all rights reserved -...
TRANSCRIPT
IDENTIFICATION AND CHARACTERIZATION OF A NOVEL RECEPTOR-LIKE KINASE
INVOLVED IN THE INITIATION AND REGULATION OF ARABIDOPSIS INNATE
IMMUNITY.
by
XIN YANG
KATRINA M. RAMONELL, COMMITTEE CHAIR
JANIS M. O'DONNELLPERRY F. CHURCHILLMARGRET D. JOHNSON
AMY LITT
A DISSERTATION
Submitted in partial fulfillment of the requirementsfor the degree of Doctor of Philosophyin the Department of Biological Sciences
in the Graduate School ofThe University of Alabama
TUSCALOOSA, ALABAMA
2011
ii
ABSTRACT
Receptor-like kinases (RLKs) are known to be involved in the recognition of pathogen-
associated molecular patterns (PAMPs) and subsequently activate resistance pathways against
broad classes of pathogens. While initiation and maintenance of defense pathways is critical for
survival, mechanisms to damp down these responses are just as necessary though currently not as
well understood. We have identified CRLK1, an Arabidopsis RLK that is highly induced by
chitin at early time points and localizes to the plasma membrane. Knock-out mutants in crlk1 are
more susceptible to both biotrophic and necrotrophic fungal pathogens though the response of
the mutants to bacterial pathogens is unaffected. Interestingly expression ofMAPK3, an
important positive regulator of innate immunity, is increased in crlk1 mutants. Our data show
that CRLK1 is essential for the establishment of defense against biotrophic and necrotrophic
fungi and that the mutation in CRLK1 does not fully block chitin-enhanced Arabidopsis
resistance. We show that CRLK1 is a functional kinase in vitro and its kinase activity required
the presence of manganese. Overexpression of a 35S:CRLK1: GUS fusion protein in
Arabidopsis confers enhanced resistance to the powdery mildew pathogen Golovinomycetes
cichoracearum. In addition, CRLK1 induction by chitin is increased in mapk3 and several wrky
iii
mutants indicating that CRLK1 may be repressed by MAPK3 and WRKY transcription factors in
planta. The results presented provide important information about the function and regulation of
CRLK1 in Arabidopsis.
iv
DEDICATION
This dissertation is dedicated to everyone who had accompanied me and helped me
through the experiments and trials of creating this manuscript. In particular, my family and
colleagues whostood by me throughout the time taken to complete this masterpiece.
v
LIST OF ABBREVIATIONS AND SYMBOLS
AA amino acid
ACC 1-aminocyclopropane 1-carboxylic acid
BiFC Bimolecular fluorescence complementation
BIK1 Botrytis-induced kinase1
CEBiP chitin oligosaccharide elicitor-binding protein
CERK1 Chitin Elicitor Receptor Kinase 1
CRLK1 chitin-induced receptor-like kinase 1
CRG chitin responsive genes
CSC crab shell chitin
DAB diamino-benzidine
DAMP danger-associated molecular patterns
EMS ethyl methanesulfonate
EIX Ethylene-induced xylanase
ET ethylene
ETI effectors-triggered immunity
vi
GFP green fluorescent protein
IP immunoprecipitation
JA jasmonic acid
OG oligogalacturonide
SDS-PAGE sodium dodecyl sulfate polyacrylamide gel electrophoresis
MAPK mitogen-activated protein kinase
MBP myelin basic protein
MS mass spectrometry
PAMP pathogen associated molecular pattern
PRR pattern recognition receptors
PTI PAMP-triggered immunity
qRT-PCR quantitative reverse transcriptase–polymerase chain reaction
RLK receptor-like kinase
RLP receptor-like protein
RLCK receptor-like cytoplasmic kinase
RNAi RNA interference
ROS reactive oxygen species
SA Salicylic acid
viii
ACKNOWLEDGMENTS
I am pleased to dedicate this dissertation to all people who have helped and supported me
during the past five years. The faculty in Department of Biological Sciences provided unselfish
help to me. Dr. Katrina Ramonell, my mentor, recruited me as a graduate student from oversea
and mentored me in pursuing Ph.D. in the area of plant-microbe interactions. She instructed me
for not only techniques for experiments but also supported tremendously with her inspiration and
encouragement. I was supported through out five years with teaching/research assistantships and
Alabama EPSCoR Fellowship with the help of Dr. Ramonell. Dr. Margret Johnson taught me
how to critique and think in a way of scientists. Dr. Perry Churchill helped me with
biochemistry work in this dissertation and enlightened me to explore more information about my
CRLK1. Dr. Janis O'Donnell guided me to the world of genetics and modern molecular
techniques in studying model organism. It is my pleasure to have them all as my committee
members and I would like to thank them for their great support during the past five years. I
would also to thank my parents and my wife Ning for loving me and supporting my decision of
being a graduate student in Alabama. I also appreciate the support and concern by Dr. David
ix
Wang, Mr. Zaicun Zhang and Mrs. Huizhong Chen. Finally I want to give my thanks to my
labmates Mr. Jay Antico and Mrs. Fengyan Deng for their help and friendship.
