabasicfamiliaritywithFourieroptics.
INSTRUCTORDavid Voelz is a professor of electrical engineering at New MexicoStateUniversityandholdsaPaulW.andValerieKlipschProfessorship.He received his Ph.D. degree in EE from the University of Illinoisin 1987. From 1986 to 2001 he worked as a research engineer andprojectmanagerattheAirForceResearchLaboratoryinAlbuquerque,NM. He was named a Fellow of SPIE in 1999 and has received anOSA Engineering Excellence Award, the Bromilow Award at NMSUfor research excellence, and the Giller Award at AFRL for technicalachievement. His research interests always seem to involve someaspectofFourieropticsandincludespectralandpolarimetricimaging,laser imaging and beam projection, laser communication, adaptiveoptics,andastronomicalinstrumentationdevelopment.COURSEPRICEINCLUDESthetextComputational Fourier Optics, A MATLAB Tutorial(SPIEPress,2011)byDavidVoelz.Attendeesarewelcometobringalaptopwithcomputationalsoftwaretothecoursetoexploresomeoftheconcepts.However,acomputerisnotrequiredforthelearningexperience.
Principles of Fourier Optics and DiffractionSC017Course level: IntermediateCEU .65 $630 / $745 USD Tuesday 8:30 am to 5:30 pm
Thiscourse introduces theapplicationofFourier theory indiffractionandimageformation.Thefirstpartofthecourseprovidesareviewofanumberofmathematicaltopics,includingconvolutionandtheFouriertransform.Next,thephenomenonofdiffractionisintroduced,theeffectsoflensesondiffractionarediscussed,andthepropagationofGaussianbeamsistreated.Finally,theeffectsofdiffractionontheperformanceofimage-formingsystemsandotheropticaldevicesarediscussed.
LEARNING OUTCOMESThiscoursewillenableyouto:• understandconvolutionandFouriertransformoperations• describethegeneraleffectsofdiffractionintheFresneland
Fraunhoferregions• understandtheeffectsoflensesondiffraction• predicttheFraunhoferdiffractionpatternsassociatedwithspecific
apertures• describethepropagationofGaussianbeams• understandtheeffectsofdiffractiononimageformationandimage
resolution• calculatethePoint-SpreadFunctions(PSF)andOpticalTransfer
Functions(OTF)forvariousimagingsystems
INTENDED AUDIENCEThis course is intended for scientists and engineers who need tounderstand the diffraction of optical wavefields and the effects ofdiffraction on the performance of image-forming systems and otheropticaldevices.
INSTRUCTORJack GaskillisProfessorEmeritusofOpticalSciencesattheUniversityofArizonawhere,formorethan30years,histeachingactivitiesweredevotedprimarilytotheapplicationsofFouriertheoryinoptics.Hehastaughtmore than40off-campusshort courses inFourier opticsandrelated subjects. Gaskill is author of the textbook, Linear Systems, Fourier Transforms, and Optics (Wiley,1978),and isaPastPresidentofSPIE.COURSE PRICE INCLUDES the text Linear Systems, Fourier Transforms, and Optics(Wiley,1978)byJackD.Gaskill.
NanoEngineering
Nanophotonics and MetaphotonicsSC1082 NEWCourse level: Introductory0.35 CEU $300 SPIE Members / $355 Non-membersMonday, 2:00 - 6:00 pmNanophotonics,definedasnanoscaleopticalscienceandtechnology,is a rapidly growing field which offers challenging opportunities forstudying the interaction between light and matter on a scale muchsmaller than thewavelengthof radiation,aswellas for thedesignofnovelnanostructuredopticalmaterialsanddevicesandfordevelopingnanocharacterizationtools.AnimportantdimensionofNanophotonicsiscontrolofexcitationdynamicsbymanipulating localrelaxationandenergytransfertojudiciouslyutilizetheexcitationenergyforaspecificpurpose.Metaphotonics isa rapidlyemergingnewdirection inNanophotonicsthatdealswithmanipulationofelectricandmagneticfieldsand theircoupling in nanoengineered materials to control the field distributionand propagation of electromagnetic waves. An important aimfor Metaphotonics is achieving negative refractive index for lightmanipulation. Another important aim is producing Switchable/TransformableMaterialsinwhichelectrical,optical,andmagneticfieldscanbeusedfordynamicandreversiblecontrolofanopticalfieldaswellaslinearandnonlinearopticalfunctions.Theirapplicationsrangefromphotonicscommunications,electronics,tosolarenergyharvesting,tosensortechnology,biomedicaltechnologyandhealthcare.This course will cover the fundamentals of nanoscale light-matterinteraction; various nanoscale linear and nonlinear optical effects,couplingofelectricandmagneticpropertiesusingnanotechnology,andnovelopticaleffectsinnanostructuredhybridmaterials.LEARNINGOUTCOMESThiscoursewillenableyouto:• becomefamiliarwiththefundamentalsofnanoscalelinearand
nonlinearopticalinteractions• learnaboutquantumdots,quantumrodsandquantumwells• learnaboutplasmonicmaterials• learnhowtocontrolthefateofexcitationenergyforaspecific
application• learnaboutup-conversionofradiationandnovelmaterialsefficiently
producingit• learnaboutapplicationofnanophotonicstosolarenergyconversion• learnaboutbiomedicalapplicationsofnanophotonics• becomefamiliarwithMetaphotonicsandMetamaterials• learnaboutdifferentapproachestoproduceMetamaterialswith
nearzeroornegativerefractiveindex• learnhowmagneto-optics,magneto-plasmonicandspin-photonics
increasesthescopeofMetaphotonics• learnaboutdifferentapproachesforswitchableandtransformable
photonicfunctions• learnaboutopportunitiesinNanophotonicsandMetaphotonics
210 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Courses
INTENDED AUDIENCEThis course is intended for anyone who needs to learn about light-matter interactions and their manipulation in nanoengineerednovel materials as well as their applications in Energy, Health Care,SemiconductorIndustry,DefenseTechnologyandSensorTechnology.The course is appropriate for a multidisciplinary audience, includingengineers, materials scientists, optical physicists, theorists, chemistsandbiomedicalresearchers.INSTRUCTORParas N. Prasad Ph.D., is the SUNY Distinguished Professor ofChemistry,Physics,ElectricalEngineering,andMedicine; theSamuelP.CapenChair;andtheExecutiveDirectoroftheInstituteforLasers,Photonics and Biophotonics at the University at Buffalo. He wasnamedamongthetop50Science&Technology leaders in theworldbyScientificAmerican in2005.Hehaspublished~700scientificandtechnicalpapersinhighimpactjournals,3monographsthatpracticallydefined the fields of Organic Nonlinear Optics, Biophotonics andNanophotonics,and8editedbooks.Heholdsnumerouspatents.Heis the recipientofmanyscientificawardsandhonors (MorleyMedal;Schoellkopfaward;Guggenheimfellowship;Sloanfellowship;WesternNewYorkHealthCareIndustriesTechnology/Discoveryaward;Fellowof APS, OSA & SPIE). He is a pioneer in nanophotonics and chiralmetaphotonics, and has been giving Plenary, Opening and KeynoteLecturesworldwideinthisfield.
NOTE: Dr. Prasad will deliver a Nanotechnology Plenarypresentation entitled “From Nanophotonics, to Metaphotonics, toDynamicPhotonics:ControllingLightPropagationandLight-MatterInteractions for Emerging Technologies” in the Monday morningsession,immediatelypriortothecourse.Thispresentationisfreetoallregisteredtechnicalattendeesandyouareencouragedtoattend.
Optical Scatter Metrology for IndustrySC1003Course level: IntermediateCEU .35 $360 / $415 USD Monday 1:30 to 5:30 pm
Optical scatter, originally used almost exclusively to characterize thestraylightgeneratedbyopticallysmoothsurfaces,isnowbeingusedasasensitive,economicalwaytomonitorthesurfacetexturerequirementsinavarietyofindustries.Forexample,thephoto-voltaicindustryusesspecifictypesoftextureonsurfacestoincreaseabsorptionandsystemefficiency. Texture is often an important requirement for the metalproducing industry and it changeswith rollwear. Theappearanceofevery day appliances (from door hinges to computer cases) variesdramaticallywith texture. Thequalityof flatpaneldisplaysdependsonthescattercharacteristicsofthescreenandcomponentsbehindit.SEMIandASTMarerespondingtothenewapplicationswith“scatterstandards” to help communication between manufacturers, vendorsandcustomers.Thelowsignal(hardtomeasure)opticalapplicationsweresolvedfirstbecause the math was easy. Rougher surface scatter relationshipsare more complicated, but the signals are much larger - makinginstrumentationeasier.Thecoursestartswiththeopticalapplicationsandthenexploresthetransitiontorougherindustrysurfaces.Betweenagoodopticalmirrorandaconcretesidewalktherearethousandsofindustrysurfacesthatcanbemonitoredwithscattermetrology.Thereare twokeypoints for these “in-between” surfaces: (1) If the texturechanges - the scatter changes and (2) these changes (and productfunction)cannotbeadequatelymonitoredbyasinglevariable-suchasRMSRoughness,HazeorGloss.Thecourseemphasizesquantifying,measuring and understanding scatter. The modeling of scatter ismentioned,butisnotemphasizedhere.
LEARNING OUTCOMESThiscoursewillenableyouto:• quantifyandanalyzescatterintermsofBRDF,TIS,HazeandDSC
units• explaintheinstrumentationforobtainingscatterdataandevaluate
systemcalibration• describeandovercomethevariousdifficultiesincomparing
roughnessstatisticsfoundfromprofilometersandscatterometersforbothone-andtwo-dimensionalsamples
• convertscattertoroughnessstatisticswhenpossibleandunderstandwhenitisnotpossible
• evaluatetheuseofscattermeasurementforspecificapplicationssuchas:straysystemradiation,surfacemicro-roughness,particulatesizing,backgroundsensornoise
• explaintheuseofpolystyrenelatexspheredepositionsasanopticalscatteringstandard
• reviewscatteringstandardsforthesemiconductorandphoto-voltaicindustries
INTENDED AUDIENCEEngineers, scientists, and managers who need to understand andapply thebasicconceptsofscattermetrology to laboratory researchandindustrialprocesscontrol.Someknowledgeofcalculusishelpful,but thecoursedoesnot require that thestudent followmathematicalderivations. The instructor has worked with Thomas Germer (SC492instructor)toavoidoverlapbetweenthetwocourses.
INSTRUCTORJohn Stover is President of The Scatter Works, Inc., a Tucson firmconcentratingonscatterbasedmetrologystandards,consulting,andmeasurementas theyapply todiverse industries.Hehas researchedlight scatter related problems for over 30 years and led teams ofengineers who developed state-of-the-art scatterometers, verifiedtheoretical relationship between surface roughness and scatter andcharacterizedsurfacedefectstoimprovewafermetrology.Hehasbeeninvolvedwithinternationalstandardsorganizationsforover20years,isanSPIEFellow,andhasbeenactiveasanauthor,conferencechairman,andeditor,andhasoveronehundredpublications.COURSEPRICEINCLUDESthetext Optical Scattering: Measurement and Analysis, 2nd Edition(SPIEPress,1995)byJohnStover.
Nanoscience
Shaping Light, with applications in Advanced Microscopy and Optical TrappingSC1043Course level: IntroductoryCEU .35 $300 / $355 USD Tuesday 1:30 to 5:30 pm
Wavefrontcorrectionandgenerationareimportanttopicsinmanyareas.Thisintroductorycoursewillcover:thebasicGaussianbeam,theneedfor other beams such as: Hermite-Gaussian and Laguerre-Gaussianlasermodes,Besselbeams,Airybeams,andothernotablebeamsandhowtheymaybegenerated.Inaddition,wewillcoversomeapproachesusedforadaptiveoptics/wavefrontcorrection.WewillconsiderusesofDeformableMirrorArrays,SpatialLightModulators,Acousto-OpticDeflectors,etc. Applications includesub-diffraction imaging /super-resolutionmicroscopy,OCT,opticaltrapping,multi-photonmicroscopyatenhanceddepth,andoptimalexcitationofplasmonicstructures.
spie.org/opadvance · TEL:+13606763290 · help@spie.org 211
Courses
LEARNING OUTCOMESThiscoursewillenableyouto:• assessavarietyofapproachestobeamshapingandwavefront
correction• explainsimplealignmentprotocolsforoptimizingsomeoptical
beamtypesofbroadinterest• describevariousaspectsofdataanalysisforsomewavefront
correctionalgorithms• identifykeyoptionsforenhanceddegreesofbeamcontrol,
resolution,andsensitivity
INTENDED AUDIENCEThismaterial isappropriate to researcherswhoareconsideringworkinawidevarietyofareaswherewavefrontcorrectionorgenerationofnovelbeamsisofinterest.
INSTRUCTORSKishan Dholakia is a Professor of Physics at the University of St.Andrews(Scotland)andco-ChairoftheConferenceonOpticalTrappingandOpticalMicromanipulation.Gabriel Spalding is a Professor of Physics at Illinois Wesleyanand co-Chair of the Conference on Optical Trapping and OpticalMicromanipulation.
NanoplasmonicsSC727Course level: IntermediateCEU .65 $525 / $640 USD Thursday 8:30 am to 5:30 pm
Nanooptics deals with optical phenomena and spectroscopy on thenanoscale,i.e.,intheregionsofspacewhosesizeismuchsmallerthanthelightwavelength.Whileelectromagneticwavescannotbelocalizedin the regions with sizes significantly less than half wavelength,nanooptics isbasedonelectricfieldsoscillatingatoptical frequency.From the positions of the interaction with matter and spectroscopy,such localoptical fieldsmostlyproduce thesame typeof responsesaselectromagneticwaves.Elementaryexcitations thatarecarriersofenergyandcoherenceinnanoopticsaresurfaceplasmons(SPs).Theselocalfieldscauseawealthofgiganticallyenhancedopticalphenomenaofwhich thesurfaceenhancedRamanscattering (SERS) is themoststudiedandwidelyknown.This one-day course will encompass the fundamental propertiesand applications of the surface plasmonics at the nanoscale. It willinclude coherent effects associated with phase memory of the SPs,in particular, coherent control of nanooptical phenomena. Nonlinearprocessessuchasgenerationofharmonicsandtwo-photonexcitationbynanoscale fieldswill alsobecovered.Ultrafast (femtosecondandattosecond) phenomena are within the scope of this course. We willalsoincludequantumphenomenaassociatedwithpropertiesofsurfaceplasmons as quantum quasiparticles such as quantum generationand fluctuations. Along with fundamental properties of SPs, we willconsidermanyapplicationsofnanoplasmonics,inparticular,detectionofultrasmallamountsofchemicalandbiologicalcompounds,scanningnear-fieldopticalmicroscopesorSNOMs,andnanolithography.
LEARNING OUTCOMESThiscoursewillenableyouto:• namepropertiesofsurfaceplasmonpolaritons(SPPs)as
electromagneticwavesatmetal-dielectricinterfaces• explainwhataresurfaceplasmons(SPs)aseigenmodesof
nanosystem• formulatetheoryoflinearopticalresponsesonthenanoscale• explaingiantenhancementofRamanscatteringinnanoplasmonic
systems• identifyultrafastnanoplasmonicopticalresponses• explaincoherentcontrolofopticalresponsesonnanoscale:linear
andnonlineareffects• describequantumgenerationofSPsinnanosystem
INTENDED AUDIENCEThis course is intended for engineers, physicists, chemists, andbiologistsinterestedinfundamentalsandapplicationsofnanooptics.
INSTRUCTORMark Stockman received his PhD and DSc degrees from institutesof the Russian Academy of Sciences. Currently he is Professor ofPhysicsatGeorgiaStateUniversity,Atlanta,GA,USA.HealsoservedasaDistinguishedProfessoratEcoleNormaleSupérieuredeCachan(France)andasaGuestProfessoratUniversityofStuttgart(Germany),Max Plank Institute for Quantum Optics (Garching, Germany), andLudwig Maximilian University (Munich, Germany). A major directionof his research is theoretical nanoplasmonics, especially theory ofultrafast and nonlinear nanoscale optical phenomena. He is a co-inventorofSPASER(nanoplasmoniclaser).Heisanauthorof150majorresearchpapersandpresentedmanyinvitedandkeynotetalksatmajorinternationalconferences.Hetaughtshortcoursesonnanoplasmonicsand related topics at major international meetings and scientificinstitutionsinUS,Canada,Europe,Asia,andAustralia.
Nanophotonics and MetaphotonicsSC1082Course level: Introductory0.35 CEU $300 SPIE Members / $355 Non-membersMonday, 2:00 - 6:00 pmNanophotonics,definedasnanoscaleopticalscienceandtechnology,is a rapidly growing field which offers challenging opportunities forstudying the interaction between light and matter on a scale muchsmaller than thewavelengthof radiation,aswellas for thedesignofnovelnanostructuredopticalmaterialsanddevicesandfordevelopingnanocharacterizationtools.AnimportantdimensionofNanophotonicsiscontrolofexcitationdynamicsbymanipulating localrelaxationandenergytransfertojudiciouslyutilizetheexcitationenergyforaspecificpurpose.Metaphotonics isa rapidlyemergingnewdirection inNanophotonicsthatdealswithmanipulationofelectricandmagneticfieldsand theircoupling in nanoengineered materials to control the field distributionand propagation of electromagnetic waves. An important aimfor Metaphotonics is achieving negative refractive index for lightmanipulation. Another important aim is producing Switchable/TransformableMaterialsinwhichelectrical,optical,andmagneticfieldscanbeusedfordynamicandreversiblecontrolofanopticalfieldaswellaslinearandnonlinearopticalfunctions.Theirapplicationsrangefromphotonicscommunications,electronics,tosolarenergyharvesting,tosensortechnology,biomedicaltechnologyandhealthcare.This course will cover the fundamentals of nanoscale light-matterinteraction; various nanoscale linear and nonlinear optical effects,couplingofelectricandmagneticpropertiesusingnanotechnology,andnovelopticaleffectsinnanostructuredhybridmaterials.
LEARNING OUTCOMESThiscoursewillenableyouto:• becomefamiliarwiththefundamentalsofnanoscalelinearand
nonlinearopticalinteractions• learnaboutquantumdots,quantumrodsandquantumwells• learnaboutplasmonicmaterials• learnhowtocontrolthefateofexcitationenergyforaspecific
application• learnaboutup-conversionofradiationandnovelmaterialsefficiently
producingit• learnaboutapplicationofnanophotonicstosolarenergyconversion• learnaboutbiomedicalapplicationsofnanophotonics• becomefamiliarwithMetaphotonicsandMetamaterials• learnaboutdifferentapproachestoproduceMetamaterialswith
nearzeroornegativerefractiveindex• learnhowmagneto-optics,magneto-plasmonicandspin-photonics
increasesthescopeofMetaphotonics• learnaboutdifferentapproachesforswitchableandtransformable
photonicfunctions• learnaboutopportunitiesinNanophotonicsandMetaphotonics
212 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Courses
INTENDED AUDIENCEThis course is intended for anyone who needs to learn about light-matter interactions and their manipulation in nanoengineerednovel materials as well as their applications in Energy, Health Care,SemiconductorIndustry,DefenseTechnologyandSensorTechnology.The course is appropriate for a multidisciplinary audience, includingengineers, materials scientists, optical physicists, theorists, chemistsandbiomedicalresearchers.
INSTRUCTORParas N. Prasad Ph.D., is the SUNY Distinguished Professor ofChemistry,Physics,ElectricalEngineering,andMedicine; theSamuelP.CapenChair;andtheExecutiveDirectoroftheInstituteforLasers,Photonics and Biophotonics at the University at Buffalo. He wasnamedamongthetop50Science&Technology leaders in theworldbyScientificAmerican in2005.Hehaspublished~700scientificandtechnicalpapersinhighimpactjournals,3monographsthatpracticallydefined the fields of Organic Nonlinear Optics, Biophotonics andNanophotonics,and8editedbooks.Heholdsnumerouspatents.Heis the recipientofmanyscientificawardsandhonors (MorleyMedal;Schoellkopfaward;Guggenheimfellowship;Sloanfellowship;WesternNewYorkHealthCareIndustriesTechnology/Discoveryaward;Fellowof APS, OSA & SPIE). He is a pioneer in nanophotonics and chiralmetaphotonics, and has been giving Plenary, Opening and KeynoteLecturesworldwideinthisfield.
NOTE: Dr. Prasad will deliver a Nanotechnology Plenarypresentation entitled “From Nanophotonics, to Metaphotonics,to Dynamic Photonics: Controlling Light Propagation and Light-Matter Interactions for Emerging Technologies” in the Mondaymorningsession,immediatelypriortothecourse.Thispresentationisfreetoallregisteredtechnicalattendeesandyouareencouragedtoattend.
Optical Design and Systems Engineering
Practical Optical System DesignSC003Course level: IntermediateCEU .65 $605 / $725 USD Wednesday 8:30 am to 5:30 pm
This course will provide attendees with a basic working knowledgeof optical design and associated engineering. The information inthis course will help novice and experienced designers, as well aspeoplewho interactwithopticaldesignersandengineers,sufficientlyunderstand these problems and solutions to minimize cost and risk.Thecourseincludesbackgroundinformationforopticaldesignandanarrayofpragmaticconsiderationssuchasopticalsystemspecification,analysisofopticalsystems,materialselection,useofcatalogsystemsandcomponents,ultraviolet through infraredsystemconsiderations,environmental factors and solutions, Gaussian beam optics, andproductionconsiderationssuchasoptical testingandalignment.Thecourse includes many practical and useful examples emphasizingrigorousopticaldesignandengineeringwithanemphasisondesigningformanufacture.Evenifyouhaveneverusedanopticaldesignprogrambefore,youwillbecomefluentwithhowtoestimate,assess,execute,andmanagethedesignofopticalsystemsformanyvariedapplications.This course is a continuation of the long-running Practical OpticalSystemsDesigncourseestablishedandtaughtbyRobertE.Fischer.
LEARNING OUTCOMESThiscoursewillenableyouto:• developacompleteopticalsystemdesignspecification• reviewfundamentalphysicsandengineeringrelatedtooptical
design• assessandanalyzeopticalsystemsusingcomputer-aidedmethods• properlytakeintoaccountsystemconsiderationssuchas
environmentalfactors• designformanufacture,alignment,andtesting• describeallaspectsofopticaldesignandassociatedengineering
INTENDED AUDIENCEThiscourseisintendedforanyonewhoneedstolearnhowtodesignopticalsystems.Itwillbeofvaluetothosewhoeitherdesigntheirownopticsorthosewhoworkdirectlyorindirectlywithopticaldesigners,asyouwillnowunderstandwhatisreallygoingonandhowtoasktherightquestionsofyourdesigners.
INSTRUCTORRichard Youngworth isFounderandChiefEngineerofRiyoLLC,anopticaldesignandengineeringfirmprovidingengineeringandproductdevelopmentservices.His industrialexperiencespansdiverse topicsincluding optical metrology, design, manufacturing, and analysis. Dr.Youngworth has spent significant time working on optical systemsin the challenging transition from ideal design to successful volumemanufacturing.Heiswidelyconsideredanexpert,duetohisresearch,lectures,publications,andindustrialworkonthedesign,producibility,and tolerance analysis of optical components and systems. Dr.Youngworth teaches “Practical Optical System Design” and “Cost-ConsciousTolerancingofOpticalSystems”forSPIE.HehasaB.S.inelectricalengineering fromtheUniversityofColoradoatBoulderandearnedhisPh.D.inopticsattheUniversityofRochesterbyresearchingtoleranceanalysisofopticalsystems.COURSE PRICE INCLUDES the text Optical System Design, 2nd Edition (SPIEPress, 2008)byRobertE. Fischer,BiljanaTadic-Galeb,andPaulR.Yoder,Jr.
Optical System Design: Layout Principles and PracticeSC690Course level: IntroductoryCEU .65 $635 / $750 USD Sunday 8:30 am to 5:30 pm
This course provides the background and principles necessary tounderstand how optical imaging systems function, allowing you toproduceasystemlayoutwhichwillsatisfytheperformancerequirementsofyourapplication.Thiscourseteachesthemethodsandtechniquesofarrivingatthefirst-order layoutofanopticalsystembyaprocesswhichdeterminestherequiredcomponentsandtheirlocations.Thisprocesswillproduceanimageoftherightsizeandintherightlocation.Aspecialemphasisisplacedonunderstandingthepracticalaspectsofthedesignofopticalsystems.OpticalsystemimagerycanreadilybecalculatedusingtheGaussiancardinalpointsorbyparaxialraytracing.Theseprinciplesareextendedto the layout and analysis of multi-component systems. This courseincludestopicssuchas imagingwiththin lensesandsystemsof thinlenses, stops and pupils, and afocal systems. The course starts byproviding the necessary background and theory of first-order opticaldesignfollowedbynumerousexamplesofopticalsystemsillustratingthedesignprocess.
spie.org/opadvance · TEL:+13606763290 · help@spie.org 213
Courses
LEARNING OUTCOMESThiscoursewillenableyouto:• specifytherequirementsofanopticalsystemforyourapplication
includingmagnification,object-to-imagedistance,andfocallength• diagramraypathsanddosimpleraytracing• describetheperformancelimitsimposedonopticalsystemsby
diffractionandthehumaneye• predicttheimagingcharacteristicsofmulti-componentsystems• determinetherequiredelementdiameters• applythelayoutprinciplestoavarietyofopticalinstruments
includingtelescopes,microscopes,magnifiers,fieldandrelaylenses,zoomlenses,andafocalsystems
• adaptaknownconfigurationtosuityourapplication• grasptheprocessofthedesignandlayoutofanopticalsystem
INTENDED AUDIENCEThiscourseisintendedforengineers,scientists,managers,techniciansandstudentswhoneedtouseordesignopticalsystemsandwanttounderstand theprinciplesof image formationbyopticalsystems.Nopreviousknowledgeofopticsisassumedinthematerialdevelopment,and only basic math is used (algebra, geometry and trigonometry).Bytheendof thecourse, thesetechniqueswillallowthedesignandanalysisofrelativelysophisticatedopticalsystems.
INSTRUCTORJohn Greivenkamp isaprofessorattheCollegeofOpticalSciencesofTheUniversityofArizonawhereheteachesgeometricalopticsandopticalsystemdesigntoundergraduateandgraduatestudents.JohnistheeditoroftheSPIEFieldGuidesandistheauthorofthe Field Guide to Geometrical Optics(SPIEPress,2004).COURSEPRICEINCLUDESthetexts Modern Optical Engineering, 4th edition(SPIEPress,2008)byWarrenJ.Smithandthe Field Guide to Geometrical Optics(SPIEPress,2004)byJohnE.Greivenkamp.SPECIALNOTE:ThiscourseisacontinuationofWarrenSmith’slong-standingSPIEcourseSC001,OpticalSystemDesign:LayoutPrinciplesand Practice and incorporates many of the same approaches andmaterialusedforthatcourse.
Intermediate Lens DesignSC912Course level: IntermediateCEU .65 $610 / $725 USD Wednesday 8:30 am to 5:30 pm
Haveyoueverwonderedwhyrefractive,reflective,andzoomedopticalsystems look theway that theydo? Thiscoursebeginswithabriefreviewofparaxialoptics, third-orderaberration theory,andcomputeraided optimization. A survey of refractive optical design forms fromthe landscapelenstothedoublegauss lens isgiven. Telephotoandretrofocuslenses,Petzvalandmicroscopeobjectives,andwideanglelensesarediscussed.Zoomlensprinciplesandfirstorder layoutarepresented in detail with easy to understand examples. Visible bandcolor correction techniques and UV and IR design constraints arediscussed.This full day course also examines the basics of reflective opticalsystemdesign including refractivedesignanalogies, advantagesanddisadvantagesofreflectivesystems,obscuredvs.unobscureddesignforms.ReflectivesystemsrangingfromtheCassegraintothereflectivetriplettothreeandfourmirroranastigmatsarepresented.
LEARNING OUTCOMESThiscoursewillenableyouto:• determinewhichlenstypesaresuitableforvariousapplications• createanewsystemdesignfromscratch• layoutazoomlensfromfirstprinciples• describereflectivesystemdesignsandconstraints
INTENDED AUDIENCEThiscourseis intendedforopticalengineersandscientistswhohavesomepreviousknowledgeofgeometricaloptics,aberrationtheory,andlensdesignandwhowanttoincreasetheiropticaldesignproficiencythroughabetterunderstandingofthesubject.
INSTRUCTORJulie Bentley is an Associate Professor at The Institute of Optics,University of Rochester and has been teaching two graduate levelcoursesinopticaldesignformorethan10years.ShereceivedherB.S.,M.S., and PhD in Optics from the The Institute of Optics, UniversityofRochester.AftergraduatingshespenttwoyearsatHughesAircraftCo. in California designing optical systems for the defense industryandthentwelveyearsatCorningTropelCorporationinFairport,NewYorkdesigningandmanufacturingprecisionopticalassembliessuchasmicrolithographicinspectionsystems.COURSE PRICE INCLUDES the text Modern Lens Design, 2nd edition(SPIE/McGraw-Hill,2004)byWarrenJ.Smith.ThiscourseisananaloguetoWarrenSmith’slong-runningcourseSC006,ModernLensDesign.
Basic Optics for EngineersSC156Course level: IntroductoryCEU .65 $565 / $680 USD Tuesday 8:30 am to 5:30 pm
This course introduces each of the following basic areas of optics,fromanengineeringpointof view:geometrical optics, imagequality,flux transfer, sources, detectors, and lasers. Basic calculations andconceptsareemphasized.
LEARNING OUTCOMESThiscoursewillenableyouto:• computethefollowingimageproperties:size,location,fidelity,
brightness• estimatediffraction-limitedimagingperformance• explainopticaldiagrams• describethefactorsthataffectfluxtransferefficiency,andtheir
quantitativedescription• computethespectraldistributionofasource• describethedifferencebetweenphotonandthermaldetectors• calculatethesignaltonoiseperformanceofasensor(D*andnoise
equivalentpower)• differentiatebetweensensitivityandresponsivity• explainthemainfactorsoflaserbeams:monochromaticity,
collimation,andpropagation
INTENDED AUDIENCEThisclass is intended forengineers, technicians,andmanagerswhoneedtounderstandandapplybasicopticsconceptsintheirwork.Thebasics in each of the areas are covered, and are intended for thosewith little or no prior background in optics, or for those who need afundamentalrefreshercourse.
INSTRUCTORGlenn Boreman is the Chairman of the Department of Physics andOptical Science at the University of North Carolina at Charlotte. HereceivedaBSinOpticsfromRochesterandPhDinOpticsfromArizona.Prof.BoremanservedonthefacultyofUniversityofCentralFloridafor27years,with23PhDstudentssupervisedtocompletion.Hisresearchinterestsareininfrareddetectors,infraredmetamaterials,andelectro-opticalsensingsystems.Prof.BoremanisaFellowofSPIE,OSA,andtheMilitarySensingSymposium.COURSEPRICEINCLUDESthetext Basic Electro-Optics for Electrical Engineers(SPIEPress,1998)byGlennD.Boreman.Thiscourseisalsoavailableinonlineformat.
214 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Courses
Thin Film Optical CoatingsSC321Course level: IntermediateCEU .65 $525 / $640 USD Monday 8:30 am to 5:30 pm
Virtually no modern optical system could operate without opticalcoatings. Much of any optical system consists of a series of coatedandshapedsurfaces.Theshapedeterminesthepowerofthesurfacebutitisthecoatingthatdeterminesthespecularproperties,theamountoflighttransmittedorreflected,thephasechange,theemittance,thecolor, thepolarization, the retardation, includingeven themechanicalproperties. Optical coatings consist of assemblies of thin films ofmaterials where interference properties combine with the intrinsicpropertiesofthematerialstoyieldthedesiredopticalperformance.Theyacttoreducethereflectancelossesoflenses,increasethereflectanceof mirrors, reduce glare and electromagnetic emission from displaysystems,improvethethermalinsulationofbuildings,protecteyesfromlaser radiation, analyze gases, act as anticounterfeiting devices onbanknotes,multiplexordemultiplexcommunicationsignals,separateorcombinecolorchannels indisplayprojectors,andtheseare justafew of their roles. This course emphasizes understanding and takesstudentsfromfundamentalstotechniquesfordesignandmanufacture.
LEARNING OUTCOMESThiscoursewillenableyouto:• understandthebasicprinciplesofopticalinterferencecoatings• performmanyrapiddesigncalculationsandassessmentswithout
needingacomputer• speakknowledgeablyabouttheparametersthatcharacterizeoptical
coatings• designsimplecoatingsgivenasuitablyequippedcomputer• knowtheadvantagesanddisadvantagesofthebasicprocessesfor
theproductionofthesefilters• understandtheinfluenceoferrorsinmonitoringandestimate
tolerancesinproduction
INTENDED AUDIENCEAnyone who is or wishes to become involved in the manufacture oruseofopticalcoatingsorwhowantstoknowmoreaboutthisrapidlygrowingandimportantfield.Thelevelisappropriateforsomeonewhohascompletedhighschoolmathematicsand/orscience.
INSTRUCTORH. Angus MacleodisPresidentofThinFilmCenter,asoftware,trainingandconsultingcompanyinopticalcoatings,andisProfessorEmeritusofOpticalSciencesat theUniversityofArizona.Hehasbeendeeplyinvolvedinopticalcoatingsforoverfortyyears.
Infrared Systems - Technology & DesignSC835Course level: AdvancedCEU 1.30 $1145 / $1400 USD Monday-Tuesday 8:30 am to 5:30 pm
This course covers the range of topics necessary to understand thetheoretical principles of modern infrared-technology. It combinesnumerous engineering disciplines necessary for the development ofinfrared systems. Practical engineering calculations are highlighted,withexamplesoftradestudiesillustratingtheinterrelationshipsamongthevarioushardwarecharacteristics.Thiscourseiscomprisedoffoursections:Section1introducesthegeometricalopticsconceptsincludingimageformation,stopsandpupils,thicklensesandlenscombinations,imagequality,andthepropertiesofinfraredmaterials.
Section 2 covers the essentials of radiometry necessary for thequantitative understanding of infrared signatures and flux transfer.These concepts are then developed and applied to flux-transfercalculations for blackbody, graybody, and selective radiator sources.Remotetemperaturecalibrationsandmeasurementsarethenusedasanillustrationoftheseradiometricprinciples.Section 3 is devoted to fundamental background issues for opticaldetection-processes. It compares the characteristics of cooled anduncooled detectors with an emphasis on spectral and blackbodyresponsivity,detectivity(D*),aswellasthenoisemechanismsrelatedtoopticaldetection.Thedetectorparametersandcapabilitiesofsingledetectorsandthirdgenerationfocalplanearrays(FPAs)areanalyzed.Withthisacquiredbackground,Section4considersthesystems-designaspectsofinfraredimagers.Theimpactofscanformatonsignal-to-noiseratio isdescribed,andtheengineeringtradeoffs inherent inthedevelopmentofinfraredsearchandtrack(IRST)systemsareexplained.Figures of merit such as MTF, NETD, and MRTD of staring arraysare examined for the performance metrics of thermal sensitivity andspatialresolutionofthermalimagingsystems(TIS).ContrastthresholdfunctionsbasedonJohnsonandvisiblecycles (oftendenotedasN-andV-cycles)arespecified. The interrelationshipsamongthedesignparametersareidentifiedthroughtrade-studyexamples.
LEARNING OUTCOMESThiscoursewillenableyouto:• learntheprinciplesandfundamentalsofinfraredopticaldesign• choosetheproperinfraredmaterialssuiteforyourapplications• quicklyexecuteflux-transfercalculations• calibrateinfraredsourcesandtargetsignatures• recognizetheimportanceofbackgroundinthermalsignatures• haveanappreciationforthecapacityofinfraredsystemsandlearn
theinteractionofitscriticalcomponents(optics,detectors,andelectronics)intheproductionofafinalinfraredimage
• assesstheinfluenceofnoisemechanismsrelatedtoopticaldetection
• comprehendthefundamentalresponsemechanismsanddifferencesbetweencooledanduncooledsingledetectorsaswellasfocalplanearrays(FPAs)
• comprehendthecentraltheorybehindthirdgenerationinfraredimagers
• defineandusecommondescriptorsfordetectorandsystemperformance(R,D*,NEP,NEI,MTF,NETD,andMRTD)
• estimatesystemperformancegivensubsystemandcomponentspecifications
• applydesigntradeoffsinbothinfraredsearchandtracksystems(IRST)andthermal-imagingsystems(TIS)
• carryoutthepreliminarydesignofinfraredsystemsfordifferentthermalapplications
INTENDED AUDIENCEThiscourseisdirectedtothepracticingengineersand/orscientistswhorequireboththeoreticalandeffectivepracticaltechnicalinformationtodesign,build,and/ortestinfraredsystemsinawidevarietyofthermalapplications. A background at the bachelor’s level in engineeringis highly recommended. The participant should also have ampleunderstandingofFourieranalysisandrandomprocesses.
INSTRUCTORArnold Daniels is a senior lead engineer with extensive experiencein theconceptualdefinitionofadvance infrared,optical, andelectro-optical systems. His background consists of technical contributionsto applications for infrared search& track, thermal imaging, and ISRsystems.Othertechnicalexpertiseincludeinfraredradiometry(testingandmeasurements),infraredtestsystems(i.e.,MTF,NETD,andMRTD),thermographicnondestructivetesting(TNDT),opticaldesign,precisionopticalalignment,straylightanalysis,adaptiveoptics,Fourieranalysis,imageprocessing,anddataacquisitionsystems.HeearnedanM.S.inElectricalEngineeringfromtheUniversityofTel-AvivandadoctorateinElectro-OpticsfromtheSchoolofOptics(CREOL)attheUniversityofCentralFlorida.In1995hereceivedtheRudolfKingslakemedalandprizeforthemostnoteworthyoriginalpapertoappearinSPIE’sJournalofOpticalEngineering.Heispresentlydevelopingdirectenergylaserweaponsystemsfordefenseapplications.
spie.org/opadvance · TEL:+13606763290 · help@spie.org 215
Courses
COURSE PRICE INCLUDES the Field Guide to Infrared Systems, Detectors, and FPAs, 2nd EditionbyArnoldDaniels (SPIE,2010)and Infrared Detectors and Systems (Wiley,1996)byEustaceL.DereniakandGlennD.Boreman.
Non-Imaging OpticsSC388Course level: IntroductoryCEU .35 $300 / $355 USD Monday 1:30 to 5:30 pm
Nonimaging optics departs from the methods of traditional opticaldesignbyinsteaddevelopingtechniquesformaximizingthecollectingpower of illumination elements and systems. Nonimaging designsexceedtheconcentrationattainablewith focusing techniques by factors of four or more and approachthe theoretical limit (ideal concentrators). This course develops theconceptual foundations and is an excellent companion to Dr. DavidJenkins’coursewhichemphasizesapplications.
LEARNING OUTCOMESThiscoursewillenableyouto:• formulatethelimittolightcollectionposedbyaparticular
application• distinguishbetweenimagingandnonimagingsolutions• classifythenonimagingalgorithms• solvethenonimagingprobleminparticularcontexts• computespecificnonimagingdesigns• estimatetheperformanceofanonimagingdesign• comparetherelativeperformanceofnonimagingandimaging
designs• identifytheapplicationofnonimagingdesignsinavarietyof
applications
INTENDED AUDIENCEThecourseisdesignedforopticaldesigners,engineers,andscientistswhose work encounters demanding problems of light collection orillumination. The course is self-contained. No specialized technicalbackgroundrequired.
INSTRUCTORRoland WinstonisProfessor,AboveScaleintheSchoolsofEngineering&NaturalScience,UniversityofCalifornia,Merced;andDirector,UCSolar comprising five University of California campuses: Berkeley,Santa Barbara, Davis, San Diego and Merced. He founded the fieldofnonimagingopticsand,workingwithstudentsandcolleagues,hasapplied it toavarietyofproblems in radiationdetection, illumination,andsolarenergyconcentration.Heauthored,withJ.C.MinanoandP.Benitez,thetext Nonimaging Optics(Elsevier-AcademicPress,2005).
Radiometry RevealedSC915Course level: IntroductoryCEU .35 $300 / $355 USD Wednesday 8:30 am to 12:30 pm
This course explains basic principles and applications of radiometryand photometry. A primary goal of the course is to reveal the logic,systematic order, and methodology behind what sometimes appearstobeaconfusingbranchofopticalscienceandengineering.Examplesaretakenfromtheultravioletthroughthelong-waveinfraredportionsoftheelectromagneticspectrum.Anyonewhowantstoanswerquestionssuchas,“howmanywattsorphotonsdoIhave?”or“howmuchopticalenergyorradiationdoIneed?”willbenefitfromtakingthiscourse.
LEARNING OUTCOMESThiscoursewillenableyouto:• describethefundamentalunitsandquantitiesusedtoquantify
electromagneticradiationatwavelengthsfromtheultravioletthroughthevisibleandinfrared
• use,understand,andconvertbetweenradiometricandphotometricquantities
• applyradiometrytotypicalapplications,suchascalibratinganimagingsystem,determininghuman-perceivedbrightnessofadisplay,orcalculatingelectricityproducedbyasolarcell
• calculateareasandsolidanglestodeterminetheenergy,energydensity,orbrightnessinanopticalsystem
• explaintheroleofrays,stops,andpupilsindefiningthefieldofviewandlight-gatheringcapabilityofanopticalsystem
• determinethethroughputofanopticalsystemanduseitinradiometriccalculations
• quantifytheradiantenergyinopticalimagesfrompointandextendedsources
• transferradiantenergyintoandthroughoutopticalsystems• identifyradiometricstandardsandcalibrationmethods• befamiliarwithradiometersandphotometers
INTENDED AUDIENCEScientists, engineers, technicians, or technical managers who wishtolearnmoreabouthowtoquantifyradiantenergyinopticalsystemsandmeasurements.Undergraduate training inengineeringorscienceisassumed.
INSTRUCTORJoseph Shaw is Director of the Optical Technology Center andProfessor of Electrical Engineering and Physics at Montana StateUniversity inBozeman,Montana.Hepreviouslyworkedat theNOAAresearchlabsinBoulder,Colorado.Heisawidelyrecognizedexpertinthedevelopment,calibration,andanalysisofopticalsystemsused inenvironmentalandmilitarysensing.RecognitionforhisworkinthisfieldincludesNOAAresearchawards,aPresidentialEarlyCareerAwardforScientistsandEngineers,andtheWorldMeteorologicalOrganization’sVaisalaPrize.HeearnedaPh.D.inOpticalSciencesattheUniversityofArizonaandisaFellowofboththeOSAandSPIE.