x
CONTENTS
ABSTRACT................................................................................................ ii
DEDICATION............................................................................................iv
LIST OF ABBREVIATIONS AND SYMBOLS........................................ v
ACKNOWLEDGMENTS........................................................................viii
LIST OF TABLES.....................................................................................xii
LIST OF FIGURES..................................................................................xiii
CHAPTER ONE: AN INTRODUCTION TO RLKS/RLPS ANDCRLK1 INVOVLED IN PLANT INNATE IMMUNITY.......................... 1
CHAPTER TWO: CHARACTERIZATION OF A NOVELRECEPTOR-LIKE KINASE INVOLVED IN THE INITIATION ANDREGULATION OF ARABIDOPSIS INNATE IMMUNITY...................22
INTRODUCTION..................................................................................... 22
MATERIALS AND METHODS...............................................................24
RESULTS.................................................................................................. 29
DISCUSSION............................................................................................47
REFERENCES.......................................................................................... 51
xi
CHAPTER THREE: CRLK1 IS A FUNCTIONALMANGANESE-DEPENDENT RECEPTOR-LIKE KINASEINVOLVED IN DEFENSE AGAINST FUNGAL PATHOGENS................................................................................................................... 54
INTRODUCTION..................................................................................... 54
MATERIALS AND METHODS...............................................................56
RESULTS.................................................................................................. 63
DISCUSSION............................................................................................81
REFERENCES.......................................................................................... 86
CHAPTER FOUR: SUMMARY OF WORK ANDFUTURE DIRECTIONS .......................................................................... 89
REFERENCES.......................................................................................... 97
xii
LIST OF TABLES
Table 1.1 The list of RLKs and RLPs involved inplant innate immunity................................................................................ 17
Table 1.2 Gene name, locus and mutant accessionnumber of seven receptor-like kinases selectedfrom chitin-responsive genes.................................................................... 20
Table 3.1 Potential phosphorylation sites inphospho-peptide identified from MS/MS.................................................. 71
xiii
LIST OF FIGURES
Figure 1.1 Average numbers of conidiophores per colony (c/c)on receptor-like kinase mutants, Col-0 wild type and NahG.....................21
Figure 2.1 Crlk1 is more susceptible to G. cichoracearum butexhibits normal ROS production............................................................... 32
Figure 2.2 Crlk1 is more susceptible to the necrotroph P. cucumerina....34
Figure 2.3 Expression of CRLK1 after chitin, ACC, MeJA andSA treatments.............................................................................................37
Figure 2.4 CRLK1 encodes a RLK that has multiple W-boxesin its promoter sequence and is localized to the plasma membrane.......... 40
Figure 2.5 Histochemical staining of GUS activity in transgenicArabidopsis harboring pCRLK1::GUS......................................................43
Figure 2.6 Expression ofMAPK3 andWRKY53 after chitintreatment in Col-0 wild type and crlk1...................................................... 46
Figure 2S1 Crlk1 is not compromised in its resistance tobacterial pathogens.....................................................................................35
Figure 2S2 Wound-induced GUS expression in pCRLK1::GUStransgenic Arabidopsis plants.................................................................... 44
Figure 3.1 A phylogenetic tree based on protein sequence alignmentof CRLK1 and seven related proteins........................................................64
Figure 3.2 Subdomains and predicted phosphorylation sitesof CRLK1.................................................................................................. 66
xiv
Figure 3.3 Purification and in vitro kinase assay of truncated CRLK1(ΔTM-CRLK1) in E.coli............................................................................69
Figure 3.4 Phenotypes of Arabidopsis CRLK1 mutants andoverexpression lines...................................................................................75
Figure 3.5 CRLK1 gene expression in Arabidopsis organs andunder various treatments/conditions.......................................................... 79