Understanding Diffractive OpticsSC1071 NEWCourse level: IntroductoryCEU .35 $335 / $390 USD Sunday 1:30 to 5:30 pm
Thefirstportionofthecoursewillcoverthefundamentalprinciplesofdiffractionphenomena.Qualitativeexplanationofdiffractionbytheuseoffielddistributionsandgraphswillprovidethebasisforunderstandingthe fundamental relations and the important trends. Attendees willalsolearntheimportantterminologyemployedinthefieldofdiffractiveoptics.Next, the instructor will provide a comprehensive overview of themain typesofdiffractiveopticalcomponents, includingphaseplates,diffraction gratings, binary optics, diffractive kinoforms, holographicoptical elements, and photonic crystals. Finally, based on practicalexamplesprovidedbytheinstructor,attendeeswilllearnhowmodernoptical andphotonics instrumentationcanbenefit from incorporatingdiffractiveopticalcomponents.
216 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Courses
LEARNING OUTCOMESThiscoursewillenableyouto:• acquirethefundamentalsofdiffraction,FresnelandFraunhofer
diffraction,theTalboteffect,apodization,diffractionbymultipleapertures,andsuperresolutionphenomena
• becomefamiliarwithterminologyinthefieldofdiffractiveoptics,• gainanoverviewofthemainfabricationtechniques• describetheoperationalprinciplesofthemajortypesofdiffractive
opticalcomponentsinthescalarandtheresonantdomains,diffractionefficiency,andtheblazingcondition
• getanoverviewofthevariousfunctionsperformedbydiffractiveopticscomponentsinopticalsystems
• comparethebenefitsandlimitationsofdiffractivecomponents
INTENDED AUDIENCEThismaterialisintendedforengineers,scientists,collegestudents,andphotonicsenthusiastswhowouldliketobroadentheirknowledgeandunderstandingofdiffractiveoptics, aswell as to learn thenumerouspractical applications of diffractive optical components in modernopticalinstruments.
INSTRUCTORYakov Soskind is the Principal Systems Engineer with DHPCTechnologies in Woodbridge, NJ. He has been involved in opticalsystems’designanddevelopmentforover30years.Dr.Soskindhasbeenawardedmore than20domesticand internationalpatents,andhasauthoredandco-authoredseveralpublications.HisFieldGuidetoDiffractiveOpticswasrecentlypublishedbySPIEPress(2011).COURSEPRICEINCLUDESthe Field Guide to Diffractive Optics,FG21(SPIEPress,2011)byYakovSoskind.
Principles of Fourier Optics and DiffractionSC017Course level: IntermediateCEU .65 $630 / $745 USD Tuesday 8:30 am to 5:30 pm
Thiscourse introduces theapplicationofFourier theory indiffractionandimageformation.Thefirstpartofthecourseprovidesareviewofanumberofmathematicaltopics,includingconvolutionandtheFouriertransform.Next,thephenomenonofdiffractionisintroduced,theeffectsoflensesondiffractionarediscussed,andthepropagationofGaussianbeamsistreated.Finally,theeffectsofdiffractionontheperformanceofimage-formingsystemsandotheropticaldevicesarediscussed.
LEARNING OUTCOMESThiscoursewillenableyouto:• understandconvolutionandFouriertransformoperations• describethegeneraleffectsofdiffractionintheFresneland
Fraunhoferregions• understandtheeffectsoflensesondiffraction• predicttheFraunhoferdiffractionpatternsassociatedwithspecific
apertures• describethepropagationofGaussianbeams• understandtheeffectsofdiffractiononimageformationandimage
resolution• calculatethePoint-SpreadFunctions(PSF)andOpticalTransfer
Functions(OTF)forvariousimagingsystems
INTENDED AUDIENCEThis course is intended for scientists and engineers who need tounderstand the diffraction of optical wavefields and the effects ofdiffraction on the performance of image-forming systems and otheropticaldevices.
INSTRUCTORJack GaskillisProfessorEmeritusofOpticalSciencesattheUniversityofArizonawhere,formorethan30years,histeachingactivitiesweredevotedprimarilytotheapplicationsofFouriertheoryinoptics.Hehastaughtmore than40off-campusshort courses inFourier opticsandrelated subjects. Gaskill is author of the textbook, Linear Systems, Fourier Transforms, and Optics (Wiley,1978),and isaPastPresidentofSPIE.COURSE PRICE INCLUDES the text Linear Systems, Fourier Transforms, and Optics(Wiley,1978)byJackD.Gaskill.
Modeling and Simulation with Computational Fourier OpticsSC1080 NEWCourse level: IntermediateCEU .65 $525 / $640 USD Wednesday 8:30 am to 5:30 pm
Thiscourseexplains the implementationofFourieroptics theoryandconceptsonthecomputer.Aprimaryobjectiveistoprovideattendeeswith the capability of programming their own basic wave (physical)optics simulations to model diffraction, beam propagation, lenses,gratings, and imaging.Thecourse includesa short reviewofFourieropticstheory,detailsofapplyingthefastFouriertransform(FFT),andapproachesforimplementingavarietyofwaveopticssimulations.Themethodsdiscussedcanbeappliedintechnicalsoftwareenvironmentssuch as MATLAB, Mathcad, IDL and C. Examples are presentedprimarilyinMATLABbutimplementationinotherenvironmentsisalsodiscussed.
LEARNING OUTCOMESThiscoursewillenableyouto:• modelsimplephysicalstructureswithalimitedsetofbasicanalytic
functions• choosetheparametersformodeling2-Dspatialandspectral
functionsonthecomputeranddeterminethescalingconstantsinvolvedwiththeuseoftheFFT
• modelopticalwaveswithcomplexexponentialnotation• createanopticalpropagation/diffractioncomputersimulation• buildwaveopticscomputermodelsoflensesandgratings• createimagesimulationsthatincludediffractionandaberrations
INTENDED AUDIENCEEngineersandscientistswhowishtolearnthedetailsofimplementingFourieropticstheoryonthecomputerandhowtocreatetheirownwaveopticssimulations.Also,anyonewhoislookingforaconcisereviewofFourier optical theory fromadifferent andpractical perspective. It issuggestedthatattendeeshaveabasicfamiliaritywithFourieroptics.
INSTRUCTORDavid Voelz is a professor of electrical engineering at New MexicoStateUniversityandholdsaPaulW.andValerieKlipschProfessorship.He received his Ph.D. degree in EE from the University of Illinoisin 1987. From 1986 to 2001 he worked as a research engineer andprojectmanagerattheAirForceResearchLaboratoryinAlbuquerque,NM. He was named a Fellow of SPIE in 1999 and has received anOSA Engineering Excellence Award, the Bromilow Award at NMSUfor research excellence, and the Giller Award at AFRL for technicalachievement. His research interests always seem to involve someaspectofFourieropticsandincludespectralandpolarimetricimaging,laser imaging and beam projection, laser communication, adaptiveoptics,andastronomicalinstrumentationdevelopment.COURSEPRICEINCLUDESthetextComputational Fourier Optics, A MATLAB Tutorial(SPIEPress,2011)byDavidVoelz.Attendeesarewelcometobringalaptopwithcomputationalsoftwaretothecoursetoexploresomeoftheconcepts.However,acomputerisnotrequiredforthelearningexperience.
spie.org/opadvance · TEL:+13606763290 · help@spie.org 217
Courses
Optical Scatter Metrology for IndustrySC1003Course level: IntermediateCEU .35 $360 / $415 USD Monday 1:30 to 5:30 pm
Optical scatter, originally used almost exclusively to characterize thestraylightgeneratedbyopticallysmoothsurfaces,isnowbeingusedasasensitive,economicalwaytomonitorthesurfacetexturerequirementsinavarietyofindustries.Forexample,thephoto-voltaicindustryusesspecifictypesoftextureonsurfacestoincreaseabsorptionandsystemefficiency. Texture is often an important requirement for the metalproducing industry and it changeswith rollwear. Theappearanceofevery day appliances (from door hinges to computer cases) variesdramaticallywith texture. Thequalityof flatpaneldisplaysdependsonthescattercharacteristicsofthescreenandcomponentsbehindit.SEMIandASTMarerespondingtothenewapplicationswith“scatterstandards” to help communication between manufacturers, vendorsandcustomers.Thelowsignal(hardtomeasure)opticalapplicationsweresolvedfirstbecause the math was easy. Rougher surface scatter relationshipsare more complicated, but the signals are much larger - makinginstrumentationeasier.Thecoursestartswiththeopticalapplicationsandthenexploresthetransitiontorougherindustrysurfaces.Betweenagoodopticalmirrorandaconcretesidewalktherearethousandsofindustrysurfacesthatcanbemonitoredwithscattermetrology.Thereare twokeypoints for these “in-between” surfaces: (1) If the texturechanges - the scatter changes and (2) these changes (and productfunction)cannotbeadequatelymonitoredbyasinglevariable-suchasRMSRoughness,HazeorGloss.Thecourseemphasizesquantifying,measuring and understanding scatter. The modeling of scatter ismentioned,butisnotemphasizedhere.
LEARNING OUTCOMESThiscoursewillenableyouto:• quantifyandanalyzescatterintermsofBRDF,TIS,HazeandDSC
units• explaintheinstrumentationforobtainingscatterdataandevaluate
systemcalibration• describeandovercomethevariousdifficultiesincomparing
roughnessstatisticsfoundfromprofilometersandscatterometersforbothone-andtwo-dimensionalsamples
• convertscattertoroughnessstatisticswhenpossibleandunderstandwhenitisnotpossible
• evaluatetheuseofscattermeasurementforspecificapplicationssuchas:straysystemradiation,surfacemicro-roughness,particulatesizing,backgroundsensornoise
• explaintheuseofpolystyrenelatexspheredepositionsasanopticalscatteringstandard
• reviewscatteringstandardsforthesemiconductorandphoto-voltaicindustries
INTENDED AUDIENCEEngineers, scientists, and managers who need to understand andapply thebasicconceptsofscattermetrology to laboratory researchandindustrialprocesscontrol.Someknowledgeofcalculusishelpful,but thecoursedoesnot require that thestudent followmathematicalderivations. The instructor has worked with Thomas Germer (SC492instructor)toavoidoverlapbetweenthetwocourses.
INSTRUCTORJohn Stover is President of The Scatter Works, Inc., a Tucson firmconcentratingonscatterbasedmetrologystandards,consulting,andmeasurementas theyapply todiverse industries.Hehas researchedlight scatter related problems for over 30 years and led teams ofengineers who developed state-of-the-art scatterometers, verifiedtheoretical relationship between surface roughness and scatter andcharacterizedsurfacedefectstoimprovewafermetrology.Hehasbeeninvolvedwithinternationalstandardsorganizationsforover20years,isanSPIEFellow,andhasbeenactiveasanauthor,conferencechairman,andeditor,andhasoveronehundredpublications.COURSEPRICEINCLUDESthetext Optical Scattering: Measurement and Analysis, 2nd Edition(SPIEPress,1995)byJohnStover.
Predicting, Modeling, and Interpreting Light Scattered by SurfacesSC492Course level: IntermediateCEU .35 $300 / $355 USD Tuesday 1:30 to 5:30 pm
Themeasurementoflightscatteredbysurfacescanbeusedtolocateand identify roughness, particulates, and defects on a wide varietyof materials. Applications include the inspection of silicon wafers,optics, and storage media, characterization of thin film roughness,identification of objects in remote sensing, and prediction of opticalsystem performance. The aim of this course is to provide tools toengineers and scientists to enable them to predict scattering fordifferentsources,differentiateamongstdifferentscatteringsources,andto design instrumentation that maximizes sensitivity or differentiationamongstscatteringsourcesfortheirspecificapplication.EmphasiswillbeplacedontheuseoftheSCATMECHlibraryofscatteringcodesandthe Modeled Integrated Scatter Tool (MIST) in order to minimize themathematicsthatcanoftenbeabarriertothosewhowouldotherwisebe interested inusingopticalscatter. Themeasurementofscatter isemphasizedinSC020taughtbyJohnStover.
LEARNING OUTCOMESThiscoursewillenableyouto:• quantifyscatterintermsofintensityandpolarizationproperties• identifylikelysourcesofscatterfromamaterialorthinfilm• predictscatterfromspecificscattersources:roughness,particles,
andsubsurfacedefects• designexperimentsthatdifferentiateamongscatteringsources• useMISTtoevaluateorvisualizeopticalscatterinavarietyof
applications.• definethelimitationsoflightscattering
INTENDED AUDIENCEThiscourseisintendedforscientistsandengineerswhoareinterestedinmodeling,predicting,andinterpretinglightscatterfromsurfacesformaterialinspection,opticaldesign,orremotesensingapplications.TheinstructorhasdesignedthecoursetocomplementSC1003,workinginconjunctionwithSC1003’sinstructorJohnStovertocoordinatethematerial.
INSTRUCTORThomas Germer is a physicist specializing in measurements andmodelingoftheopticalpropertiesofmaterialsattheNationalInstituteofStandardsandTechnologyinGaithersburg,Maryland.Hehaspublishedover one hundred technical papers, covering topics of electron andultrafasttime-resolvedsurfacespectroscopy,diffuseopticalscatteringfrom particles, roughness, and defects near surfaces and thin films,polarimetry,criticaldimensionmetrologybygratingscatterometry,andbiomedical optics. He is thedeveloperof theSCATMECH libraryoflightscatteringcodesandtheassociatedMISTprogram.Dr.GermerreceivedaB.A.fromtheUniversityofCalifornia,Berkeley,andaM.S.andPh.D.fromCornellUniversity,andisaFellowofSPIE.Following the course, attendees will be provided with an electroniccopyofthepublicdomainSCATMECHlibrary,theMISTprogram,andalloftheexampleprogramsdiscussedintheclass.
218 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Courses
Optomechanics and Tolerancing of InstrumentsSC221Course level: AdvancedCEU .65 $525 / $640 USD Monday 8:30 am to 5:30 pm
Thiscourseteachesmechanicalengineersanddesignershowtoidentifyandevaluatethefeaturesinamechanicaldesignthatmaycontributetoimagemotion(registrationerrors)atthedetector.Registrationerrorsmaycauseanotherwisesharpimagetoappearblurred(focusingerror)and for even sharp images tobe in thewrongplace (trackingerror).Registration errors are controlled by the optomechanical constraintequations that relate all the motions of all the elements in a systemtotheposition,orientationandsizeofthe imageatthedetector.Thestudentsaretaughttodeveloptheoptomechanicalconstraintequationsfrom the optical imaging laws and to use them to specify alignmentrequirements, calculate thermal sensitivity and distribute dimensionaltolerancesinopticalmeteringstructure.
LEARNING OUTCOMESThiscoursewillenableyouto:• developtheoptomechanicalconstraintequationsfromtheoptical
imaginglaws• determinetherelativeaccuracyoflinearandnonlinearsolutions• adjustmanufacturingtolerancestominimizeimageregistration
errors• specifythestrokeandresolutionrequiredofalignmentmechanisms• estimatethethermalstabilityofopticalsystems• developbudgetsforopticalelementmotionsininstrumentsand
systems.
INTENDED AUDIENCEThiscourseisintendedformechanicalengineerswhoconceive,designand analyze optical instruments. The results may be easily used byanyonewithagraspofopticalimagingprinciples.
INSTRUCTORAlson Hatheway is amechanical engineerandpresidentofhisowncompany.Hehasoverthirtyyearsexperienceindesigning,analyzingand building new optical and photonic products. He has authored44technicalpapers,presentedthreedifferenttutorialsandholdsfourpatents. He is a fellow of SPIE, a founder of the Optomechanical/InstrumentTechnicalGroupandcurrentlyitschairman.
Cost-Conscious Tolerancing of Optical SystemsSC947Course level: IntroductoryCEU .65 $525 / $640 USD Tuesday 8:30 am to 5:30 pm
Thepurposeofthiscourseistopresentconcepts,tools,andmethodsthat will help attendees determine optimal tolerances for opto-mechanicalsystemsinopticalapplications.Detailedtopicsinthecourseapplytoallvolumesofsystemsbeingdeveloped-fromsinglesystemstomillionsofunits.Theimportanceoftolerancingthroughoutthedesignprocessisdiscussedindetail,includingdeterminingrobustnessofthespecification and design for manufacture and operation. The coursealsoprovidesa background to effective tolerancingwithdiscussionsonvariabilityandrelevantappliedstatistics.Atreatmentofthird-orderabberationsisincluded,withemphasisonunderstandingtheiroriginsand how to influence cost and production yield by considering theirimpacts.Toleranceanalysisandassignmentwithstrongmethodologyand examples are discussed, including the development of a designtrade forasimple IRsystem.Referencesandexamplesare includedtohelp researchers,designers,engineers,and technicianspracticallyapply the concepts to plan, design, engineer, and build high-qualitycost-competitiveopticalsystems.
LEARNING OUTCOMESThiscoursewillenableyouto:• identifykeysystemrequirementsfortolerancing• developinsightintocostandsensitivityfactorsearlyinthedesign
process• definevariabilityandcomprehenditsimpactonnominalsystems• utilizefundamentalappliedstatisticsintolerancing• constructtoleranceanalysisbudgets• performdetailedtoleranceanalysis• summarizedifferentdesignofexperimentandstatisticalprocess
controlstrategies
INTENDED AUDIENCEThismaterial is intendedformanagers,engineers,andtechnicalstaffinvolvedinproductdesignfromconceptthroughmanufacturing.
INSTRUCTORSRichard Youngworth isFounderandChiefEngineerofRiyoLLC,anopticaldesignandengineeringfirmprovidingengineeringandproductdevelopmentservices.His industrialexperiencespansdiverse topicsincluding optical metrology, design, manufacturing, and analysis. Dr.Youngworth has spent significant time working on optical systemsin the challenging transition from ideal design to successful volumemanufacturing.Heiswidelyconsideredanexpert,duetohisresearch,lectures,publications,andindustrialworkonthedesign,producibility,and tolerance analysis of optical components and systems. Dr.Youngworth teaches “Practical Optical System Design” and “Cost-ConsciousTolerancingofOpticalSystems”forSPIE.HehasaB.S.inelectricalengineering fromtheUniversityofColoradoatBoulderandearnedhisPh.D.inopticsattheUniversityofRochesterbyresearchingtoleranceanalysisofopticalsystems.James Contreras isaPrincipalOpticalEngineeratBallAerospace&Technologies Corp. in Boulder, CO, where he provide optical designsupport to a variety of proposals and projects. He has extensiveexperience in the design, analysis and fabrication of reflective andrefractive optical systems for a variety of applications ranging frommilitaryplatforms to theJamesWebbSpaceTelescope. Hisprimaryexpertise is in reflective and IR optical design specializing in designformanufacturability.He isactively involved in teachingforSPIEandmentoring junior engineers. He was trained in Physics at RensselaerPolytechnic Institute (B.S.) and the Georgia Institute of Technology(M.S.);themajorityofhiscareerhasbeeninthedefenseandaerospaceindustry.
Introduction to Optical Alignment TechniquesSC010Course level: IntroductoryCEU 1.30 $1000 / $1255 USD Monday-Tuesday 8:30 am to 5:30 pm
This course discusses the equipment, techniques, tricks, and skillsnecessary toalignopticalsystemsanddevices.You learn to identifyerrorsinanopticalsystem,andhowtoalignlenssystems.
LEARNING OUTCOMESThiscoursewillenableyouto:• determineiferrorsintheopticalsystemareduetomisalignment
errorsorotherfactorssuchasfabrication,design,ormountingproblems
• recognizeandunderstandthefundamentalimagingerrorsassociatedwithopticalsystems
• diagnose(qualitativelyandquantitively)whatiswrongwithanopticalsystembysimplyobservingthesefundamentalimagingerrors
• usethevarietyoftoolsavailableforaligningopticalsystems,andmoreimportantly,howto“tweak”logicallytheadjustmentsonthesedevicessothatthealignmentproceedsquicklyandefficiently
• alignbasiclenssystemsandtelescopes
spie.org/opadvance · TEL:+13606763290 · help@spie.org 219
Courses
• alignmorecomplexopticalsystemssuchasthosecontainingoff-axisasphericsurfaces,andmaintainalignmentusingautomaticmountingtechniques
INTENDED AUDIENCEThis course is directed toward engineers and technicians needingbasic practical information and techniques to achieve alignment ofsimple optical systems, as well as seemingly more complicated off-axisasphericmirrors.Tobenefitmost fromthiscourseyouwillneedabasicknowledgeoftheelementarypropertiesof lensesandopticalsystems(i.e.focallengths,f/numbers,magnification,andotherimagingproperties) and a working knowledge of simple interferometry. Somefamiliarity with the basic aberrations such as spherical aberration,coma,andastigmatismwillbehelpful.
INSTRUCTORMitchell Ruda Ph.D., is president of Ruda-Cardinal, Inc., an opticalengineeringconsultingfirm,locatedinTucson,Arizona.HeisafellowofSPIE.
Introduction to Optical Remote Sensing SystemsSC567Course level: IntroductoryCEU .35 $300 / $355 USD Wednesday 1:30 to 5:30 pm
This course provides a broad introduction to optical remote sensingsystems,includingbothpassivesensors(e.g.,radiometersandspectralimagers) and active sensors (e.g., laser radars or LIDARs). A briefreviewofbasicprinciplesofradiometryandatmosphericpropagation(absorption, emission, and scattering) is followed by a system-leveldiscussion of a variety of ground-, air-, and space-based remotesensingsystems.Keyequationsarepresentedforpredictingtheopticalresolution and signal-to-noise performance of passive and activesensing systems. Sensor system examples discussed in the classinclude solar radiometers, passive spectrometers and hyperspectralimagers, airborne imaging spectrometers, thermal infrared imagers,polarizationimagers,andactivelaserradars(LIDARsandLADARs).Thecoursematerialisdirectlyrelevanttosensinginenvironmental,civilian,military,astronomical,andsolarenergyapplications.