Figure 3.6 Expression of CRLK1 after chitin treatment in MAPKandWRKY mutants.................................................................................... 80
Figure 3S1 Prediction of CRLK1 transmembrane domain.......................65
Figure 3S2 Phospho-peptides identified from MS/MS for CRLK1......... 72
Figure 3S3 Sequence alignment of CRLK1 with Arabidopsiskinase (AT), Arachis kinase (AH) and conversed manganesedependent kinase domain (Accession number COG0515)........................ 83
Figure 4.1 Model of CRLK1 in chitin-mediated innate immunity............96
1
CHAPTERCHAPTERCHAPTERCHAPTERONEONEONEONE
ANANANAN INTRODUCTIONINTRODUCTIONINTRODUCTIONINTRODUCTION TOTOTOTO RECEPTOR-LIKERECEPTOR-LIKERECEPTOR-LIKERECEPTOR-LIKE KINASES/RECEPTOR-LIKEKINASES/RECEPTOR-LIKEKINASES/RECEPTOR-LIKEKINASES/RECEPTOR-LIKE PROTEINSPROTEINSPROTEINSPROTEINSANDANDANDAND CRLK1CRLK1CRLK1CRLK1 INVOVLEDINVOVLEDINVOVLEDINVOVLED ININININ PLANTPLANTPLANTPLANT INNATEINNATEINNATEINNATE IMMUNITYIMMUNITYIMMUNITYIMMUNITY
SignificanceSignificanceSignificanceSignificance ofofofof studyingstudyingstudyingstudying plantplantplantplant andandandand microbemicrobemicrobemicrobe interactionsinteractionsinteractionsinteractions
Plants constantly undergo pathogen attack during their life cycles. These pathogens
include a variety of fungi (ex. powdery mildew), bacteria, viruses, and nematodes. The ability to
recognize different classes of pathogens is critical for plants to initiate timely defense responses.
Plants have evolved complicated defense mechanisms to resist pathogens and plant pathogens
have also co-evolved with their hosts to suppress defense responses and favor infection.
Among the classes of pathogens, fungi are recognized as one of the major causes of crop
yield loss. For example, Magnaporthe grisea , an ascomycete fungus that infects rice, can cause
yield losses equaling 25% of rice production every year (Ribot et al. 2008). Fungal pathogens
also account for a 15% decrease in barley yield, which accounts for 7.5% of worldwide barley
production (Oerke et al 2004). Our work is focused on the fungal pathogen powdery mildew, a
disease of more than 9000 plant species caused by members of the Erysiphales. Every year
powdery mildew is responsible for large losses in yield of numerous agriculturally important
crops such as cereals, vegetables, and fruit trees. Tremendous effort has been focused on
developing methods that may be used to control the spread of powdery mildew on crops.
Current research in the Ramonell lab is concentrated on understanding broad spectrum
defense responses (innate immunity) in plants against the powdery mildew pathogen. In
particular we are interested in unraveling the signal transduction pathways that are triggered in
2
plants by exposure to the fungal elicitor chitin. The innate immune response is an ancient form
of defense against pathogens that is shared by plants, insects and vertebrates (Nurnberger and
Scheel, 2001). It involves the recognition of general pathogen-associated elicitors followed by a
rapid induction of basal defense responses. An improved understanding of innate immunity will
be beneficial in the design of crops with increased natural resistance to fungal pathogens.
PlantPlantPlantPlant innateinnateinnateinnate immunityimmunityimmunityimmunity
Unlike animals, plants do not have an adaptive immune system, which could recognize
and respond to a vast number of pathogens. Plants have evolved multiple lines of defense to
protect themselves from pathogen attack. In order to activate these defense responses, plants
perceive and recognize pathogens through Pattern Recognition Receptors (PRRs). The plant
genome encodes a large number of PRRs that recognize conserved microbial signatures called
pathogen-associated molecular patterns (PAMPs). Once PRRs perceive pathogens via PAMPs,
downstream signaling pathways are activated to mount defense responses such as the
hypersensitive response (HR) and the production of antimicrobial secondary metabolites. To
suppress PAMP-triggered immunity (PTI), pathogens deliver effectors into plant cells that target
key components of plant immunity. For example, the bacterial effector AvrPtoB targets and
ubiquitinates the Arabidopsis receptor CERK1 for degradation (Gimenez-Ibanez et al. 2009)
overcoming CERK1-mediated defense responses. In turn, some plant species have also evolved
resistance (R) proteins that recognize pathogen effectors either directly or indirectly and initiate
effector-triggered immunity (ETI), also known as the gene-for-gene model. Recent studies have
shown that PTI and ETI share signaling pathways that overlap significantly (Tsuda et al. 2009)
and PRRs have been shown to physically associate with R proteins in vivo (Qi et al. 2011). Both
3
PTI and ETI are essential for plant immunity in order to restrict pathogen invasion. Due to the
importance of PRRs in recognizing microbial signatures, transgenic plants overexpressing
exogenous PRRs have been created to confer broad-spectrum resistance to bacterial pathogens
(Lacombe et al. 2010).