LEARNING OUTCOMESThiscoursewillenableyouto:• reviewtheprinciplesofopticalradiometryusedtodescribeand
calculatetheflowofopticalenergyinanopticalsensorsystemorsolarenergysystem
• describehowtheatmosphereaffectsthepropagationofopticalradiation
• explainhowopticalatmosphericeffectsinfluenceremotesensingmeasurementsorsolarenergy
• usesystemparametersinbasicradiometriccalculationstopredictthesignalreceivedbypassiveandactivesensors
• comparesystemsattheblock-diagramlevelremotesensingmeasurements
• explainthedifferencebetweenpassiveimagingbasedonreflectionandemission
• acquiretheoperatingprinciplesoflaserradar(lidar/ladar)systemsfordistributedandsolidtargetsensing
INTENDED AUDIENCEScientists, engineers, technicians, or technical managers who findthemselves working on (or curious about) optical remote sensingsystemsordata.Undergraduate training inengineeringor science isassumed.
INSTRUCTORJoseph Shaw isaprofessorofelectricalengineeringandphysicsatMontanaStateUniversityandpreviouslyworkedattheNOAAresearchlabs.Heisarecognizedexpertindevelopment,calibration,andanalysisofopticaloptical remotesensingsystemsused inenvironmentalandmilitarysensing.Recognition forhiswork in thisfield includesNOAAresearchawards,aPresidentialEarlyCareerAwardforScientistsandEngineers,andtheWorldMeteorologicalOrganization’sVaisalaPrize.HeearnedaPh.D.inOpticalSciencesattheUniversityofArizona.Dr.ShawisaFellowofboththeOSAandSPIE.
Shaping Light, with applications in Advanced Microscopy and Optical TrappingSC1043Course level: IntroductoryCEU .35 $300 / $355 USD Tuesday 1:30 to 5:30 pm
Wavefrontcorrectionandgenerationareimportanttopicsinmanyareas.Thisintroductorycoursewillcover:thebasicGaussianbeam,theneedfor other beams such as: Hermite-Gaussian and Laguerre-Gaussianlasermodes,Besselbeams,Airybeams,andothernotablebeamsandhowtheymaybegenerated.Inaddition,wewillcoversomeapproachesusedforadaptiveoptics/wavefrontcorrection.WewillconsiderusesofDeformableMirrorArrays,SpatialLightModulators,Acousto-OpticDeflectors,etc. Applications includesub-diffraction imaging /super-resolutionmicroscopy,OCT,opticaltrapping,multi-photonmicroscopyatenhanceddepth,andoptimalexcitationofplasmonicstructures.
LEARNING OUTCOMESThiscoursewillenableyouto:• assessavarietyofapproachestobeamshapingandwavefront
correction• explainsimplealignmentprotocolsforoptimizingsomeoptical
beamtypesofbroadinterest• describevariousaspectsofdataanalysisforsomewavefront
correctionalgorithms• identifykeyoptionsforenhanceddegreesofbeamcontrol,
resolution,andsensitivity
INTENDED AUDIENCEThismaterial isappropriate to researcherswhoareconsideringworkinawidevarietyofareaswherewavefrontcorrectionorgenerationofnovelbeamsisofinterest.
INSTRUCTORSKishan Dholakia is a Professor of Physics at the University of St.Andrews(Scotland)andco-ChairoftheConferenceonOpticalTrappingandOpticalMicromanipulation.Gabriel Spalding is a Professor of Physics at Illinois Wesleyanand co-Chair of the Conference on Optical Trapping and OpticalMicromanipulation.
220 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Courses
Basic Optics for Non-Optics PersonnelWS609Course level: IntroductoryCEU .30 $100 / $150 USD Tuesday 1:30 to 4:00 pm
This course will provide the technical manager, sales engineering,marketing staff, or other non-optics personnel with a basic, non-mathematical introduction to the terms, specifications, andconceptsused in optical technology to facilitate effective communication withopticsprofessionalsonafunctionallevel.Topicstobecoveredincludebasicconceptssuchas imaging, interference,diffraction,polarizationandaberrations,definitionsrelatingtocolorandopticalquality,andanoverviewofthebasicmeasuresofopticalperformancesuchasMTFandwavefronterror.Thematerialwillbepresentedwithaminimalamountof math, rather emphasizing working concepts, definitions, rules ofthumb,andvisualinterpretationofspecifications.Specificapplicationswillincludedefiningbasicimagingneedssuchasmagnification,depth-of-field,andMTFaswellasthedefinitionsofradiometricterms.
LEARNING OUTCOMESThiscoursewillenableyouto:• readopticalsystemdescriptionsandpapers• asktherightquestionsaboutopticalcomponentperformance• describebasicopticalspecificationsforlenses,filters,andother
components• assessdifferencesintypesoffilters,mirrorsandbeamdirecting
optics• knowhowopticsisusedinoureverydaylives
INTENDED AUDIENCEThiscourseisintendedforthenon-opticalprofessionalwhoneedstounderstandbasicopticsandinterfacewithopticsprofessionals.
INSTRUCTORKevin Harding has been active in the optics industry for over 30years, and has taught machine vision and optical methods for over25 years in over 70 workshops and tutorials, including engineeringworkshopsonmachinevision,metrology,NDT,andinterferometryusedby vendors and system houses to train their own engineers. He hasbeenrecognizedforhisleadershipinopticsandmachinevisionbytheSocietyofManufacturingEngineers,Automated ImagingAssociation,andEngineeringSocietyofDetroit.KevinisaFellowofSPIEandwasthe2008PresidentoftheSociety.Thiscourseisalsoavailableinonlineformat.
Optomechanics and Optical manufacturing
Introduction to Optical Alignment TechniquesSC010Course level: IntroductoryCEU 1.30 $1000 / $1255 USD Monday-Tuesday 8:30 am to 5:30 pm
This course discusses the equipment, techniques, tricks, and skillsnecessary toalignopticalsystemsanddevices.You learn to identifyerrorsinanopticalsystem,andhowtoalignlenssystems.
LEARNING OUTCOMESThiscoursewillenableyouto:• determineiferrorsintheopticalsystemareduetomisalignment
errorsorotherfactorssuchasfabrication,design,ormountingproblems
• recognizeandunderstandthefundamentalimagingerrorsassociatedwithopticalsystems
• diagnose(qualitativelyandquantitively)whatiswrongwithanopticalsystembysimplyobservingthesefundamentalimagingerrors
• usethevarietyoftoolsavailableforaligningopticalsystems,andmoreimportantly,howto“tweak”logicallytheadjustmentsonthesedevicessothatthealignmentproceedsquicklyandefficiently
• alignbasiclenssystemsandtelescopes• alignmorecomplexopticalsystemssuchasthosecontaining
off-axisasphericsurfaces,andmaintainalignmentusingautomaticmountingtechniques
INTENDED AUDIENCEThis course is directed toward engineers and technicians needingbasic practical information and techniques to achieve alignment ofsimple optical systems, as well as seemingly more complicated off-axisasphericmirrors.Tobenefitmost fromthiscourseyouwillneedabasicknowledgeoftheelementarypropertiesof lensesandopticalsystems(i.e.focallengths,f/numbers,magnification,andotherimagingproperties) and a working knowledge of simple interferometry. Somefamiliarity with the basic aberrations such as spherical aberration,coma,andastigmatismwillbehelpful.
INSTRUCTORMitchell Ruda Ph.D., is president of Ruda-Cardinal, Inc., an opticalengineeringconsultingfirm,locatedinTucson,Arizona.HeisafellowofSPIE.
Introduction to Optomechanical DesignSC014Course level: IntroductoryCEU 1.30 $1000 / $1255 USD Sunday-Monday 8:30 am to 5:30 pm
This course will provide the training needed for the optical engineerto work with the mechanical features of optical systems. Theemphasis is on providing techniques for rapid estimation of opticalsystem performance. Subject matter includes material properties foroptomechanicaldesign,kinematicdesign,athermalizationtechniques,windowdesign,lensandmirrormounting.
LEARNING OUTCOMESThiscoursewillenableyouto:• selectmaterialsforuseinoptomechanicalsystems• determinetheeffectsoftemperaturechangesonopticalsystems,
anddevelopdesignsolutionsforthoseeffects• designhighperformanceopticalwindows• designlowstressmountsforlenses• selectappropriatemountingtechniquesformirrorsandprisms• describedifferentapproachestolargeandlightweightmirrordesign
INTENDED AUDIENCEEngineerswhoneedtosolveoptomechanicaldesignproblems.Opticaldesignerswillfindthatthecoursewillgiveinsightintothemechanicalaspectsofopticalsystems.Thecoursewillalsointerestthosemanagingprojects involving optomechanics. Short course SC001, OpticalSystemDesign:LayoutPrinciplesandPractice,orafirmunderstandingofitscontent,isrequiredasbackgroundtothiscourse.
INSTRUCTORDaniel Vukobratovich is a senior principal engineer at Raytheon.Hehasover20yearsofexperience inoptomechanics, isa foundingmember of the SPIE working group in optomechanics, and is fellowofSPIE.Hehastaughtoptomechanicsin11countries,consultedwithover50companiesandwrittenover50publicationsinoptomechanics.
spie.org/opadvance · TEL:+13606763290 · help@spie.org 221
Courses
Advanced Composite Materials for Optomechanical SystemsSC218Course level: IntermediateCEU .65 $525 / $640 USD Tuesday 8:30 am to 5:30 pm
Advanced composite materials have been used successfully inoptomechanical systems since the 1970s. They are being usedincreasinglyinnumerouscommercialandmilitaryapplicationsincluding:optical benches, telescopes, binoculars, mirrors, metrology andphotolithographyequipment,andotheroptomechanicalsystems,alongwith thermal management and optoelectronic packaging. Numerousand growing numbers of polymer matrix-, metal matrix-, ceramicmatrix- and carbon/carbon composites provide great improvementsin stiffness, strength, dimensional stability, thermal conductivity andcorrosion resistanceoverconventionalmaterialsofconstruction,andareconsiderablylighter.Low-cost,net-shapemanufacturingprocessesmakemanyofthesematerialseconomicallyattractive.
LEARNING OUTCOMESThiscoursewillenableyouto:• acquireterminologyandthebasicpropertiesandcharacteristicsof
thefourclassesofcompositesusedinoptomechanicalsystems• selectappropriatecandidatecompositesandperformdesign
studies• improvethermalandmoisturedimensionalstability• increasestiffness• reduceweight• increaseaccelerationanddeceleration• reducevibrations• reducethermalstressesbymatchingCTEs• increasethermalconductivity• reducethermaldesigncomplexity
INTENDED AUDIENCEThis course is designed for engineers, scientists and managersinvolvedindesignandmanufactureofoptomechanicalandhigh-speedmechanicalsystemsandthermalmanagement.
INSTRUCTORCarl Zwebenanindependentconsultantoncompositesandadvancedthermal management materials, was for many years AdvancedTechnologyManagerandDivisionFellowatGEAstroSpace.Hehasover40years’experienceindevelopmentandapplicationofalltypesof advanced composites in optomechanical systems, dimensionallystablestructures,machinecomponents,electronicandoptoelectronicpackagingandthermalcontrol.HeisaLifeFellowofASME,aFellowofASMandSAMPE,andanAssociateFellowofAIAA.HeisthefirstwinneroftheGEEngineer-of-the-YearandOne-in-a-Thousandawards.Hehastaughtover200compositesandthermalmaterialsshortcourses.
Structural Adhesives for Optical BondingSC015Course level: IntermediateCEU .35 $300 / $355 USD Monday 8:30 am to 12:30 pm
Optomechanicalsystemsrequiresecuremountingofopticalelements.This important aspect of the design can cause a production to stopif sound engineering is not applied. A wide variety of adhesivesare discussed with respect to their relevant properties. Designconsiderations, differing mounting techniques, production concerns,and reliability are reviewed. The instructor gives success and failurecasehistories.
LEARNING OUTCOMESThiscoursewillenableyouto:• understandandclassifyadhesivesandhowtheywork(epoxy,
urethane,silicone,acrylic,RTV,VU-cure,etc.)• identifypropertiesthataffectuse• obtainausersguidetoadhesiveselectionandanadhesiveproperty
matrix• makeoptic-to-mountconsiderations• understandcontamination/outgassing• identifyusesoftesting;witnesssampletesting,pulltests,
outgassingtesting,stressbirefringence,opticalstability
INTENDED AUDIENCEThis course is for engineers, managers, and technicians, this courseprovides a foundation for the correct design for successful opticalmounting; an understanding of the best options to employ for eachapplication,andtheselectionandapproachconducivetoproduction.A bound course outline is provided including summaries of popularadhesivesandtheirproperties.Someadhesivesamplesareavailable.
INSTRUCTORJohn Dalyhasbeenaconsultantforthepast10years.Hehasexperiencein the applications of adhesives to our industry. Daly has more than20yearsofexperienceinacademia,aerospace,medical,commercial,and industrial fields. He has a B.S. in Mechanical Engineering Ph.D.in Applied Physics. His exposure to these areas for applications oflaser,electro-optic,andphotonic technologieshascovered research,development,production,andmanagement.
Cost-Conscious Tolerancing of Optical SystemsSC947Course level: IntroductoryCEU .65 $525 / $640 USD Tuesday 8:30 am to 5:30 pm
Thepurposeofthiscourseistopresentconcepts,tools,andmethodsthat will help attendees determine optimal tolerances for opto-mechanicalsystemsinopticalapplications.Detailedtopicsinthecourseapplytoallvolumesofsystemsbeingdeveloped-fromsinglesystemstomillionsofunits.Theimportanceoftolerancingthroughoutthedesignprocessisdiscussedindetail,includingdeterminingrobustnessofthespecification and design for manufacture and operation. The coursealsoprovides abackground to effective tolerancingwithdiscussionsonvariabilityandrelevantappliedstatistics.Atreatmentofthird-orderabberationsisincluded,withemphasisonunderstandingtheiroriginsand how to influence cost and production yield by considering theirimpacts.Toleranceanalysisandassignmentwithstrongmethodologyand examples are discussed, including the development of a designtrade forasimple IRsystem.Referencesandexamplesare includedtohelp researchers,designers,engineers,and technicianspracticallyapply the concepts to plan, design, engineer, and build high-qualitycost-competitiveopticalsystems.
LEARNING OUTCOMESThiscoursewillenableyouto:• identifykeysystemrequirementsfortolerancing• developinsightintocostandsensitivityfactorsearlyinthedesign
process• definevariabilityandcomprehenditsimpactonnominalsystems• utilizefundamentalappliedstatisticsintolerancing• constructtoleranceanalysisbudgets• performdetailedtoleranceanalysis• summarizedifferentdesignofexperimentandstatisticalprocess
controlstrategies
222 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Courses
INTENDED AUDIENCEThismaterial is intendedformanagers,engineers,andtechnicalstaffinvolvedinproductdesignfromconceptthroughmanufacturing.
INSTRUCTORSRichard Youngworth isFounderandChiefEngineerofRiyoLLC,anopticaldesignandengineeringfirmprovidingengineeringandproductdevelopmentservices.His industrialexperiencespansdiverse topicsincluding optical metrology, design, manufacturing, and analysis. Dr.Youngworth has spent significant time working on optical systemsin the challenging transition from ideal design to successful volumemanufacturing.Heiswidelyconsideredanexpert,duetohisresearch,lectures,publications,andindustrialworkonthedesign,producibility,and tolerance analysis of optical components and systems. Dr.Youngworth teaches “Practical Optical System Design” and “Cost-ConsciousTolerancingofOpticalSystems”forSPIE.HehasaB.S.inelectricalengineering fromtheUniversityofColoradoatBoulderandearnedhisPh.D.inopticsattheUniversityofRochesterbyresearchingtoleranceanalysisofopticalsystems.James Contreras isaPrincipalOpticalEngineeratBallAerospace&Technologies Corp. in Boulder, CO, where he provide optical designsupport to a variety of proposals and projects. He has extensiveexperience in the design, analysis and fabrication of reflective andrefractive optical systems for a variety of applications ranging frommilitaryplatforms to theJamesWebbSpaceTelescope. Hisprimaryexpertise is in reflective and IR optical design specializing in designformanufacturability.He isactively involved in teachingforSPIEandmentoring junior engineers. He was trained in Physics at RensselaerPolytechnic Institute (B.S.) and the Georgia Institute of Technology(M.S.);themajorityofhiscareerhasbeeninthedefenseandaerospaceindustry.
Optomechanics and Tolerancing of InstrumentsSC221Course level: AdvancedCEU .65 $525 / $640 USD Monday 8:30 am to 5:30 pm
Thiscourseteachesmechanicalengineersanddesignershowtoidentifyandevaluatethefeaturesinamechanicaldesignthatmaycontributetoimagemotion(registrationerrors)atthedetector.Registrationerrorsmaycauseanotherwisesharpimagetoappearblurred(focusingerror)and for even sharp images tobe in thewrongplace (trackingerror).Registration errors are controlled by the optomechanical constraintequations that relate all the motions of all the elements in a systemtotheposition,orientationandsizeofthe imageatthedetector.Thestudentsaretaughttodeveloptheoptomechanicalconstraintequationsfrom the optical imaging laws and to use them to specify alignmentrequirements, calculate thermal sensitivity and distribute dimensionaltolerancesinopticalmeteringstructure.
LEARNING OUTCOMESThiscoursewillenableyouto:• developtheoptomechanicalconstraintequationsfromtheoptical
imaginglaws• determinetherelativeaccuracyoflinearandnonlinearsolutions• adjustmanufacturingtolerancestominimizeimageregistration
errors• specifythestrokeandresolutionrequiredofalignmentmechanisms• estimatethethermalstabilityofopticalsystems• developbudgetsforopticalelementmotionsininstrumentsand
systems.
INTENDED AUDIENCEThiscourseisintendedformechanicalengineerswhoconceive,designand analyze optical instruments. The results may be easily used byanyonewithagraspofopticalimagingprinciples.
INSTRUCTORAlson Hatheway is amechanical engineerandpresidentofhisowncompany.Hehasoverthirtyyearsexperienceindesigning,analyzingand building new optical and photonic products. He has authored44technicalpapers,presentedthreedifferenttutorialsandholdsfourpatents. He is a fellow of SPIE, a founder of the Optomechanical/InstrumentTechnicalGroupandcurrentlyitschairman.
Thin Film Optical CoatingsSC321Course level: IntermediateCEU .65 $525 / $640 USD Monday 8:30 am to 5:30 pm
Virtually no modern optical system could operate without opticalcoatings. Much of any optical system consists of a series of coatedandshapedsurfaces.Theshapedeterminesthepowerofthesurfacebutitisthecoatingthatdeterminesthespecularproperties,theamountoflighttransmittedorreflected,thephasechange,theemittance,thecolor, thepolarization, the retardation, includingeven themechanicalproperties. Optical coatings consist of assemblies of thin films ofmaterials where interference properties combine with the intrinsicpropertiesofthematerialstoyieldthedesiredopticalperformance.Theyacttoreducethereflectancelossesoflenses,increasethereflectanceof mirrors, reduce glare and electromagnetic emission from displaysystems,improvethethermalinsulationofbuildings,protecteyesfromlaser radiation, analyze gases, act as anticounterfeiting devices onbanknotes,multiplexordemultiplexcommunicationsignals,separateorcombinecolorchannels indisplayprojectors,andtheseare justafew of their roles. This course emphasizes understanding and takesstudentsfromfundamentalstotechniquesfordesignandmanufacture.
LEARNING OUTCOMESThiscoursewillenableyouto:• understandthebasicprinciplesofopticalinterferencecoatings• performmanyrapiddesigncalculationsandassessmentswithout
needingacomputer• speakknowledgeablyabouttheparametersthatcharacterizeoptical
coatings• designsimplecoatingsgivenasuitablyequippedcomputer• knowtheadvantagesanddisadvantagesofthebasicprocessesfor
theproductionofthesefilters• understandtheinfluenceoferrorsinmonitoringandestimate
tolerancesinproduction
INTENDED AUDIENCEAnyone who is or wishes to become involved in the manufacture oruseofopticalcoatingsorwhowantstoknowmoreaboutthisrapidlygrowingandimportantfield.Thelevelisappropriateforsomeonewhohascompletedhighschoolmathematicsand/orscience.
INSTRUCTORH. Angus MacleodisPresidentofThinFilmCenter,asoftware,trainingandconsultingcompanyinopticalcoatings,andisProfessorEmeritusofOpticalSciencesat theUniversityofArizona.Hehasbeendeeplyinvolvedinopticalcoatingsforoverfortyyears.
spie.org/opadvance · TEL:+13606763290 · help@spie.org 223
Courses
Introduction to Interferometric Optical TestingSC213Course level: IntroductoryCEU .35 $330 / $385 USD Tuesday 8:30 am to 12:30 pm
Thisshortcourseintroducesthefieldofinterferometricopticaltesting.Topics covered include basic interferometers for optical testing, andconceptsofphase-shiftinginterferometryincludingerroranalysis.Longwavelength interferometry,testingofasphericsurfaces,measurementof surface microstructure, and the state-of-the-art of direct phasemeasurementinterferometersarealsodiscussed.