TheTheTheThe rolerolerolerole ofofofof receptor-likereceptor-likereceptor-likereceptor-like kinases/proteinskinases/proteinskinases/proteinskinases/proteins inininin plantplantplantplant innateinnateinnateinnate immunityimmunityimmunityimmunity
Receptor-like kinases (RLKs) and Receptor-like proteins (RLPs) in plants are involved in
many biological processes including development, innate immunity, cell differentiation and
patterning, nodulation and self-incompatibility. As more and more plant genome sequences have
become available, the number of genes annotated as RLKs or RLPs in plants has been growing.
The Arabidopsis genome contains more than 600 RLKs and 57 RLPs, accounting for almost
2.5% of the Arabidopsis genome (Shiu et al. 2001; Wang et al. 2008). The rice genome contains
2,210 RLKs and more than 443 of rice RLKs appear to share common ancestors with
Arabidopsis RLKs (Shiu et al. 2004). Ninety genes were predicted to be RLPs in the rice
genome and 73 of these are believed to be involved in pathogen defense (Fritz-Laylin et al.
2005). Additionally, over 650 RLKs were identified in the soybean genome by searching for
RLK homologs in an EST database (Liu et al. 2009). While the functions of most RLKs and
RLPs are unknown, increasing experimental data points to their importance in the plant.
A typical RLK contains an extracellular domain, a transmembrane domain (TM) and an
intracellular kinase domain. Some RLKs lack an extracellular domain and are designated as
receptor-like cytoplasmic kinases (RLCKs). RLPs are composed of an extracellular domain, a
transmembrane domain and a short cytoplasmic region and lack an associated kinase domain
(Wang et al. 2008). The extracellular domains of both RLKs and RLPs function primarily in
4
recognition of either endogenous or exogenous molecular cues. For example, extracellular
leucine-rich repeat domains (eLRR) in RLKs are well characterized and have been shown to be
involved in recognition of general elicitors (FLS2, Gomez-Gomez and Boller 2000) and plant
hormones (BRI1, Li and Chory 1997). Some RLK/RLP extracellular domains have also been
shown to bind carbohydrate derivatives such as chitin (CERK1, Iizasa et al. 2010) and
oligogalacturonide (WAK1, Decreux and Messiaen 2005). The transmembrane domain (TM) is
critical for localization of RLKs and RLPs to the plasma membrane and deletion of the TM
domain results in cytoplasmic localization of an RLK (Bleckmann et al. 2010). Additionally,
transmembrane domains are known to play critical roles in many protein-protein interactions
(Reviewed by Senes et al. 2004). The intracellular kinase domain of RLKs is involved in
phosphorylation of other proteins to relay signals and initiates downstream signaling pathways.
Interestingly, a large number of RLKs are actually receptor-like cytoplasmic kinases (RLCKs).
It has been reported that there are 379 putative RLCKs in the rice genome (Vij et al. 2008) and
200 RLCKs in Arabidopsis (Jurca et al. 2008). Since they lack an extracellular domain, RLCKs
do not perceive a signal directly but interact with other receptors to form a complex that then
proceeds to amplify the downstream signal (Rowland et al. 2005; Veronese et al. 2006; Lu et al.
2010). In the last decade, many RLKs and RLPs have been characterized that function in plant-
pathogen interactions and have critical roles in the initiation and transduction of signals in major
plant defense pathways. In this chapter, we will summarize our current understanding of RLKs
and RLPs that are involved in plant innate immunity and what is known regarding their
mechanism of action in plant defense pathways. An overview of all RLKs and RLPs discussed in
this review is summarized in table 1.
5
RLKsRLKsRLKsRLKs andandandand RLPsRLPsRLPsRLPs areareareare involvedinvolvedinvolvedinvolved inininin defensedefensedefensedefense againstagainstagainstagainst fungalfungalfungalfungal pathogenspathogenspathogenspathogens viaviaviavia PAMPPAMPPAMPPAMP andandandand DAMPDAMPDAMPDAMP
recognitionrecognitionrecognitionrecognition
Plants recognize and respond to pathogen attack by sensing pathogen-associated
molecular patterns (PAMPs), pathogen effectors and danger-associated molecular patterns
(DAMPs) (Reviewed by Postel and Kemmerling 2009). To date, many elicitors have been
identified that originate from either the pathogen; such as the fungal elicitors chitin and xylanase
and the bacterial elicitors flg22, EF-Tu and lipopolysacchride, or from plants themselves; such as
oligogalacturonide (OG) and the peptide signal Pep1 (Reviewed by Postel and Kemmerling
2009). However, only a few RLKs and RLPs have been identified that act as receptors for these
known elicitors.
For example, both the RLP Chitin oligosacchride elicitor-binding protein (CEBiP) and
RLK Chitin Elicitor Receptor Kinase 1 (CERK1) contain LysM domains that have been shown
to bind chitin and trigger chitin-mediated defense signaling (Kaku et al. 2006; Miya et al. 2007;
Wan et al. 2008; Shimizu et al. 2010). CEBiP was purified from suspension-cultured rice cells
and shown to bind chitin fragments. Microarray analysis showed that a majority of chitin-
responsive genes did not respond to chitin treatment in CEBiP-RNAi knockdown rice cells
(Kaku et al. 2006). Transgenic rice plants were also constructed to suppress the CEBiP
transcripts using RNA interference (RNAi). Data from these experiments showed that CEBiP
RNAi lines had more cells penetrated by the rice blast fungus Magnaporthe oryzae.
Overexpression of CEBiP in rice repressed M. oryzae infection to some extent and increased
levels of reactive oxygen species (ROS) produced (Kishimoto et al. 2010). The barley HvCEBiP
protein is an ortholog of CEBiP that shares 60% amino acid identity with the rice protein. When
barley HvCEBiP was silenced using virus-induced gene silencing (VIGS), the silenced plants
6
developed more severe symptoms compared to control plants inoculated with the fungal
pathogenM. oryzae mossd1,a mutant that fails to infect rice and barley (Tanaka et al. 2010). The
rice ortholog of CERK1, OsCERK1, was identified from a group of 10 rice LysM RLKs and
shown to interact with CEBiP (Shimizu et al. 2010) Similar to CEBiP, knockdowns of
OsCERK1 in RNAi rice cell lines also blocked the induction or repression of most chitin
responsive genes upon chitin treatment. ROS induced by chitin was also suppressed in
OsCERK1-RNAi cell lines (Shimizu et al. 2010). In Arabidopsis, CERK1 was shown to be the
major receptor that binds and perceives chitin elicitors (Wan et al. 2008; Miya et al. 2007; Iizasa
et al. 2010). Arabidopsis CERK1 knockout mutants exhibited impaired immunity to the
biotrophic fungus Golovinomycetes cichoracearum and the necrotrophic fungus Alternaria
brassicicola. Although three other CEBiP-like proteins were also identified in Arabidopsis, their
functions remain unknown (Wan et al. 2008).
Ethylene-induced xylanase (EIX) is a potent fungal elicitor that stimulates ethylene
production, the alkalinization response and necrosis when applied to tobacco and tomato leaves
(Enkerli et al. 1999). Two genes LeEix1 and LeEix2 were identified from tomato as LRR RLPs
potentially involved in the response to this elicitor (Ron and Avni 2004). EIX-induced cell death
was suppressed in LeEix1-RNAi transgenic Nicotianana tabacum cv Samsun plants that are
known to respond to EIX. Interactions between EIX and tobacco cells were not detected in
silenced lines. The study showed that while both LeEIX1 and LeEIX2 proteins were able to bind
EIX only LeEIX2 was capable of inducing the hypersensitive response (HR) (Ron and Avni
2004). Recent work by Bar et al. (2010) showed that LeEIX1 and LeEIX2 interact with each
other in tobacco cells upon EIX treatment.
7
The function of LeEIX1 in tobacco appears to be to attenuate EIX-induced LeEIX2 endocytosis
and subsequent EIX-induced defense responses (Bar et al. 2010).
Elicitins are conserved extracellular proteins that are secreted by the fungal pathogen
Phytophthora infestans. Treatment of plants with elicitins triggers the hypersensitive response
(HR) and necrotic lesions in tobacco (Ricci et al. 1989). NbLRK1, a lectin RLK found in
Nicotiana benthamiana, was identified as an interactor of the protein INF1, an elicitin from P.
infestans (Kanzaki et al. 2008). Yeast two-hybrid experiments using a series of truncated
NbLRK1 proteins showed that INF1 interacted with the VIb subdomain of NbLRK1’s
intracellular kinase domain. In NbLRK1-silenced tobacco plants, INF1-induced H2O2 production
was inhibited and the HR response was delayed. Another RLK, NgRLK1, was discovered in
Nicotiana glutinosa and has been shown to interact directly with the fungal elicitin capsicein
from Phytophthora capsici (Kim et al. 2009). Both NbLRK1 and NgRLK1 are potential
candidate genes for elicitin-mediated immunity though no direct evidence for a role in innate
immunity has been shown to date.