LEARNING OUTCOMESThiscoursewillenableyouto:• explainthebasicconceptsofinterferometricopticaltesting• describethepower,capabilities,andlimitationsofphase-shifting
interferometry• describetechniques,advantages,anddisadvantagesoflong-
wavelengthinterferometry• comparedifferentaspherictestingtechniques• listcapabilitiesandtechniquesformeasuringsurfacemicrostructure• describethecurrentstate-of-the-artofdirectphasemeasurement
interferometers
INTENDED AUDIENCEEngineers,scientists,andmanagerswhoneedtounderstandthebasicconceptsofinterferometricopticaltesting.
INSTRUCTORJames WyantisDeanoftheCollegeofOpticalSciencesandProfessorofOpticalSciencesattheUniversityofArizona.HewasafounderoftheWYKOCorporationandservedasitspresidentfrom1984to1997.Dr.Wyantwasthe1986PresidentofSPIE.
Practical Interferometry and Fringe AnalysisSC211Course level: IntermediateCEU .65 $525 / $640 USD Wednesday 8:30 am to 5:30 pm
You’venodoubtheardofinterferometrictestingandallthewonderfulthingsitcandotosolveyourmeasurementproblems.Youmayhaveattended an introduction to interferometry or been shopping for aninstrument.Buthowdoyougetstarted?Howdoyoudeterminewhichtypeofinterferometerwillsolveyourproblem?Doyoumakeyourownorbuyacommercialinstrument?Onceyou’vegotaninstrumenthowcanyoubesureyoualigneditcorrectlyandaregettingthebestdatayoucanforyourmeasurementproblem?Thisintermediate-levelcourseoffersanoverviewofthefundamentalsof interferometric testing and the analysis of interferometric fringepatterns applicable to many different areas of interferometry, opticaltesting, nondestructive testing, and metrology. It is geared towardstechnicallymindedtypeswhohavehadsomeexposuretothebasicsofinterferometryandwanttofindoutmoreaboutthepracticalnutsandboltsofusinginterferometryasatool.Wewillbeginwithanoverviewof the basic fundamentals of interferometry including formation ofinterference fringes fordifferent typesofsources, fringevisibilityandhowfringesrelatetobasicpropertiesoftheobjectbeingtested.Wethen will cover common interferometer types and phase modulationtechniques, essentials for creating, detecting and digitizing fringes,alignmentandenvironmentalconsiderationsandcalibration.
Throughoutthiscoursereal-worldproblemswillbeusedasexamples.Thesecondhalfoftheclasswillfocusonthesesamequestionsfromthe aspect of fringe analysis techniques. We will outline the basictechniquesand thenbrainstormhowyoudeterminewhetheryougotgooddataandhowyouwouldbegin ifyouwereanalyzingyourownraw fringe data. During this discussion common pitfalls and sourcesoferrorswillbepointedouttohelpstreamlineyourprocessofgettingup and running to take your own measurements. Attendees areencouragedtobringalongtheirreal-worldproblemsandofferthemasstartingpointsforourdiscussion.
LEARNING OUTCOMESThiscoursewillenableyouto:• understandthebasiccomponentsofmonochromatic,narrowband
andwhitelightinterferometers• ensurethatyouarechoosingtherighttypeofinterferometerforyour
application• listthenecessarystepstosetupaninterferometerandtakea
measurement• differentiatetheprosandconsofvariousmeasurementandanalysis
techniques• evaluatethetradeoffsbetweentechniques• outlinesimpleteststodetermineifyouaregettinggood
measurements• helpyoudecidewhichtechniqueisbestforaparticularapplication
INTENDED AUDIENCEThiscourseisforengineersworkingwithopticalinterferometry,opticaltesting, surface metrology, experimental mechanics, nondestructivetesting,andMoiregratingtechniques.Itwillbeassumedthatattendeeshaveabasicknowledgeofgeometricalopticsandinterferometry.
INSTRUCTORKatherine Creath is an internationally recognized expert in opticaltesting, metrology and system design working as a Consultant, aSeniorResearchScientistfor4DTechnologyCorp,andasaResearchProfessorofOpticalSciencesandMedicineattheUniversityofArizona.Shehasmorethan25yearsofexperienceininterferometryandopticaltestingandisaFellowofSPIEandOSA.
remote Sensing
Introduction to Optical Remote Sensing SystemsSC567Course level: IntroductoryCEU .35 $300 / $355 USD Wednesday 1:30 to 5:30 pm
This course provides a broad introduction to optical remote sensingsystems,includingbothpassivesensors(e.g.,radiometersandspectralimagers) and active sensors (e.g., laser radars or LIDARs). A briefreviewofbasicprinciplesofradiometryandatmosphericpropagation(absorption, emission, and scattering) is followed by a system-leveldiscussion of a variety of ground-, air-, and space-based remotesensingsystems.Keyequationsarepresentedforpredictingtheopticalresolution and signal-to-noise performance of passive and activesensing systems. Sensor system examples discussed in the classinclude solar radiometers, passive spectrometers and hyperspectralimagers, airborne imaging spectrometers, thermal infrared imagers,polarizationimagers,andactivelaserradars(LIDARsandLADARs).Thecoursematerialisdirectlyrelevanttosensinginenvironmental,civilian,military,astronomical,andsolarenergyapplications.
224 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Courses
LEARNING OUTCOMESThiscoursewillenableyouto:• reviewtheprinciplesofopticalradiometryusedtodescribeand
calculatetheflowofopticalenergyinanopticalsensorsystemorsolarenergysystem
• describehowtheatmosphereaffectsthepropagationofopticalradiation
• explainhowopticalatmosphericeffectsinfluenceremotesensingmeasurementsorsolarenergy
• usesystemparametersinbasicradiometriccalculationstopredictthesignalreceivedbypassiveandactivesensors
• comparesystemsattheblock-diagramlevelremotesensingmeasurements
• explainthedifferencebetweenpassiveimagingbasedonreflectionandemission
• acquiretheoperatingprinciplesoflaserradar(lidar/ladar)systemsfordistributedandsolidtargetsensing
INTENDED AUDIENCEScientists, engineers, technicians, or technical managers who findthemselves working on (or curious about) optical remote sensingsystemsordata.Undergraduate training inengineeringor science isassumed.
INSTRUCTORJoseph Shaw isaprofessorofelectricalengineeringandphysicsatMontanaStateUniversityandpreviouslyworkedattheNOAAresearchlabs.Heisarecognizedexpertindevelopment,calibration,andanalysisofopticaloptical remotesensingsystemsused inenvironmentalandmilitarysensing.Recognition forhiswork in thisfield includesNOAAresearchawards,aPresidentialEarlyCareerAwardforScientistsandEngineers,andtheWorldMeteorologicalOrganization’sVaisalaPrize.HeearnedaPh.D.inOpticalSciencesattheUniversityofArizona.Dr.ShawisaFellowofboththeOSAandSPIE.
Image Enhancement, Deblurring and Super-ResolutionSC468 NEWCourse level: AdvancedCEU .65 $525 / $640 USD Monday 8:30 am to 5:30 pm
This course discusses some of the advanced algorithms in the fieldof digital image processing. In particular, it familiarizes the audiencewith the understanding, design, and implementation of advancedalgorithms used in deblurring, contrast enhancement, sharpening,noisereduction,andsuper-resolution instill imagesandvideo.Someof the applications include medical imaging, entertainment imaging,consumer and professional digital still cameras/camcorders, forensicimaging, and surveillance. Many image examples complement thetechnicaldescriptions.
LEARNING OUTCOMESThiscoursewillenableyouto:• explainthevariousnonadaptiveandadaptivetechniquesused
inimagecontrastenhancement.ExamplesincludePhotoShopcommandssuchasBrightness/Contrast,AutoLevels,EqualizeandShadow/Highlights,orPizer’stechniqueandMoroney’sapproach
• explainthefundamentaltechniquesusedinimageDynamicRangeCompression(DRC).IllustrateusingthefastbilateralfilteringbyDorseyandDurandasanexample.
• explainthevarioustechniquesusedinimagenoiseremoval,suchasbilateralfiltering,sigmafilteringandK-NearestNeighbor
• explainthevarioustechniquesusedinimagesharpeningsuchasnonlinearunsharpmasking,etc.
• explainthebasictechniquesusedinimagedeblurring(restoration)suchasinversefilteringandWienerfiltering
• explainthefundamentalideasbehindachievingimagesuper-resolutionfrommultiplelowerresolutionimagesofthesamescene
• explainhowmotioninformationcanbeutilizedinimagesequencestoimprovetheperformanceofvariousenhancementtechniquessuchasnoiseremoval,sharpening,andsuper-resolution
INTENDED AUDIENCEScientists, engineers, and managers who need to understand and/or apply the techniques employed in digital image processing invarious products in a diverse set of applications such as medicalimaging, professional and consumer imaging, forensic imaging,etc. Prior knowledge of digital filtering (convolution) is necessary forunderstandingthe(Wienerfilteringandinversefiltering)conceptsusedindeblurring(about20%ofthecoursecontent).
INSTRUCTORMajid Rabbanihas30yearsofexperienceindigital imaging.HeisaKodak Fellow and Department Head and also an adjunct AssociateProfessor at Rochester Institute of Technology (RIT). He is the co-recipientofthe2005and1988KodakC.E.K.MeesAwardsandtheco-recipientof twoEmmyEngineeringAwards in1990and1996.Heistheco-authorofthebook“DigitalImageCompressionTechniques”publishedin1991andthecreatorofsixvideo/CDROMcoursesintheareaofdigitalimaging.Dr.RabbaniisaFellowofSPIE,aFellowofIEEE,andaKodakDistinguishedInventor.
High Dynamic Range Imaging: Sensors and ArchitecturesSC967 NEWCourse level: IntermediateCEU .35 $345 / $400 USD Monday 1:30 to 5:30 pm
This course provides attendees with an intermediate knowledge ofhighdynamic range imagesensorsand techniques for industrialandnon-industrial applications.Thecoursedescribesvarioussensorandpixelarchitectures toachievehighdynamicrange imagingaswellassoftwareapproachestomakehighdynamicrangeimagesoutoflowerdynamicrangesensorsorimagesets.Thecoursefollowsamathematicapproach to define the amount of information that can be extractedfromtheimageforeachofthemethodsdescribed.Somemethodsforautomaticcontrolofexposureanddynamicrangeofimagesensorsandotherissueslikecolorandglarewillbeintroduced.
LEARNING OUTCOMESThiscoursewillenableyouto:• describevariousapproachestoachievehighdynamicrange
imaging• predictthebehaviorofagivensensororarchitectureonascene• specifythesensororsystemrequirementsforahighdynamicrange
application• classifyahighdynamicrangeapplicationintooneofseveral
standardtypes
INTENDED AUDIENCEThismaterial is intended for anyonewhoneeds to learnmoreaboutquantitative side of high dynamic range imaging. Optical engineers,electronicengineersandscientistswillfindusefulinformationfortheirnexthighdynamicrangeapplication.
INSTRUCTORArnaud Darmont isownerandCEOofAphesa,acompanyfoundedin 2008 and specialized in image sensor consulting, the EMVA1288standardandcamerabenchmarking.HeholdsadegreeinElectronicEngineering from the University of Liège (Belgium). Prior to foundingAphesa,heworkedforover7yearsinthefieldofCMOSimagesensorsandhighdynamicrangeimaging.Note: COURSE PRICE INCLUDES the text High Dynamic Range Imaging: Sensors and Architectures (SPIE Press, 2012) by ArnaudDarmont.
spie.org/opadvance · TEL:+13606763290 · help@spie.org 225
Courses
Multispectral and Hyperspectral Image SensorsSC194Course level: AdvancedCEU .35 $380 / $435 USD Wednesday 8:30 am to 12:30 pm
Thiscoursewilldescribetheimagingcapabilitiesandapplicationsoftheprincipal typesofmultispectral (MS)andhyperspectral (HS) sensors.The focus will be on sensors that work in the visible, near-infraredandshortwave-infraredspectralregimes,butthecoursewilltouchonlongwave-infrared applications. A summary of the salient features ofclassicalcolorimaging(humanobservation)willalsobeprovidedinanappendix.
LEARNING OUTCOMESThiscoursewillenableyouto:• understandmanyoftheapplicationsandadvantagesof
multispectral(MS)andhyperspectral(HS)imaging• describeandcategorizethepropertiesoftheprincipalMS/
HSdesigntypes(multi-bandscanner,starerswithfilterwheels,dispersive,wedge,andFouriertransformimagerswith2Darrays,etc.)
• listanddefinetherelevantradiometricradiometricquantities,conceptsandphenomenology
• understandtheprocessoftranslatingsystemrequirementsintosensorhardwareconstraintsandspecifications
• analyzesignal-to-noiseratio,modulation-transfer-function,andspatial/spectralsamplingforMSandHSsensors
• define,understandandapplytherelevantnoise-equivalentfigures-of-merit(Noise-equivalentreflectancedifference,Noise-equivalenttemperaturedifference,Noise-equivalentspectralradiance,Noise-equivalentirradiance,etc.)
• describetheelementsoftheimagechainfromphotons-intobits-out(photondetection,videosignalmanipulation,analogprocessing,anddigitization)
• listandreviewkeyimagersubsystemtechnologyelements(optical,focalplane,videoelectronics,andthermal)
• formulateadetailedend-to-enddesignexampleofasatelliteimagingscanningHSsensor
• provideanappendixthatsummarizescolorimagingprinciplesandsensorassociatedelementsforhumanobservationapplications(e.g.colortelevision,stillcameras,etc.)
INTENDED AUDIENCEEngineers, scientists, and technical managers who are interested inunderstandingandapplyingmultispectralandhyperspectralsensorsinadvancedmilitary,civil,scientificandcommercialapplications.
INSTRUCTORTerrence LomheimholdsthepositionofDistinguishedEngineeratTheAerospaceCorp.Hehas32yearsofhardwareandanalysisexperienceinvisibleandinfraredelectro-opticalsystems,focalplanetechnology,andappliedoptics,andhasauthoredandco-authored53publicationsinthesetechnicalareas.HeisaFellowoftheSPIE.COURSEPRICEINCLUDESthetext CMOS/CCD Sensors and Camera Systems, 2nd edition (SPIE Press, 2011) by Terrence Lomheim andGeraldHolst.
Introduction to CCD and CMOS Imaging Sensors and ApplicationsSC504Course level: IntroductoryCEU .65 $665 / $780 USD Monday 8:30 am to 5:30 pm
ThiscourseprovidesareviewofgeneraltheoryandoperationforCCDand CMOS imaging technologies looking at the development andapplicationstatusesofboth.PerformancedifferencesbetweenCMOSandCCDimagingarraysarecovered.Fundamentalperformancelimitsbehind major sensor operations are presented in addition to imagedefects,shorts,deviceyield,popularchipfoundries,chipcost;customdesigned and off-the-shelf sensors. We discuss operation principlesbehind popular commercial and scientific CMOS pixel architectures,and various array readout schemes. We cover backside illuminatedarraysforUV,EUVandx-rayapplications;highQEfrontsideilluminatedsensors;deepdepletionCCDs,ultralargeCMOSandCCDarrays;highspeed/ low noise parallel readout sensors. We describe the photontransfertechniqueinmeasuringperformanceandcalibratingcameraandchipsystems,andchargetransfermechanisms.Wereviewcorrelateddouble sampling theory used to achieve low noise performance andconclude with a look at future research and development trends foreachtechnology.
LEARNING OUTCOMESThiscoursewillenableyouto:• describeoperatingCMOSandCCDarraysandcamerasystemsfor
commercialandscientificimagingapplications• explainhowCCDandCMOSarraysaredesigned,fabricated,tested
andcalibrated• knowhowtoapplytestmethodologiesandperformancestandards• listspecificationsandrequirementstoselectasensorforyour
imagingapplication• recognizeperformancedifferencesbetweenCMOSandCCD
technologies• understandhowvideosignalsareprocessedforoptimumsignal-to-
noiseperformance• becomefamiliarwithcurrentandfutureimagingtechnologiesand
applications
INTENDED AUDIENCEThiscourseisforscientists,engineers,andmanagersinvolvedwithhighperformanceCCDandCMOSimagingsensorsandcamerasystems.
INSTRUCTORJames Janesick is currently the director of the CMOS advanceddevelopment group for Sarnoff Corporation. Previously he waswith Conexant Systems Inc. developing CMOS imaging arrays forcommercial applications. He was technology director of Pixel Vision,Inc.forfiveyearsdevelopinghighspeedbacksideilluminatedCCDsforscientificandcinemacameras.PriortothisJanesickwaswiththeJetPropulsionLaboratoryfor22yearswhereasgroupleaderhedesignedscientificgroundandflightbased imagingsystems.Hehasauthored75 publications and has contributed to many NASA Tech Briefs andpatents for various CCD and CMOS innovations. Janesick receivedNASA medals for Exceptional Engineering Achievement (1982 and1992)andwastherecipientoftheSPIEEducatorAward(2004)andwasSPIE/IS&TImagingScientistoftheYear(2007).COURSE PRICE INCLUDES the texts Scientific Charge Coupled Devices(SPIEPress,2001),and Photon Transfer(SPIEPress,2007)byJamesJanesick.
226 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Courses
Digital Camera and Sensor Evaluation Using Photon TransferSC916Course level: IntroductoryCEU .65 $575 / $690 USD Tuesday 8:30 am to 5:30 pm
Photon transfer (PT) is a popular and essential characterizationstandard employed in the design, operation, characterization,calibration, optimization, specification and application of digitalscientific and commercial camera systems. The PT user friendlytechniqueisbasedononlytwomeasurements-averagesignalandrmsnoisewhichtogetherproduceamultitudeof importantdataproductsinevaluatingdigitalcamerasystems(mostnotablyCCDandCMOS).PT is applicable to all imaging disciplines. Design and fabricationprocessengineersdevelopingimagersrelyheavilyonPTdataproductsin determining discrete performance parameters such as quantumefficiency (QE), quantum yield, read noise, full well, dynamic range,nonlinearity, fixed pattern noise, V/e- conversion gain, dark current ,image,etc..CamerausersroutinelyusethePTtechniquetodeterminesystemlevelperformanceparameterstoconvertrelativemeasurementsinto absolute electron and photon units, offset correction, flat fieldand image S/N, ADC quantizing noise, optimum encoding, minimumdetectable luminance, operating temperature to remove dark current, reliability,stability,etc. PT isalso thefirstgo/no-gotestperformedtodeterminethehealthofnewcamerasystemand/ordetectoraswellasprovideapowertoolintroubleshootingproblems.ThiscoursewillreviewtheseaspectsandmanyothersofferedbyPT.
LEARNING OUTCOMESThiscoursewillenableyouto:• describePTtheory• takePTdataanddetermineimportantCCDandCMOSperformance
parameters• showexamplePTdataproductsgeneratedbyCCDandCMOS
imagers• calibrateacamerasysteminabsolutephysicalunits• usePTtodeterminethebestcameraorCCD/CMOSimagerforthe
application• usePTtodemonstrateandverifythecamerasystemisreliableand
ingoodoperatingorder• discussguidelinesforthenoviceandadvanceduseringenerating
PT,ModulationandLuxTransfercurves• usePTtooptimallyremovefixedpatternnoisesourcesinimagesfor
thehighestS/Npossiblethroughflatfielding• comprehendsignal-to-noiseimagetheorythroughPT
INTENDED AUDIENCEEngineers,scientists,andtechnicalmanagersworkingwithcommercialandscientificdigitalcamerasystems.SomefamiliaritywithCCDandCMOSimagersisrecommended.
INSTRUCTORJames Janesick is currently the director of the CMOS advanceddevelopment group for Sarnoff Corporation. Previously he waswith Conexant Systems Inc. developing CMOS imaging arrays forcommercial applications. He was technology director of Pixel Vision,Inc.forfiveyearsdevelopinghighspeedbacksideilluminatedCCDsforscientificandcinemacameras.PriortothisJanesickwaswiththeJetPropulsionLaboratoryfor22yearswhereasgroupleaderhedesignedscientificgroundandflightbased imagingsystems.Hehasauthored75 publications and has contributed to many NASA Tech Briefs andpatents for various CCD and CMOS innovations. Janesick receivedNASA medals for Exceptional Engineering Achievement (1982 and1992)andwastherecipientoftheSPIEEducatorAward(2004)andwasSPIE/IS&TImagingScientistoftheYear(2007).COURSE PRICE INCLUDES the text Photon Transfer (SPIE Press,2007)byJamesR.Janesick.