Oligogalacturonide (OG) is known to trigger extensive gene expression in plants and is
classified as a DAMP generated from plant cell wall pectin (Denoux et al. 2008; Postel and
Kemmerling 2009). Arabidopsis Wall-Associated Kinase 1 (WAK1) is a receptor-like kinase
that interacts with pectin and OG in vitro (Decreux and Messiaen 2005; Decreux et al. 2006). In
a chimeric receptor study, the WAK1 extracellular domain was shown to interact with OGs and
activate downstream defense responses (Brutus et al. 2010). Arabidopsis plants over-expressing
WAK1 were more resistant to the necrotrophic fungi Botrytis cinerea (Brutus et al. 2010).
8
OsWAK1, a homolog of WAK1 identified in rice, was induced significantly by M. oryzae
infection and over-expression of OsWAK1 in rice plants conferred increased resistance to M.
Oryzae (Li et al. 2009).
Another plant DAMP, Arabidopsis peptide 1 (AtPep1), is a 23 amino acid peptide
derived from a 92 aa precursor found in leaf tissue (Huffaker et al. 2006). Treatment of
Arabidopsis plants with AtPep1 induces expression of the defense marker gene PDF1.2 and
production of H2O2.Over-expression of AtPep1 in Arabidopsis confers increased resistance to
the oomycete Pythium irregulare (Huffaker et al. 2006). An ortholog of AtPep1, ZmPep1, was
identified in corn and pretreatment of maize plants with this peptide enhanced plant resistance to
the fungal pathogens Cochliobolis heterostrophus and Colletotrichum graminicola (Huffaker et
al. 2011). The receptor for AtPep1 (AtPepR1) was isolated from Arabidopsis suspension-
cultured cells and identified as an LRR RLK (Yamaguchi et al. 2006). Another protein, AtPepR2,
was first identified as a homolog of AtPepR1 in Arabidopsis but was subsequently found to
interact directly with AtPep1 (Yamaguchi et al. 2010). Plants with mutations in both proteins
(pepr1/ pepr2) were completely insensitive to AtPep1 treatment while single mutations in either
pepr1 or pepr2 showed only partial insensitivity to AtPep1 treatment (Krol et al.2010). However,
there was no significant difference in the response of wild type and pepr1, pepr2 and
pepr1/pepr2 mutants infected with the fungal pathogens P. irregulare and A. brassicicola
without AtPep1 pretreatment (Yamaguchi et al. 2010). Though compelling this data cannot
exclude the possibility that AtPepR1 and AtPepR2 function in AtPep1-mediated resistance
against fungal pathogens in some capacity.
OrphanOrphanOrphanOrphan RLKs/RLPsRLKs/RLPsRLKs/RLPsRLKs/RLPs involvedinvolvedinvolvedinvolved inininin defensedefensedefensedefense againstagainstagainstagainst fungalfungalfungalfungal pathogenspathogenspathogenspathogens
9
While ligands have been identified for a few RLKs/RLPs, the binding partners of most
RLKs/RLPs in the plant genome remain unknown. Several orphan RLKs/RLPs have been
shown to be important in plant innate immunity, though their mechanism of action was revealed
only by further study. Llorente et al. surveyed 75 Arabidopsis accessions and found that
Landsberg erecta (Ler-0) was highly susceptible to the necrotrophic fungi Plectosphaerella
cucumerina (Llorente et al. 2005). QTL analysis showed that the LRR RLK ERECTA was a
candidate gene for Ler-0’s resistance to P.cucumerina. Loss-of-function mutants in ERECTA
showed that both the receptor and kinase domains were required for resistance to P. cucumerina
(Llorente et al. 2005) and to the oomycete pathogen Pythium irregulare (Adie et al. 2007).
Further experimentation showed that ERECTA-mediated resistance was associated with cell wall
content alteration suggesting that ERECTA may also function as a sensor for cell wall integrity
in plants (Sanchez-Rodriguez et al. 2009).
In Arabidopsis, BOTRYTIS-INDUCED KINASE 1 (BIK1) is highly induced by
inoculation with the necrotrophic fungi Botrytis cinerea. T-DNA insertional mutants of bik1
displayed more severe disease symptoms than wild type plants inoculated with B.cinerea and A.
brassicicola. Interestingly, bik1 is more resistant to the bacterial pathogen P. syringae DC3000,
suggesting that BIK1 regulates basal resistance to pathogens instead of race-specific resistance
(Veronese et al. 2006). The tomato homolog of BIK1, TPK1b was shown to be induced by
various stimuli including infection with Botrytis cinerea and Pseudomonas syringae pv. tomato
DC3000 (Pst DC3000), wounding, and treatment with the herbicide paraquat. TPK1b RNAi
plants showed increased susceptibility to Botrytis and supported more fungal growth than wild
type plants. However, data showed that TPK1b was not required for resistance to the bacterial
pathogen Pst DC3000. Over-expression of TPK1b in Arabidopsis suppressed the susceptible
10
phenotype of the bik1 mutant suggesting that TPK1b and BIK1 may have similar functions in
plant innate immunity (Abuqumar et al. 2008).