Infrared Systems - Technology & DesignSC835Course level: AdvancedCEU 1.30 $1145 / $1400 USD Monday-Tuesday 8:30 am to 5:30 pm
This course covers the range of topics necessary to understand thetheoretical principles of modern infrared-technology. It combinesnumerous engineering disciplines necessary for the development ofinfrared systems. Practical engineering calculations are highlighted,withexamplesoftradestudiesillustratingtheinterrelationshipsamongthevarioushardwarecharacteristics.Thiscourseiscomprisedoffoursections:Section1introducesthegeometricalopticsconceptsincludingimageformation,stopsandpupils,thicklensesandlenscombinations,imagequality,andthepropertiesofinfraredmaterials.Section 2 covers the essentials of radiometry necessary for thequantitative understanding of infrared signatures and flux transfer.These concepts are then developed and applied to flux-transfercalculations for blackbody, graybody, and selective radiator sources.Remotetemperaturecalibrationsandmeasurementsarethenusedasanillustrationoftheseradiometricprinciples.Section 3 is devoted to fundamental background issues for opticaldetection-processes. It compares the characteristics of cooled anduncooled detectors with an emphasis on spectral and blackbodyresponsivity,detectivity(D*),aswellasthenoisemechanismsrelatedtoopticaldetection.Thedetectorparametersandcapabilitiesofsingledetectorsandthirdgenerationfocalplanearrays(FPAs)areanalyzed.Withthisacquiredbackground,Section4considersthesystems-designaspectsofinfraredimagers.Theimpactofscanformatonsignal-to-noiseratio isdescribed,andtheengineeringtradeoffs inherent inthedevelopmentofinfraredsearchandtrack(IRST)systemsareexplained.Figures of merit such as MTF, NETD, and MRTD of staring arraysare examined for the performance metrics of thermal sensitivity andspatialresolutionofthermalimagingsystems(TIS).ContrastthresholdfunctionsbasedonJohnsonandvisiblecycles (oftendenotedasN-andV-cycles)arespecified. The interrelationshipsamongthedesignparametersareidentifiedthroughtrade-studyexamples.
LEARNING OUTCOMESThiscoursewillenableyouto:• learntheprinciplesandfundamentalsofinfraredopticaldesign• choosetheproperinfraredmaterialssuiteforyourapplications• quicklyexecuteflux-transfercalculations• calibrateinfraredsourcesandtargetsignatures• recognizetheimportanceofbackgroundinthermalsignatures• haveanappreciationforthecapacityofinfraredsystemsandlearn
theinteractionofitscriticalcomponents(optics,detectors,andelectronics)intheproductionofafinalinfraredimage
• assesstheinfluenceofnoisemechanismsrelatedtoopticaldetection
• comprehendthefundamentalresponsemechanismsanddifferencesbetweencooledanduncooledsingledetectorsaswellasfocalplanearrays(FPAs)
• comprehendthecentraltheorybehindthirdgenerationinfraredimagers
• defineandusecommondescriptorsfordetectorandsystemperformance(R,D*,NEP,NEI,MTF,NETD,andMRTD)
• estimatesystemperformancegivensubsystemandcomponentspecifications
• applydesigntradeoffsinbothinfraredsearchandtracksystems(IRST)andthermal-imagingsystems(TIS)
• carryoutthepreliminarydesignofinfraredsystemsfordifferentthermalapplications
spie.org/opadvance · TEL:+13606763290 · help@spie.org 227
Courses
INTENDED AUDIENCEThiscourseisdirectedtothepracticingengineersand/orscientistswhorequireboththeoreticalandeffectivepracticaltechnicalinformationtodesign,build,and/ortestinfraredsystemsinawidevarietyofthermalapplications. A background at the bachelor’s level in engineeringis highly recommended. The participant should also have ampleunderstandingofFourieranalysisandrandomprocesses.
INSTRUCTORArnold Daniels is a senior lead engineer with extensive experiencein theconceptualdefinitionofadvance infrared,optical, andelectro-optical systems. His background consists of technical contributionsto applications for infrared search& track, thermal imaging, and ISRsystems.Othertechnicalexpertiseincludeinfraredradiometry(testingandmeasurements),infraredtestsystems(i.e.,MTF,NETD,andMRTD),thermographicnondestructivetesting(TNDT),opticaldesign,precisionopticalalignment,straylightanalysis,adaptiveoptics,Fourieranalysis,imageprocessing,anddataacquisitionsystems.HeearnedanM.S.inElectricalEngineeringfromtheUniversityofTel-AvivandadoctorateinElectro-OpticsfromtheSchoolofOptics(CREOL)attheUniversityofCentralFlorida.In1995hereceivedtheRudolfKingslakemedalandprizeforthemostnoteworthyoriginalpapertoappearinSPIE’sJournalofOpticalEngineering.Heispresentlydevelopingdirectenergylaserweaponsystemsfordefenseapplications.COURSE PRICE INCLUDES the Field Guide to Infrared Systems, Detectors, and FPAs, 2nd EditionbyArnoldDaniels (SPIE,2010)and Infrared Detectors and Systems (Wiley,1996)byEustaceL.DereniakandGlennD.Boreman.
Radiometry RevealedSC915Course level: IntroductoryCEU .35 $300 / $355 USD Wednesday 8:30 am to 12:30 pm
This course explains basic principles and applications of radiometryand photometry. A primary goal of the course is to reveal the logic,systematic order, and methodology behind what sometimes appearstobeaconfusingbranchofopticalscienceandengineering.Examplesaretakenfromtheultravioletthroughthelong-waveinfraredportionsoftheelectromagneticspectrum.Anyonewhowantstoanswerquestionssuchas,“howmanywattsorphotonsdoIhave?”or“howmuchopticalenergyorradiationdoIneed?”willbenefitfromtakingthiscourse.
LEARNING OUTCOMESThiscoursewillenableyouto:• describethefundamentalunitsandquantitiesusedtoquantify
electromagneticradiationatwavelengthsfromtheultravioletthroughthevisibleandinfrared
• use,understand,andconvertbetweenradiometricandphotometricquantities
• applyradiometrytotypicalapplications,suchascalibratinganimagingsystem,determininghuman-perceivedbrightnessofadisplay,orcalculatingelectricityproducedbyasolarcell
• calculateareasandsolidanglestodeterminetheenergy,energydensity,orbrightnessinanopticalsystem
• explaintheroleofrays,stops,andpupilsindefiningthefieldofviewandlight-gatheringcapabilityofanopticalsystem
• determinethethroughputofanopticalsystemanduseitinradiometriccalculations
• quantifytheradiantenergyinopticalimagesfrompointandextendedsources
• transferradiantenergyintoandthroughoutopticalsystems• identifyradiometricstandardsandcalibrationmethods• befamiliarwithradiometersandphotometers
INTENDED AUDIENCEScientists, engineers, technicians, or technical managers who wishtolearnmoreabouthowtoquantifyradiantenergyinopticalsystemsandmeasurements.Undergraduate training inengineeringorscienceisassumed.
INSTRUCTORJoseph Shaw is Director of the Optical Technology Center andProfessor of Electrical Engineering and Physics at Montana StateUniversity inBozeman,Montana.Hepreviouslyworkedat theNOAAresearchlabsinBoulder,Colorado.Heisawidelyrecognizedexpertinthedevelopment,calibration,andanalysisofopticalsystemsused inenvironmentalandmilitarysensing.RecognitionforhisworkinthisfieldincludesNOAAresearchawards,aPresidentialEarlyCareerAwardforScientistsandEngineers,andtheWorldMeteorologicalOrganization’sVaisalaPrize.HeearnedaPh.D.inOpticalSciencesattheUniversityofArizonaandisaFellowofboththeOSAandSPIE.
Basic Optics for EngineersSC156Course level: IntroductoryCEU .65 $565 / $680 USD Tuesday 8:30 am to 5:30 pm
This course introduces each of the following basic areas of optics,fromanengineeringpointof view:geometrical optics, imagequality,flux transfer, sources, detectors, and lasers. Basic calculations andconceptsareemphasized.
LEARNING OUTCOMESThiscoursewillenableyouto:• computethefollowingimageproperties:size,location,fidelity,
brightness• estimatediffraction-limitedimagingperformance• explainopticaldiagrams• describethefactorsthataffectfluxtransferefficiency,andtheir
quantitativedescription• computethespectraldistributionofasource• describethedifferencebetweenphotonandthermaldetectors• calculatethesignaltonoiseperformanceofasensor(D*andnoise
equivalentpower)• differentiatebetweensensitivityandresponsivity• explainthemainfactorsoflaserbeams:monochromaticity,
collimation,andpropagation
INTENDED AUDIENCEThisclass is intended forengineers, technicians,andmanagerswhoneedtounderstandandapplybasicopticsconceptsintheirwork.Thebasics in each of the areas are covered, and are intended for thosewith little or no prior background in optics, or for those who need afundamentalrefreshercourse.
INSTRUCTORGlenn Boreman is the Chairman of the Department of Physics andOptical Science at the University of North Carolina at Charlotte. HereceivedaBSinOpticsfromRochesterandPhDinOpticsfromArizona.Prof.BoremanservedonthefacultyofUniversityofCentralFloridafor27years,with23PhDstudentssupervisedtocompletion.Hisresearchinterestsareininfrareddetectors,infraredmetamaterials,andelectro-opticalsensingsystems.Prof.BoremanisaFellowofSPIE,OSA,andtheMilitarySensingSymposium.COURSEPRICEINCLUDESthetext Basic Electro-Optics for Electrical Engineers(SPIEPress,1998)byGlennD.Boreman.Thiscourseisalsoavailableinonlineformat.
228 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Courses
Solar Energy + Technology
Design and Reliability of Photovoltaic ModulesSC910Course level: IntermediateCEU .35 $300 / $355 USD Tuesday 8:30 am to 12:30 pm
Photovoltaicmoduledesigndrawsonknowledgefrommanydisciplines:optical, electronic, mechanical and quality engineering. This courseprovidesattendeeswithabasicworkingknowledgeofphotovoltaic(PV)moduledesignandreliability.AbriefsummaryofthePhysicsofFailureof Electronic Packages will be presented. The history of PV modulefieldfailureswillbepresentedalongwithadescriptionofhowthisfieldexperience has been utilized to develop more reliable modules andacceleratedstressteststomorerapidlyevaluatemoduleperformance.Theconceptofqualificationtestingwillbeintroducedwithadiscussiononitsusefulnessandlimitations.Typicalmoduleconfigurationswillbepresentedalongwithadiscussionofthecriteriautilizedforcomponentselectionwithintheseconfigurations.Anumberofexamplesbasedoncommercialmoduleconstructionwillbeusedtoillustratethesepoints.Thelongtermreliability,degradationratesandlifetimeforthepresentdaycommercialmoduleswillbediscussed.
LEARNING OUTCOMESThiscoursewillenableyouto:• describehowtoday’sPVmodulepackagesarebuiltandwhythey
arebuiltthatway• makespecificdistinctionsbetweenqualificationtestingand
reliabilitytesting,identifyingtherolesthateachplays• designPVmodulesandchooseappropriatecomponentsfor
buildingthem• testandevaluatethereliabilityofdifferenttypesofPVmodules
INTENDED AUDIENCEThismaterialisintendedforanyonewhowishestolearnhowtodesignPVmodulesandtotestandevaluatetheirreliability.ThosewhoeitherdesignandbuildPVmodulesortestandevaluatetheirreliabilitywillfindthiscoursevaluable.
INSTRUCTORsNeelkanth DhereisProgramDirectorandProfessorattheFloridaSolarEnergyCenter,UniversityofCentralFloridaandhasbeencarryingoutresearchandteachinginPhotovoltaicsforover30years.HeisaFellowofAVS,Sci.&Technol.Michael D. Kempe is aScientist in thePVModuleReliabilityGroupof the National Center for Photovoltaics at the National RenewableEnergyLaboratory,wherehestudiesthefactorsaffectingthelongevityof photovoltaic cells and modules. His work is concerned primarilywithbothmodellingandmeasuringmoistureingressintoPVmodulesandstudyingitseffectonpolymeradhesion,deviceperformanceandcomponentcorrosion.HeisalsostudyingtheeffectsofUVradiationand heat on the mechanical, chemical, and electrical stability ofPV packaging components. This effort is tied into creating betterqualification tests that more accurately assess safety and are betterpredictors of long term durability. Dr. Kempe graduated from theCaliforniaInstituteofTechnologywithaPh.D.inchemicalengineering.
Non-Imaging OpticsSC388Course level: IntroductoryCEU .35 $300 / $355 USD Monday 1:30 to 5:30 pm
Nonimaging optics departs from the methods of traditional opticaldesignbyinsteaddevelopingtechniquesformaximizingthecollectingpower of illumination elements and systems. Nonimaging designsexceedtheconcentrationattainablewith focusing techniques by factors of four or more and approachthe theoretical limit (ideal concentrators). This course develops theconceptual foundations and is an excellent companion to Dr. DavidJenkins’coursewhichemphasizesapplications.
LEARNING OUTCOMESThiscoursewillenableyouto:• formulatethelimittolightcollectionposedbyaparticular
application• distinguishbetweenimagingandnonimagingsolutions• classifythenonimagingalgorithms• solvethenonimagingprobleminparticularcontexts• computespecificnonimagingdesigns• estimatetheperformanceofanonimagingdesign• comparetherelativeperformanceofnonimagingandimaging
designs• identifytheapplicationofnonimagingdesignsinavarietyof
applications
INTENDED AUDIENCEThecourseisdesignedforopticaldesigners,engineers,andscientistswhose work encounters demanding problems of light collection orillumination. The course is self-contained. No specialized technicalbackgroundrequired.
INSTRUCTORRoland WinstonisProfessor,AboveScaleintheSchoolsofEngineering&NaturalScience,UniversityofCalifornia,Merced;andDirector,UCSolar comprising five University of California campuses: Berkeley,Santa Barbara, Davis, San Diego and Merced. He founded the fieldofnonimagingopticsand,workingwithstudentsandcolleagues,hasapplied it toavarietyofproblems in radiationdetection, illumination,andsolarenergyconcentration.Heauthored,withJ.C.MinanoandP.Benitez,thetext Nonimaging Optics(Elsevier-AcademicPress,2005).
Optical Scatter Metrology for IndustrySC1003Course level: IntermediateCEU .35 $360 / $415 USD Monday 1:30 to 5:30 pm
Optical scatter, originally used almost exclusively to characterize thestraylightgeneratedbyopticallysmoothsurfaces,isnowbeingusedasasensitive,economicalwaytomonitorthesurfacetexturerequirementsinavarietyofindustries.Forexample,thephoto-voltaicindustryusesspecifictypesoftextureonsurfacestoincreaseabsorptionandsystemefficiency. Texture is often an important requirement for the metalproducing industry and it changeswith rollwear. Theappearanceofevery day appliances (from door hinges to computer cases) variesdramaticallywith texture. Thequalityof flatpaneldisplaysdependsonthescattercharacteristicsofthescreenandcomponentsbehindit.SEMIandASTMarerespondingtothenewapplicationswith“scatterstandards” to help communication between manufacturers, vendorsandcustomers.
spie.org/opadvance · TEL:+13606763290 · help@spie.org 229
Courses
Thelowsignal(hardtomeasure)opticalapplicationsweresolvedfirstbecause the math was easy. Rougher surface scatter relationshipsare more complicated, but the signals are much larger - makinginstrumentationeasier.Thecoursestartswiththeopticalapplicationsandthenexploresthetransitiontorougherindustrysurfaces.Betweenagoodopticalmirrorandaconcretesidewalktherearethousandsofindustrysurfacesthatcanbemonitoredwithscattermetrology.Thereare twokeypoints for these “in-between” surfaces: (1) If the texturechanges - the scatter changes and (2) these changes (and productfunction)cannotbeadequatelymonitoredbyasinglevariable-suchasRMSRoughness,HazeorGloss.Thecourseemphasizesquantifying,measuring and understanding scatter. The modeling of scatter ismentioned,butisnotemphasizedhere.
LEARNING OUTCOMESThiscoursewillenableyouto:• quantifyandanalyzescatterintermsofBRDF,TIS,HazeandDSC
units• explaintheinstrumentationforobtainingscatterdataandevaluate
systemcalibration• describeandovercomethevariousdifficultiesincomparing
roughnessstatisticsfoundfromprofilometersandscatterometersforbothone-andtwo-dimensionalsamples
• convertscattertoroughnessstatisticswhenpossibleandunderstandwhenitisnotpossible
• evaluatetheuseofscattermeasurementforspecificapplicationssuchas:straysystemradiation,surfacemicro-roughness,particulatesizing,backgroundsensornoise
• explaintheuseofpolystyrenelatexspheredepositionsasanopticalscatteringstandard
• reviewscatteringstandardsforthesemiconductorandphoto-voltaicindustries
INTENDED AUDIENCEEngineers, scientists, and managers who need to understand andapply thebasicconceptsofscattermetrology to laboratory researchandindustrialprocesscontrol.Someknowledgeofcalculusishelpful,but thecoursedoesnot require that thestudent followmathematicalderivations. The instructor has worked with Thomas Germer (SC492instructor)toavoidoverlapbetweenthetwocourses.
INSTRUCTORJohn Stover is President of The Scatter Works, Inc., a Tucson firmconcentratingonscatterbasedmetrologystandards,consulting,andmeasurementas theyapply todiverse industries.Hehas researchedlight scatter related problems for over 30 years and led teams ofengineers who developed state-of-the-art scatterometers, verifiedtheoretical relationship between surface roughness and scatter andcharacterizedsurfacedefectstoimprovewafermetrology.Hehasbeeninvolvedwithinternationalstandardsorganizationsforover20years,isanSPIEFellow,andhasbeenactiveasanauthor,conferencechairman,andeditor,andhasoveronehundredpublications.COURSEPRICEINCLUDESthetext Optical Scattering: Measurement and Analysis, 2nd Edition(SPIEPress,1995)byJohnStover.
Thin Film Optical CoatingsSC321Course level: IntermediateCEU .65 $525 / $640 USD Monday 8:30 am to 5:30 pm
Virtually no modern optical system could operate without opticalcoatings. Much of any optical system consists of a series of coatedandshapedsurfaces.Theshapedeterminesthepowerofthesurfacebutitisthecoatingthatdeterminesthespecularproperties,theamountoflighttransmittedorreflected,thephasechange,theemittance,thecolor, thepolarization, the retardation, includingeven themechanicalproperties. Optical coatings consist of assemblies of thin films ofmaterials where interference properties combine with the intrinsic
propertiesofthematerialstoyieldthedesiredopticalperformance.Theyacttoreducethereflectancelossesoflenses,increasethereflectanceof mirrors, reduce glare and electromagnetic emission from displaysystems,improvethethermalinsulationofbuildings,protecteyesfromlaser radiation, analyze gases, act as anticounterfeiting devices onbanknotes,multiplexordemultiplexcommunicationsignals,separateorcombinecolorchannels indisplayprojectors,andtheseare justafew of their roles. This course emphasizes understanding and takesstudentsfromfundamentalstotechniquesfordesignandmanufacture.
LEARNING OUTCOMESThiscoursewillenableyouto:• understandthebasicprinciplesofopticalinterferencecoatings• performmanyrapiddesigncalculationsandassessmentswithout
needingacomputer• speakknowledgeablyabouttheparametersthatcharacterizeoptical
coatings• designsimplecoatingsgivenasuitablyequippedcomputer• knowtheadvantagesanddisadvantagesofthebasicprocessesfor
theproductionofthesefilters• understandtheinfluenceoferrorsinmonitoringandestimate
tolerancesinproduction
INTENDED AUDIENCEAnyone who is or wishes to become involved in the manufacture oruseofopticalcoatingsorwhowantstoknowmoreaboutthisrapidlygrowingandimportantfield.Thelevelisappropriateforsomeonewhohascompletedhighschoolmathematicsand/orscience.
INSTRUCTORH. Angus MacleodisPresidentofThinFilmCenter,asoftware,trainingandconsultingcompanyinopticalcoatings,andisProfessorEmeritusofOpticalSciencesat theUniversityofArizona.Hehasbeendeeplyinvolvedinopticalcoatingsforoverfortyyears.
Predicting, Modeling, and Interpreting Light Scattered by SurfacesSC492Course level: IntermediateCEU .35 $300 / $355 USD Tuesday 1:30 to 5:30 pm
Themeasurementoflightscatteredbysurfacescanbeusedtolocateand identify roughness, particulates, and defects on a wide varietyof materials. Applications include the inspection of silicon wafers,optics, and storage media, characterization of thin film roughness,identification of objects in remote sensing, and prediction of opticalsystem performance. The aim of this course is to provide tools toengineers and scientists to enable them to predict scattering fordifferentsources,differentiateamongstdifferentscatteringsources,andto design instrumentation that maximizes sensitivity or differentiationamongstscatteringsourcesfortheirspecificapplication.EmphasiswillbeplacedontheuseoftheSCATMECHlibraryofscatteringcodesandthe Modeled Integrated Scatter Tool (MIST) in order to minimize themathematicsthatcanoftenbeabarriertothosewhowouldotherwisebe interested inusingopticalscatter. Themeasurementofscatter isemphasizedinSC020taughtbyJohnStover.
LEARNING OUTCOMESThiscoursewillenableyouto:• quantifyscatterintermsofintensityandpolarizationproperties• identifylikelysourcesofscatterfromamaterialorthinfilm• predictscatterfromspecificscattersources:roughness,particles,
andsubsurfacedefects• designexperimentsthatdifferentiateamongscatteringsources• useMISTtoevaluateorvisualizeopticalscatterinavarietyof
applications.• definethelimitationsoflightscattering
230 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Courses
INTENDED AUDIENCEThiscourseisintendedforscientistsandengineerswhoareinterestedinmodeling,predicting,andinterpretinglightscatterfromsurfacesformaterialinspection,opticaldesign,orremotesensingapplications.TheinstructorhasdesignedthecoursetocomplementSC1003,workinginconjunctionwithSC1003’sinstructorJohnStovertocoordinatethematerial.
INSTRUCTORThomas Germer is a physicist specializing in measurements andmodelingoftheopticalpropertiesofmaterialsattheNationalInstituteofStandardsandTechnologyinGaithersburg,Maryland.Hehaspublishedover one hundred technical papers, covering topics of electron andultrafasttime-resolvedsurfacespectroscopy,diffuseopticalscatteringfrom particles, roughness, and defects near surfaces and thin films,polarimetry,criticaldimensionmetrologybygratingscatterometry,andbiomedical optics. He is thedeveloperof theSCATMECH libraryoflightscatteringcodesandtheassociatedMISTprogram.Dr.GermerreceivedaB.A.fromtheUniversityofCalifornia,Berkeley,andaM.S.andPh.D.fromCornellUniversity,andisaFellowofSPIE.Following the course, attendees will be provided with an electroniccopyofthepublicdomainSCATMECHlibrary,theMISTprogram,andalloftheexampleprogramsdiscussedintheclass.
Radiometry RevealedSC915Course level: IntroductoryCEU .35 $300 / $355 USD Wednesday 8:30 am to 12:30 pm
This course explains basic principles and applications of radiometryand photometry. A primary goal of the course is to reveal the logic,systematic order, and methodology behind what sometimes appearstobeaconfusingbranchofopticalscienceandengineering.Examplesaretakenfromtheultravioletthroughthelong-waveinfraredportionsoftheelectromagneticspectrum.Anyonewhowantstoanswerquestionssuchas,“howmanywattsorphotonsdoIhave?”or“howmuchopticalenergyorradiationdoIneed?”willbenefitfromtakingthiscourse.
LEARNING OUTCOMESThiscoursewillenableyouto:• describethefundamentalunitsandquantitiesusedtoquantify
electromagneticradiationatwavelengthsfromtheultravioletthroughthevisibleandinfrared
• use,understand,andconvertbetweenradiometricandphotometricquantities
• applyradiometrytotypicalapplications,suchascalibratinganimagingsystem,determininghuman-perceivedbrightnessofadisplay,orcalculatingelectricityproducedbyasolarcell
• calculateareasandsolidanglestodeterminetheenergy,energydensity,orbrightnessinanopticalsystem
• explaintheroleofrays,stops,andpupilsindefiningthefieldofviewandlight-gatheringcapabilityofanopticalsystem
• determinethethroughputofanopticalsystemanduseitinradiometriccalculations
• quantifytheradiantenergyinopticalimagesfrompointandextendedsources
• transferradiantenergyintoandthroughoutopticalsystems• identifyradiometricstandardsandcalibrationmethods• befamiliarwithradiometersandphotometers
INTENDED AUDIENCEScientists, engineers, technicians, or technical managers who wishtolearnmoreabouthowtoquantifyradiantenergyinopticalsystemsandmeasurements.Undergraduate training inengineeringorscienceisassumed.
INSTRUCTORJoseph Shaw is Director of the Optical Technology Center andProfessor of Electrical Engineering and Physics at Montana StateUniversity inBozeman,Montana.Hepreviouslyworkedat theNOAAresearchlabsinBoulder,Colorado.Heisawidelyrecognizedexpertinthedevelopment,calibration,andanalysisofopticalsystemsused inenvironmentalandmilitarysensing.RecognitionforhisworkinthisfieldincludesNOAAresearchawards,aPresidentialEarlyCareerAwardforScientistsandEngineers,andtheWorldMeteorologicalOrganization’sVaisalaPrize.HeearnedaPh.D.inOpticalSciencesattheUniversityofArizonaandisaFellowofboththeOSAandSPIE.
X-ray, gamma-ray, and Particle Technologies
Optical Scatter Metrology for IndustrySC1003Course level: IntermediateCEU .35 $360 / $415 USD Monday 1:30 to 5:30 pm
Optical scatter, originally used almost exclusively to characterize thestraylightgeneratedbyopticallysmoothsurfaces,isnowbeingusedasasensitive,economicalwaytomonitorthesurfacetexturerequirementsinavarietyofindustries.Forexample,thephoto-voltaicindustryusesspecifictypesoftextureonsurfacestoincreaseabsorptionandsystemefficiency. Texture is often an important requirement for the metalproducing industry and it changeswith rollwear. Theappearanceofevery day appliances (from door hinges to computer cases) variesdramaticallywith texture. Thequalityof flatpaneldisplaysdependsonthescattercharacteristicsofthescreenandcomponentsbehindit.SEMIandASTMarerespondingtothenewapplicationswith“scatterstandards” to help communication between manufacturers, vendorsandcustomers.Thelowsignal(hardtomeasure)opticalapplicationsweresolvedfirstbecause the math was easy. Rougher surface scatter relationshipsare more complicated, but the signals are much larger - makinginstrumentationeasier.Thecoursestartswiththeopticalapplicationsandthenexploresthetransitiontorougherindustrysurfaces.Betweenagoodopticalmirrorandaconcretesidewalktherearethousandsofindustrysurfacesthatcanbemonitoredwithscattermetrology.Thereare twokeypoints for these “in-between” surfaces: (1) If the texturechanges - the scatter changes and (2) these changes (and productfunction)cannotbeadequatelymonitoredbyasinglevariable-suchasRMSRoughness,HazeorGloss.Thecourseemphasizesquantifying,measuring and understanding scatter. The modeling of scatter ismentioned,butisnotemphasizedhere.
LEARNING OUTCOMESThiscoursewillenableyouto:• quantifyandanalyzescatterintermsofBRDF,TIS,HazeandDSC
units• explaintheinstrumentationforobtainingscatterdataandevaluate
systemcalibration• describeandovercomethevariousdifficultiesincomparing
roughnessstatisticsfoundfromprofilometersandscatterometersforbothone-andtwo-dimensionalsamples
• convertscattertoroughnessstatisticswhenpossibleandunderstandwhenitisnotpossible
• evaluatetheuseofscattermeasurementforspecificapplicationssuchas:straysystemradiation,surfacemicro-roughness,particulatesizing,backgroundsensornoise
• explaintheuseofpolystyrenelatexspheredepositionsasanopticalscatteringstandard
• reviewscatteringstandardsforthesemiconductorandphoto-voltaicindustries
spie.org/opadvance · TEL:+13606763290 · help@spie.org 231
Courses
INTENDED AUDIENCEEngineers, scientists, and managers who need to understand andapply thebasicconceptsofscattermetrology to laboratory researchandindustrialprocesscontrol.Someknowledgeofcalculusishelpful,but thecoursedoesnot require that thestudent followmathematicalderivations. The instructor has worked with Thomas Germer (SC492instructor)toavoidoverlapbetweenthetwocourses.
INSTRUCTORJohn Stover is President of The Scatter Works, Inc., a Tucson firmconcentratingonscatterbasedmetrologystandards,consulting,andmeasurementas theyapply todiverse industries.Hehas researchedlight scatter related problems for over 30 years and led teams ofengineers who developed state-of-the-art scatterometers, verifiedtheoretical relationship between surface roughness and scatter andcharacterizedsurfacedefectstoimprovewafermetrology.Hehasbeeninvolvedwithinternationalstandardsorganizationsforover20years,isanSPIEFellow,andhasbeenactiveasanauthor,conferencechairman,andeditor,andhasoveronehundredpublications.COURSEPRICEINCLUDESthetext Optical Scattering: Measurement and Analysis, 2nd Edition(SPIEPress,1995)byJohnStover.
Predicting, Modeling, and Interpreting Light Scattered by SurfacesSC492Course level: IntermediateCEU .35 $300 / $355 USD Tuesday 1:30 to 5:30 pm
Themeasurementoflightscatteredbysurfacescanbeusedtolocateand identify roughness, particulates, and defects on a wide varietyof materials. Applications include the inspection of silicon wafers,optics, and storage media, characterization of thin film roughness,identification of objects in remote sensing, and prediction of opticalsystem performance. The aim of this course is to provide tools toengineers and scientists to enable them to predict scattering fordifferentsources,differentiateamongstdifferentscatteringsources,andto design instrumentation that maximizes sensitivity or differentiationamongstscatteringsourcesfortheirspecificapplication.EmphasiswillbeplacedontheuseoftheSCATMECHlibraryofscatteringcodesandthe Modeled Integrated Scatter Tool (MIST) in order to minimize themathematicsthatcanoftenbeabarriertothosewhowouldotherwisebe interested inusingopticalscatter. Themeasurementofscatter isemphasizedinSC020taughtbyJohnStover.
LEARNING OUTCOMESThiscoursewillenableyouto:• quantifyscatterintermsofintensityandpolarizationproperties• identifylikelysourcesofscatterfromamaterialorthinfilm• predictscatterfromspecificscattersources:roughness,particles,
andsubsurfacedefects• designexperimentsthatdifferentiateamongscatteringsources• useMISTtoevaluateorvisualizeopticalscatterinavarietyof
applications.• definethelimitationsoflightscattering
INTENDED AUDIENCEThiscourseisintendedforscientistsandengineerswhoareinterestedinmodeling,predicting,andinterpretinglightscatterfromsurfacesformaterialinspection,opticaldesign,orremotesensingapplications.TheinstructorhasdesignedthecoursetocomplementSC1003,workinginconjunctionwithSC1003’sinstructorJohnStovertocoordinatethematerial.
INSTRUCTORThomas Germer is a physicist specializing in measurements andmodelingoftheopticalpropertiesofmaterialsattheNationalInstituteofStandardsandTechnologyinGaithersburg,Maryland.Hehaspublishedover one hundred technical papers, covering topics of electron andultrafasttime-resolvedsurfacespectroscopy,diffuseopticalscattering
from particles, roughness, and defects near surfaces and thin films,polarimetry,criticaldimensionmetrologybygratingscatterometry,andbiomedical optics. He is thedeveloperof theSCATMECH libraryoflightscatteringcodesandtheassociatedMISTprogram.Dr.GermerreceivedaB.A.fromtheUniversityofCalifornia,Berkeley,andaM.S.andPh.D.fromCornellUniversity,andisaFellowofSPIE.Following the course, attendees will be provided with an electroniccopyofthepublicdomainSCATMECHlibrary,theMISTprogram,andalloftheexampleprogramsdiscussedintheclass.
Practical Interferometry and Fringe AnalysisSC211Course level: IntermediateCEU .65 $525 / $640 USD Wednesday 8:30 am to 5:30 pm
You’venodoubtheardofinterferometrictestingandallthewonderfulthingsitcandotosolveyourmeasurementproblems.Youmayhaveattended an introduction to interferometry or been shopping for aninstrument.Buthowdoyougetstarted?Howdoyoudeterminewhichtypeofinterferometerwillsolveyourproblem?Doyoumakeyourownorbuyacommercialinstrument?Onceyou’vegotaninstrumenthowcanyoubesureyoualigneditcorrectlyandaregettingthebestdatayoucanforyourmeasurementproblem?Thisintermediate-levelcourseoffersanoverviewofthefundamentalsof interferometric testing and the analysis of interferometric fringepatterns applicable to many different areas of interferometry, opticaltesting, nondestructive testing, and metrology. It is geared towardstechnicallymindedtypeswhohavehadsomeexposuretothebasicsofinterferometryandwanttofindoutmoreaboutthepracticalnutsandboltsofusinginterferometryasatool.Wewillbeginwithanoverviewof the basic fundamentals of interferometry including formation ofinterference fringes fordifferent typesofsources, fringevisibilityandhowfringesrelatetobasicpropertiesoftheobjectbeingtested.Wethen will cover common interferometer types and phase modulationtechniques, essentials for creating, detecting and digitizing fringes,alignmentandenvironmentalconsiderationsandcalibration.Throughoutthiscoursereal-worldproblemswillbeusedasexamples.Thesecondhalfoftheclasswillfocusonthesesamequestionsfromthe aspect of fringe analysis techniques. We will outline the basictechniquesand thenbrainstormhowyoudeterminewhetheryougotgooddataandhowyouwouldbegin ifyouwereanalyzingyourownraw fringe data. During this discussion common pitfalls and sourcesoferrorswillbepointedouttohelpstreamlineyourprocessofgettingup and running to take your own measurements. Attendees areencouragedtobringalongtheirreal-worldproblemsandofferthemasstartingpointsforourdiscussion.
LEARNING OUTCOMESThiscoursewillenableyouto:• understandthebasiccomponentsofmonochromatic,narrowband
andwhitelightinterferometers• ensurethatyouarechoosingtherighttypeofinterferometerforyour
application• listthenecessarystepstosetupaninterferometerandtakea
measurement• differentiatetheprosandconsofvariousmeasurementandanalysis
techniques• evaluatethetradeoffsbetweentechniques• outlinesimpleteststodetermineifyouaregettinggood
measurements• helpyoudecidewhichtechniqueisbestforaparticularapplication
INTENDED AUDIENCEThiscourseisforengineersworkingwithopticalinterferometry,opticaltesting, surface metrology, experimental mechanics, nondestructivetesting,andMoiregratingtechniques.Itwillbeassumedthatattendeeshaveabasicknowledgeofgeometricalopticsandinterferometry.
232 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Courses
INSTRUCTORKatherine Creath is an internationally recognized expert in opticaltesting, metrology and system design working as a Consultant, aSeniorResearchScientistfor4DTechnologyCorp,andasaResearchProfessorofOpticalSciencesandMedicineattheUniversityofArizona.Shehasmorethan25yearsofexperienceininterferometryandopticaltestingandisaFellowofSPIEandOSA.
Introduction to Interferometric Optical TestingSC213Course level: IntroductoryCEU .35 $330 / $385 USD Tuesday 8:30 am to 12:30 pm
Thisshortcourseintroducesthefieldofinterferometricopticaltesting.Topics covered include basic interferometers for optical testing, andconceptsofphase-shiftinginterferometryincludingerroranalysis.Longwavelength interferometry,testingofasphericsurfaces,measurementof surface microstructure, and the state-of-the-art of direct phasemeasurementinterferometersarealsodiscussed.
LEARNING OUTCOMESThiscoursewillenableyouto:• explainthebasicconceptsofinterferometricopticaltesting• describethepower,capabilities,andlimitationsofphase-shifting
interferometry• describetechniques,advantages,anddisadvantagesoflong-
wavelengthinterferometry• comparedifferentaspherictestingtechniques• listcapabilitiesandtechniquesformeasuringsurfacemicrostructure• describethecurrentstate-of-the-artofdirectphasemeasurement
interferometers
INTENDED AUDIENCEEngineers,scientists,andmanagerswhoneedtounderstandthebasicconceptsofinterferometricopticaltesting.
INSTRUCTORJames WyantisDeanoftheCollegeofOpticalSciencesandProfessorofOpticalSciencesattheUniversityofArizona.HewasafounderoftheWYKOCorporationandservedasitspresidentfrom1984to1997.Dr.Wyantwasthe1986PresidentofSPIE.
business + Professional Development
Basic Optics for Non-Optics PersonnelWS609Course level: IntroductoryCEU .30 $100 / $150 USD Tuesday 1:30 to 4:00 pm
This course will provide the technical manager, sales engineering,marketing staff, or other non-optics personnel with a basic, non-mathematical introduction to the terms, specifications, andconceptsused in optical technology to facilitate effective communication withopticsprofessionalsonafunctionallevel.Topicstobecoveredincludebasicconceptssuchas imaging, interference,diffraction,polarizationandaberrations,definitionsrelatingtocolorandopticalquality,andanoverviewofthebasicmeasuresofopticalperformancesuchasMTFandwavefronterror.Thematerialwillbepresentedwithaminimalamountof math, rather emphasizing working concepts, definitions, rules ofthumb,andvisualinterpretationofspecifications.Specificapplicationswillincludedefiningbasicimagingneedssuchasmagnification,depth-of-field,andMTFaswellasthedefinitionsofradiometricterms.
LEARNING OUTCOMESThiscoursewillenableyouto:• readopticalsystemdescriptionsandpapers• asktherightquestionsaboutopticalcomponentperformance• describebasicopticalspecificationsforlenses,filters,andother
components• assessdifferencesintypesoffilters,mirrorsandbeamdirecting
optics• knowhowopticsisusedinoureverydaylives
INTENDED AUDIENCEThiscourseisintendedforthenon-opticalprofessionalwhoneedstounderstandbasicopticsandinterfacewithopticsprofessionals.
INSTRUCTORKevin Harding has been active in the optics industry for over 30years, and has taught machine vision and optical methods for over25 years in over 70 workshops and tutorials, including engineeringworkshopsonmachinevision,metrology,NDT,andinterferometryusedby vendors and system houses to train their own engineers. He hasbeenrecognizedforhisleadershipinopticsandmachinevisionbytheSocietyofManufacturingEngineers,Automated ImagingAssociation,andEngineeringSocietyofDetroit.KevinisaFellowofSPIEandwasthe2008PresidentoftheSociety.Thiscourseisalsoavailableinonlineformat.
Critical Skills for Compelling Research ProposalsWS1058 NEWCourse level: IntroductoryCEU .35 $75 / $125 USD Sunday 1:30 to 5:30 pm
Research costs money. The good news is that there are thousandsof avenues of financial support. The bad news is that hundreds ofthousands of proposals are competing for those funds. This classwill teachyou tocrafthigh-qualityproposals thatstandout from themasses.Wewill focusonfive fundamental skills thatwill bolster thesubstance,structure,andappearanceofyourproposals.Adheringtothesepracticeswilldramaticallyincreaseyouroddsofwinningfundingforyourresearch.
spie.org/opadvance · TEL:+13606763290 · help@spie.org 233
Courses
LEARNING OUTCOMESThiscoursewillenableyouto:• identifyfundingopportunitiesthatalignwithyourresearchgoals• developsolidresearchplansandbelievablebudgets• communicateyourresearchtoageneralaudience• writeinaclear,concise,andcompellingmanner• formatyourproposalforvisualappeal
INTENDED AUDIENCEThis course is intended for all scientists and engineers seeking toimprovethequalityoftheirresearchproposals.
INSTRUCTORDamon Diehl isAssistantProfessorand Coordinator for theOpticalSystems Technology program at Monroe Community College inRochester,NYandalsothefounderandownerofDiehlResearchGrantServices.HehasaPh.D.inopticalengineeringfromtheUniversityofRochesterInstituteofOpticsandaB.A.inphysicsfromtheUniversityofChicago.Hisclassisbasedonfifteenyearsofacademicandindustrialresearchexperience.Thiscourse is free toSPIEStudentMembers,but youmust registertoattend.
Resumes to Interviews: Strategies for a Successful Job SearchWS1059 NEWCourse level: IntroductoryCEU .35 $75 / $125 USD Tuesday 8:30 am to 12:30 pm
Thiscoursereviewseffectivestrategiesandtechniquesforasuccessfuljob search such as: compiling resumes, writing cover letters, andinterviewingtips.Theprimarygoalofthecourseistoprovidecreativeandproventechniquesfornewcollegegraduatesandprofessionalstoplanandconducttheirjobsearchandsecureajob.Creativeandcomprehensivejobsearchtechniqueswillbediscussedaswellasactualresumeandinterviewingexamplesandtips.Anyonewhoisgettingreadytoentertheworkforcewhowantstoanswerquestionssuch as, “when and how do I start my job search?,” “what kind ofcover letterandresumegetsnoticed?”or“howdoIsellmyself inaninterview?”willbenefitfromtakingthiscourse.
LEARNING OUTCOMESThiscoursewillenableyouto:• startandcreateyourjobsearchplan• createanonlinenetworkingpresence• buildandwriteeffectivecoverlettersandresumesthatgetnoticed• avoidcommonresumeandcoverlettermistakes• interviewwithconfidence
INTENDED AUDIENCEGraduate students, new graduates, engineers and technicians whowishtolearnmoreaboutcreatingajobsearchplan,writinganeffectivecover letter and resume that gets you noticed, and techniques forsuccessfulinterviews.
INSTRUCTORSPaige Lawson has been in professional recruiting for more than 20years.Shehasextensiveexperiencewithbothin-housecorporateenvironmentsaswellasoutsideagency/consultingenvironments. Paige is currently the Executive Recruiter for ExoticElectroOpticsinMurrieta,CA,andamemberofthelocalnetworkinggroupProfessionalsinHumanResources(PHIRA).Suzanne Krinskyhasbeeninhumanresourcesandcorporaterecruitingfor more than 15 years. She has extensive experience with both in-house corporate environments as well as outside agency/consultingenvironments.Suzanne iscurrently theHumanResourceDirector forDaylightSolutions inSanDiego,andalsoa long-timeBoardmemberfor theBiotechHumanResourceDevelopmentCoalition (BEDC)andHumanResourceRoundtablemember.Thiscourse is free toSPIEStudentMembers,but youmust registertoattend.
Effective Technical PresentationsWS897Course level: IntroductoryCEU .35 $75 / $125 USD Monday 8:30 am to 12:30 pm
Oralpresentationskillsareakeytosuccessforresearchers.Thiscourseproposesafive-stepmethodologythatwilltakeyoufromscratchtoaneffectivetechnicalpresentation.Italsoofferstipsonhowtomanagethenervousnessassociatedwithspeakinginpublic.
LEARNING OUTCOMESThiscoursewillenableyouto:• planyourpresentationefficiently• organizeyourmaterialintoaneffectivestructure• createslidesthatgetthemessageacross• deliveryourpresentationeffectively,bothverballyandnonverbally• handleeventhemostdifficultquestions
INTENDED AUDIENCEThismaterialisintendedforanyonewhomustprepareanddeliveroralpresentations. Both novice and experienced speakers can expect tolearnmuchfromit.
INSTRUCTORJean-luc Doumont runs lectures,workshops, and trainingprogramsinoral,written,andgraphicalcommunicationforengineers,scientists,and managers worldwide. He is an engineer from the University ofLouvainandadoctorinappliedphysicsfromStanfordUniversity.Thiscourseisbasedonhispopularlectureonoralpresentationsatover15top-rankedengineeringschools(MIT,StanfordU,UCBerkeley,Caltech,Harvard,etc.).Thiscourse is free toSPIEStudentMembers,but youmust registertoattend.