Another orphan RLK, OsBRR1 from rice, is highly induced by infection with the rice
blast fungi M. oryzae. Knockdowns of OsBRR1 in RNAi transgenic plants displayed increased
susceptibility to a weakly virulent isolate ofM. oryzae. OsBRR1 expression is not induced
significantly by ABA, SA, or JA suggesting that it is not involved in the defense pathways
mediated by these hormones (Peng et al. 2009). In wheat, TaRLK-R1, 2 and 3 were identified
and cloned as three receptor-like kinases that were induced by stripe rust infection. Virus-
induced gene silencing of TaRLK-R1, 2 and 3 transcripts resulted in more senescence-like
symptoms and the appearance of more rust sori on infected leaves (Zhou et al. 2007).
Two homologs of Arabidopsis BAK1/SERK3 were found in N. Benthamiana and
knockdowns of both genes using VIGS lines resulted in enhanced susceptibility to P. infestans
but not to P. mirabilis, an avirulent species. In tobacco plants NbSERK3A/B was shown to be
required for INF1-triggered innate immunity since silencing and NbSERK3A/B lead to a
significant reduction in cell death in INF1-treated tobacco (Chaparro-Garcia et al. 2011). The
oomycete pathogen Hyaloperonospora parasitica (Hp) Waco9 was able to infect NbSERK3-
silenced N. benthamiana but not wild type plants (Heese et al. 2007) suggesting a general role
for SERK3/BAK1 in plant innate immunity.
The BROAD-SPECTRUM RESISTANCE 1 (BSR1) protein was identified as a rice
receptor-like cytoplasmic kinase (RLCK) in a screen for Pst DC3000 resistant rice-FOX
Arabidopsis lines that over-express full-length rice cDNAs (Dubouzet et al. 2010). Over-
expression lines of BSR1 in Arabidopsis were also resistant to the hemitrophic fungal pathogen
11
Colletotrichum higginsianum. Transgenic rice lines over-expressing BSR1 were more resistant to
the rice fungal pathogenMagnaporthe grisea.
The Ve1 gene has also been shown to be an RLK that plays an important role in
resistance against Verticillium wilt diseases (Fradin et al. 2009). Fradin et al (2009) compared
coding sequences of Ve1 among several resistant and susceptible tomato cultivars. A single
nucleotide deletion that resulted in a truncated Ve1 protein was found only in susceptible but not
in resistant cultivars of tomato. Silencing of Ve1 via VIGS compromised the resistance of
tomato plants to Verticillium dahliae. Meanwhile over-expression of Ve1 in susceptible tomato
cultivars enhanced plant resistance to V. dahliae and Verticillium albo-atrum.
The Apple Vf locus contains four orphan LRR RLPs (Vfa1, Vfa2, Vfa3 and Vfa4) that
confer resistance to the fungal pathogen Venturia inaequalis (Xu and Korban 2002).
Introduction of Vfa1 and Vfa2 into two apple cultivars (Galaxy and McIntosh) enhanced
resistance to Venturia inaequalis compared to non-transformed plants (Malnoy et al. 2008;
Belfanti et al. 2004). Interestingly, Vfa4 is a negative regulator of apple innate immunity as Vfa4
transformants are more susceptible to V. inaequalis.
NegativeNegativeNegativeNegative RegulatorsRegulatorsRegulatorsRegulators ofofofof PlantPlantPlantPlant InnateInnateInnateInnate ImmunityImmunityImmunityImmunity
Although many RLKs/RLPs are involved in positive regulation of defense against
pathogens, several have been identified that act as negative regulators of plant innate immunity.
For example, FERONIA (FER), an RLK controlling pollen tube reception, plays a critical role in
negatively regulating Arabidopsis defense against the powdery mildew Golovinomyces orontii
(Kessler et al. 2010). Due to the similarity between powdery mildew hyphal tip growth and plant
pollen tube reception, it is hypothesized that powdery mildew may produce ligands similar to
12
that of plant pollen tube cells, which may cause FER-mediated susceptibility (Govers and
Angenent, 2010).
Another negative regulator in Arabidopsis innate immunity is the BAK1-interacting
receptor-like kinase (BIR1) (Gao et al. 2009). T-DNA insertional mutations in BIR1 cause over-
accumulation of H2O2 and SA. The bir1-1 mutant is highly resistant to the oomycete
Hyaloperonospora parasitica Noco2. Another protein, SOBIR1, (suppressor of BIR1), also
encodes an LRR RLK and suppressed the cell death and resistance phenotype observed in the
BIR1 mutant. The authors showed that SOBIR1 alone is not required for basal resistance to Pst
DC3000; however, over expression of SOBIR1 in Arabidopsis can induce cell death and enhance
resistance to bacterial pathogens (Gao et al. 2009).