Effective Scientific PapersWS908Course level: IntroductoryCEU .35 $75 / $125 USD Monday 1:30 to 5:30 pm
Strongwritingskillsareakeytosuccessforresearchers.Thiscourseproposesamethodologythatwilltakeyoufromscratchtoaneffectivescientific or technical document-a question of structure, not style.Theapproachisapplicableacrosslanguagesandforawiderangeofdocumenttypesbeyondscientificpapers,too.
LEARNING OUTCOMESThiscoursewillenableyouto:• planyourdocumentefficiently• createaneffectiveabstract,introduction,andconclusion• organizeyourmaterialintoanaccessiblestructure• constructparagraphsthatgetthemessageacross• writesentencesthatareeasytoread
INTENDED AUDIENCEThismaterial is intendedforanyonewhomustwriteoredit technicaldocuments ingeneralandscientificpapers inparticular.Bothnoviceandexperiencedwriterscanexpecttolearnmuchfromit.
INSTRUCTORJean-luc Doumont runs lectures,workshops, and trainingprogramsinoral,written,andgraphicalcommunicationforengineers,scientists,and managers worldwide. He is an engineer from the University ofLouvain and a doctor in applied physics from Stanford University.Thiscourseisbasedonhislecturesandworkshopsonscientificandtechnicalwritingatuniversitiesandresearchcentersaroundtheworld(MIT,Shell,Johnson&Johnson,etc.).Thiscourse is free toSPIEStudentMembers,but youmust registertoattend.
234 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Courses
Workshops for Optics Educators
KHET in the Classroom - Teaching Optics Principles using The Laser Game: KHET 2.0WS1081 NEWCourse level: IntroductoryCEU .00 $50 / $75 USD Monday 8:30 am to 12:30 pm
This course will lead participants though structured educationalactivitiesbasedonTheLaserGame:KHET2.0.Theseactivities,usingthekitprovided,canbeemployedbyteachersandoutreachvolunteersto educate and excite students about a variety of optical principles.KHETisanaward-winninggamethatuseslasersandmirroredpiecestostimulatespatialrelationshipsandlogicalthinking.Teachersusingthekithavediscoveredthatstudentsgetgenuinelyexcitedaboutlessonsbasedona“real”gameandlearnandretaintheinformationbetterthanwhentaughtintraditionallectureformats.Thekits,developedbytheinstructor(oneofthecreatorsofKHET)incollaboration with pre-college teachers, present an activity-orientedandinquiry-basedapproachthatsupportstheintroductionofthebasicprinciplesof lightandopticseducation.Whetheryouareconductinga class or assisting a teacher, the KHET Educational Kit will aid youin taking students from identification of prior knowledge through ahands-onprocess that includesquestioning,guidedexperimentation,group discussion and collaboration, and options for further researchandchallenge.
LEARNING OUTCOMESThiscoursewillenableyouto:• explaintherulesforplayingKHETandunderstandsomestrategic
principlesforwinning• usetheeducationalkitinaclassroomorothergroupsetting
toteachbasicopticsprinciples,includingreflection,refraction,diffraction,andfiltering
• useKHETasavehicleforexplainingthespecialaspectsoflaserlight
• considerstrategiesforservingasaneducationalresource,includingvolunteeringasaguestinstructorinaclassroomorafterschoolprogram,andcollaboratingwithSPIEStudentChapterstofacilitatetheireducationaloutreachefforts
INTENDED AUDIENCEScientists, engineers, technicians, managers, teachers, and collegestudentswhowishtolearnmoreabouthowtoengageinpre-collegeeducationaloutreach.Noparticular training inengineeringorscienceisrequired.
INSTRUCTORMichael LarsonMichaelLarsonearnedhisPhDfromMITin1992.HenowholdstheElPomarEndowedChairofEngineeringandInnovationand is a Professor of Mechanical Engineering at the University ofColoradoatColoradoSprings,wherehealsoservesastheAssociateVice Chancellor for Research and Innovation. With funding totalingmore than $7M from a variety of agencies, including the NSF, theU.S.AirForce,theMissileDefenseAgency,andprivatecorporations,Michaelhastackledanumberofprojectsrelatedtoopticalmethods,including laser/materials interactions related to medical applications.Michael has a passion for creativity and innovation. He has co-foundedtwocompanies,onebasedonamedicaldeviceheinventedandanotherbasedonaconsumerproduct,alaserboardgamecalledKHET.Dr.Larsonhasconductednumerousworkshopsonthetopicsofinnovationandcreativeproblemsolving.Hehasgarneredsixawardsfor outstanding teaching and conducted a program, with fundingfrom theLilly Foundation, to increasehigh school student interest inengineeringfields.
Optics Magic - Easy Demonstrations from the PHOTON ProjectsWS961Course level: IntroductoryCEU .30 $10 / $20 USD Wednesday 1:30 to 4:30 pm
Makeglassdisappear!Turna tomato intoaplum!Seea “solid”wallvanish before your eyes and more. It’s all done with optics! Thesemagicalinquiry-baseddemonstrationsinlightandvisionmaybeeasilyreplicated with inexpensive, commonly found supplies. Completeinstructionsandsupplierlistwillbeprovided.BasedonthePHOTONExplorations, these informative hands-on activities are some of thefavorite demonstrations of the teacher participants of the PHOTONprofessionaldevelopmentprojectsfundedbytheAdvancedTechnologyEducationprogramoftheNationalScienceFoundation.
LEARNING OUTCOMESThiscoursewillenableyouto:• Engagestudentsandothersininquiry-basedoutreachactivitiesthat
illustrateimportantopticsconceptssuchasreflection,refraction,diffraction,polarization,fluorescenceandphosphorescence
• Provideage-appropriate(middleschool)explanationsforopticalphenomena
• Conductan“opticsmagicshow”basedonseveraloftheincludeddemonstrations
INTENDED AUDIENCEThisworkshopisintendedforanyonewhowantsafewengaging,simpledemonstrationstotakeintotheircommunityforoutreachpurposes.
INSTRUCTORSJudy Donnelly is currently Professor of Physics at Three RiversCommunity Technical College and the 2003 recipient of the SPIEEducator of the Year award. She is the co-author of Author, “Light:Introduction to Optics and Photonics” and the co-creator of “LaserCamp”,ahands-onintroductiontoopticsandcareersforHighSchoolstudents.Nancy Magnani is Science Specialist and Program Facilitator forEASTCONN’s Teaching and Learning Services where her projectsinclude facilitating EASTCONN Science Council; Inter-district grantprograms providing authentic science learning opportunities to over700 students in northeastern Connecticut; and developing science-basedprofessionaldevelopmentforK-12teachers.
spie.org/opadvance · TEL:+13606763290 · help@spie.org 235
236 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Proceedings of SPIE
Searchable CD with Multiple ConferencesCDsarenowavailablewithin8weeksofthemeeting.
PC,Macintosh,andUnixcompatible.
Purchase additional print Proceedings of SPIE at the
low pre-publish price.Proceedings will be available an average
of 6 weeks after the meeting.
Vol# Title(Editor) PrepublicationPrice
8455 Metamaterials: Fundamentals and Applications V(A.D.Boardman/N.Engheta/M.A.Noginov/N.I.Zheludev)$125
8456 Nanophotonic Materials IX(S.Cabrini/T.Mokari) . . . . . . . . . . . . . . . . . . . . . . . . . . .$60
8457 Plasmonics: Metallic Nanostructures and Their Optical Properties X(M.I.Stockman)..................... $150
8458 Optical Trapping and Optical Micromanipulation IX(K.Dholakia/G.C.Spalding) . . . . . . . . . . . . . . . . . . . . . . $135
8459 Physical Chemistry of Interfaces and Nanomaterials XI(J.Clark/C.Silva) . . . . .$60
8460 Biosensing and Nanomedicine V(H.Mohseni/M.H.Agahi/M.Razeghi) . . . .$90
8461 Spintronics V (H.Drouhin/J.Wegrowe/M.Razeghi). . . . . . . . . . . . . . . . . . . . . . . . . .$90
8462 Carbon Nanotubes, Graphene, and Associated Devices V (D.Pribat/Y.Lee/M.Razeghi). . . . . . . . . . . . . . . . . . . . . . . . . .$60
8463 Nanoengineering: Fabrication, Properties, Optics, and Devices IX(E.A.Dobisz/L.A.Eldada) . . . . . . . . . . . . . . . . . . . . . . . . .$90
8464 Nanobiosystems: Processing, Characterization, and Applications V(N.Kobayashi/F.Ouchen/I.Rau) . . . . . . . . .$60
8465 Nanostructured Thin Films V(T.G.Mackay/Y.Jen/R.J.Martín-Palma) . . . . . .$80
8466 Instrumentation, Metrology, and Standards for Nanomanufacturing, Optics, and Semiconductors VI(M.T.Postek). . . . . . .$53
8467 Nanoepitaxy: Materials and Devices IV (N.P.Kobayashi/A.Talin/M.Islam). . . . . . .$60
Vol# Title(Editor) PrepublicationPrice
8474 Optical Processes in Organic Materials and Nanostructures (R.Jakubiak). . . . . . $70
8475 Liquid Crystals XVI(I.Khoo)........... $70
8476 ✓Organic Light Emitting Materials and Devices XVI(F.So) . . . . . . . . . . . . . . . . . .$100
8477 ✓Organic Photovoltaics XIII(Z.H.Kafafi).$90
8478 Organic Field-Effect Transistors XI(Z.Bao/I.McCulloch) . . . . . . . . . . . . . . . . . . $70
8479 Organic Semiconductors in Sensors and Bioelectronics V(R.Shinar). . . . . . . . . . . .$60
✓ Indicatesvolumesthatwillbeavailableatthemeeting.OtherProceedingswillbeavailableanaverageof6weeksafterthemeeting.
Vol# Title(Editor) PrepublicationPrice
8468 High and Low Concentrator Systems for Solar Electric Applications VII(K.VanSant/A.P.Plesniak) . . . . . . . . . . . . . . . . . . . . . . . .$53
8469 Solar Hydrogen and Nanotechnology VII(L.Vayssieres). . . . . . . . . . . . . . . . . . . . . . . .$60
8470 Thin Film Solar Technology IV (L.A.Eldada) . . . . . . . . . . . . . . . . . . . . . . . .$60
8471 Next Generation (Nano) Photonic and Cell Technologies for Solar Energy Conversion III(L.Tsakalakos) . . . . . . . . . .$60
8472 Reliability of Photovoltaic Cells, Modules, Components, and Systems V(N.G.Dhere) . . . . . . . . . . . . . . . . . . . . . . . . .$60
8473 Laser Material Processing for Solar Energy(E.W.Reutzel). . . . . . . . . . . . . . . . . . . . . . . .$60
Optics and Photonics 2012: Organic Photonics and Electronics(IncludesVols.8474-8479)OrderNo.CDS483Est.pub.October2012Meetingattendee:$135Nonattendeememberprice:$325Nonattendeenonmemberprice:$420
Optics and Photonics 2012: Solar Energy and Technology(IncludesVols.8468-8473,8477,8485)OrderNo.CDS482Est.pub.October2012Meetingattendee:$135Nonattendeememberprice:$355Nonattendeenonmemberprice:$470
Optics and Photonics 2012: NanoScience and NanoEngineering
(IncludesVols.8455-8467)OrderNo.CDS481Est.pub.October2012Meetingattendee:$135Nonattendeememberprice:$780Nonattendeenonmemberprice:$1040
Organic Photonics + ElectronicsSPIEOptics+Photonics
Solar Energy+TechnologySPIEOptics+Photonics
NanoScience+ EngineeringSPIEOptics+Photonics
Organic Photonics + ElectronicsSPIEOptics+Photonics
Solar Energy+TechnologySPIEOptics+Photonics
NanoScience+ EngineeringSPIEOptics+Photonics
spie.org/opadvance · TEL:+13606763290 · help@spie.org 237
Proceedings of SPIE
Vol# Title(Editor) PrepublicationPrice Vol# Title(Editor) PrepublicationPriceVol# Title(Editor) PrepublicationPrice
8480 The Nature of Light: Light in Nature IV(R.Liang) . . . . . . . . . . . . . . . . . . . . . . . . . . . .$45
8481 Optics Education and Outreach II (G.Gregory) . . . . . . . . . . . . . . . . . . . . . . . . .$60
8482 Photonic Innovations and Solutions for Complex Environments and Systems (PISCES)(A.Lakhtakia/J.A.Todd). . . . . . .$45
8483 Tribute to William Wolfe(M.G.Turner) . .$45
8484 Twelfth International Conference on Solid State Lighting and Fourth International Conference on White LEDs and Solid State Lighting(M.H.Kane/C.Wetzel/J.Huang) $80
8485 Nonimaging Optics: Efficient Design for Illumination and Solar Concentration IX(R.Winston/J.M.Gordon) . . . . . . . . . . . . . . . . .$60
8486 Current Developments in Lens Design and Optical Engineering XIII (R.Johnson/V.N.Mahajan/S.Thibault) . . . . . . . . . . . . . . . . . .$80
8487 Novel Optical Systems Design and Optimization XV(G.Gregory/A.J.Davis) $70
8488 Zoom Lenses IV(E.I.Betensky/T.Yamanashi) . . . . . . . . . . . . . . . . . . . . . . . .$53
8489 Polymer Optics and Molded Glass Optics: Design, Fabrication, and Materials II (D.H.Krevor/W.S.Beich/M.P.Schaub/S.M.Bäumer). . . . . . . . . . . . . . . . . . . . . . . . . . . . .$53
8490 Laser Beam Shaping XIII(A.Forbes/T.E.Lizotte). . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$53
8491 Optical System Alignment, Tolerancing, and Verification VI(J.Sasián/R.N.Youngworth) . . . . . . . . . . . . . . . . . . . .$53
8492 Optical System Contamination: Effects, Measurements, and Control 2012(S.A.Straka/N.Carosso/J.Egges) . . . . . . . . . . . .$53
8493 ✓Interferometry XVI: Techniques and Analysis(J.Schmit/K.Creath/C.E.Towers). . . . . . . . . . . . . . . . . . . . . . . . .$80
8494 ✓Interferometry XVI: Applications(C.Furlong/C.Gorecki/E.L.Novak). . . . . .$60
8495 Reflection, Scattering, and Diffraction from Surfaces III (L.M.Hanssen) . . . . . . . . . . . . $70
8496 Terahertz Emitters, Receivers, and Applications III(M.Razeghi/A.N.Baranov/H.O.Everitt/J.M.Zavada/T.Manzur). . . . .$60
8497 Photonic Fiber and Crystal Devices: Advances in Materials and Innovations in Device Applications VI (S.Yin/R.Guo) . .$80
8498 Optics and Photonics for Information Processing VI(A.A.Awwal/K.M.Iftekharuddin). . . . . . . . . . . . . . . . . . . . . . . . $70
8499 Applications of Digital Image Processing XXXV(A.G.Tescher). . . . . . . . . . . . . . . . .$105
8500 Image Reconstruction from Incomplete Data VII(P.J.Bones/M.A.Fiddy/R.P.Millane) . . . . . . . . . . . . . . . . . . . . . . . . .$60
8501 Advances in Metrology for X-Ray and EUV Optics IV(L.Assoufid/P.Z.Takacs/A.K.Asundi) . . . . . . . . . . . . . . . . . . . . . . . . .$45
8502 Advances in X-Ray/EUV Optics and Components VII(S.Goto/C.Morawe/A.M.Khounsary). . . . . . . . . . . . . . . . . . . . .$53
8503 Adaptive X-Ray Optics II (A.M.Khounsary/S.L.O’Dell/T.G.Bifano) . . . . . . . . . . . . . . .$45
8504 X-Ray Free-Electron Lasers: Beam Diagnostics, Beamline Instrumentation, and Applications(S.P.Hau-Riege/S.P.Moeller/M.Yabashi)...................$60
8505 Target Diagnostics Physics and Engineering for Inertial Confinement Fusion(P.Bell/G.P.Grim) . . . . . . . . . . . . . .$53
8506 Developments in X-Ray Tomography VIII(S.R.Stock) . . . . . . . . . . . . . . . . . . . . . . . . .$90
8507 Hard X-Ray, Gamma-Ray, and Neutron Detector Physics XIV(R.B.James/A.Burger/L.A.Franks/M.Fiederle) . . . . . . . . .$90
8508 Medical Applications of Radiation Detectors II(H.Barber/H.Roehrig) . . . . . .$45
8509 Penetrating Radiation Systems and Applications XIII (G.P.Grim/H.Barber) . .$53
8510 Earth Observing Systems XVII(J.J.Butler/X.Xiong/X.Gu) . . . . . . . . . . . . . . . . . . . . . . . . .$90
8511 Infrared Remote Sensing and Instrumentation XX(M.Strojnik/G.Paez)$70
8512 Infrared Sensors, Devices, and Applications II(P.D.LeVan/A.K.Sood/P.S.Wijewarnasuriya/A.I.D’Souza). . . . . .$60
8513 Remote Sensing and Modeling of Ecosystems for Sustainability IX (W.Gao/T.J.Jackson) . . . . . . . . . . . . . . . . . . . . . . . .$60
8514 Satellite Data Compression, Communications, and Processing VIII (B.Huang/A.J.Plaza/C.Thiebaut). . . . . . .$60
8515 Imaging Spectrometry XVII(S.S.Shen/P.E.Lewis). . . . . . . . . . . . . . . . . . . . . . . . . .$60
8516 Remote Sensing System Engineering IV(P.E.Ardanuy/J.J.Puschell) . . . . . . . . . . . .$53
8517 Laser Communication and Propagation through the Atmosphere and Oceans(A.M.vanEijk/C.C.Davis/S.M.Hammel/A.K.Majumdar). . . . . . . . . . . . . . . . . . . . . . $70
8518 Quantum Communications and Quantum Imaging X(R.E.Meyers/Y.Shih/K.S.Deacon)$60
8519 Nanophotonics and Macrophotonics for Space Environments VI(E.W.Taylor/D.A.Cardimona) . . . . . . . . . . . . . . . . . . . . .$53
8520 Unconventional Imaging and Wavefront Sensing 2012(J.J.Dolne/T.J.Karr/V.L.Gamiz). . . . . . . . . . . . . . . . . . . . . . . . . .$53
8521 Instruments, Methods, and Missions for Astrobiology XV(R.B.Hoover/G.V.Levin/A.Y.Rozanov/P.C.Davies) . . . . . . . . . . . . .$45
✓ Indicatesvolumesthatwillbeavailableatthemeeting.OtherProceedingswillbeavailableanaverageof6weeksafterthemeeting.
Optics and Photonics 2012: Optical Design and Systems Engineering, and Illumination Engineering
(IncludesVols.8480-8483,8484-8492,8497)OrderNo.CDS484Est.pub.October2012Meetingattendee:$135Nonattendeememberprice:$585Nonattendeenonmemberprice:$770
Optics and Photonics 2012: Optics and Photonics 2012: Advanced Metrology(IncludesVols.8493-8495,8466,8501)OrderNo.CDS485Est.pub.October2012Meetingattendee:$135Nonattendeememberprice:$220Nonattendeenonmemberprice:$285
Optics and Photonics 2012: Image and Signal Processing (IncludesVols.8498-8500)OrderNo.CDS486Est.pub.October2012Meetingattendee:$135Nonattendeememberprice:$165Nonattendeenonmemberprice:$220
Optics and Photonics 2012: X-Ray, Gamma-Ray, and Particle Technologies(IncludesVols.8501-8509)OrderNo.CDS487Est.pub.October2012Meetingattendee:$135Nonattendeememberprice:$375Nonattendeenonmemberprice:$500
Optics and Photonics 2012: Remote Sensing(IncludesVols.8510-8516,8496)OrderNo.CDS488Est.pub.October2012Meetingattendee:$135Nonattendeememberprice:$360Nonattendeenonmemberprice:$480
Optics and Photonics 2012: Atmospheric and Space Optical Systems(IncludesVols.8517-8521)OrderNo.CDS489Est.pub.October2012Meetingattendee:$135Nonattendeememberprice:$200Nonattendeenonmemberprice:$260
Optical Engineering+ ApplicationsSPIEOptics+Photonics
Optical Engineering+ ApplicationsSPIEOptics+Photonics
238 spie.org/opadvance · TEL:+13606763290 · help@spie.org
Participate in an international competition that recognizes cutting-edge products that break conventional ideas, solve problems, and improve life through photonics.Apply online by 14 September 2012: PrismAwards.org
APPLYNOW
Call for EntriesPrismAwards.org
PRESENTED BY SPIE & PHOTONICS MEDIA
thisprismadisbarelyholdingtogetherpatchedandnotgood
12–16 August 2012
2012
Advance Technical Program
Conference: 12–16 August 2012
Exhibition: 14–16 August 2012
San Diego Marriott Marquis and Marina, San Diego Convention CenterSan Diego, California, USA
- Stay on the forefront of research and innovation.
- Build your skills and improve your capability with training courses.
- Develop partnerships that will stay with you throughout your career.
Register online today!spie.org/opadvance
Helping engineers and scientists stay current
and competitive
SPIEDigitalLibrary.orgFind the answer
Defense& Security
SensorsBiomedicalOptics
Optics & Astronomy
Nano/Micro Technologies
Optoelectronics & Communications
Energy Lasers
top related