Receptor-likeReceptor-likeReceptor-likeReceptor-like kinases/proteinskinases/proteinskinases/proteinskinases/proteins areareareare involvedinvolvedinvolvedinvolved inininin defensedefensedefensedefense againstagainstagainstagainst bacterialbacterialbacterialbacterial pathogenspathogenspathogenspathogensPositivePositivePositivePositive regulatorsregulatorsregulatorsregulators inininin defensedefensedefensedefense againstagainstagainstagainst bacteriabacteriabacteriabacteria
Many RLKs/RLPs are involved not only in resistance to fungal pathogens but also in
resistance to bacterial pathogens. For example, Arabidopsis CERK1/LysM RLK1 was reported
to be targeted and ubiquitinated for degradation by AvrPtoB, a type III effector of the bacterial
pathogen P. Syringae. In the absence of AvrPtoB, AtCERK1/LysM RLK1 plays a critical role in
restricting bacterial growth in Arabidopsis (Gimenez-Ibanez et al. 2009), suggesting that
AtCERK1/LysM RLK1 may bind an unknown PAMP in bacteria. The ERECTA RLK was also
shown to play a role in defense against Ralstonia solanacearum, the causal agent of bacterial wilt
(Godiard et al. 2003). Null mutations in SNC2 lead to impairment of basal resistance in
Arabidopsis resulting in more bacterial growth on the plant (Zhang et al. 2010). The rice
receptor-like cytoplasmic kinase BSR1 confers resistance to Pst DC3000 in Arabidopsis and to X.
oryzae pv. oryzae (Xoo) in rice (Dubouzet et al. 2010). Additionally, silencing of NbSERK3 in N.
13
Benthamiana enhances susceptibility to the bacterial pathogens P. syringae pv. tabaci 11528
(Pta 11528), P. syringae pv. Tomato DC3000 (Pto DC3000) and the nonpathogenic strain Pto
DC3000 hrcC (Heese et al. 2007).
Besides RLKs/RLPs listed above, many RLKs/RLPs have only been investigated for
their role in bacterial resistance. The Flagellin-sensitive 2 (FLS2) and EF-Tu (EFR) receptors
are LRR RLKs that bind the bacterial PAMPs flg22 and EF-Tu respectively (Gomez-Gomez and
Boller 2000; Zipfel et al. 2006). Null mutations in FLS2 or EFR render mutant plants insensitive
to their ligands (flg22 or elf18 respectively) resulting in susceptibility to bacterial pathogens
(Zipfel et al. 2004; Zipfel et al. 2006). Expression of EFR in N. benthamiana and tomato, which
are insensitive to elf18, causes ROS production and expression of defense-responsive genes upon
elf18 treatment (Lacombe et al. 2010). Transgenic N. Benthamiana and tomato plants expressing
EFR showed increased resistance to bacterial pathogens when compared to wild type plants.
Mutations in the RLKs AtPepR1 and AtPepR2 also impact resistance to bacterial pathogens.
Both pepr1 and pepr2 mutants displayed no difference in their resistance response compared to
wild type plants after inoculation with Pst DC3000 without AtPep1 pretreatment (Yamaguchi et
al. 2010). However upon pretreatment of wild type, pepr1 or pepr2 plants with AtPep1, there
was a marked reduction in the disease symptoms caused by infection with Pst DC3000. AtPep1
pretreated pepr1/pepr2 double mutants had a similar level of susceptibility to Pst DC3000 to the
untreated double mutant plants suggesting that both AtPepR1 and AtPepR2 are required for
initiating AtPep1-mediated defense responses against bacterial pathogens (Yamaguchi et al.
2010).
The rice RLK XA21 confers resistance to a broad spectrum of Xoo (Xanthomonas oryzae
pv. oryzae) races through the recognition of a sulfated peptide Ax21 (activator of XA21-
14
mediated immunity) (Lee et al. 2009). Transgenic plants carrying Xa21 are highly resistant to 29
of 32 Xoo isolates from eight countries (Wang et al. 1996). Xa21D, a natural variant of Xa21,
encodes a receptor-like protein that carries an LRR domain but lacks the transmembrane and
kinase domains. Plants carrying Xa21D also recognize pathogens carrying Ax21 and display
partial resistance to Xoo (Wang et al. 1998). Taken together these data indicate that Xa21 may
recognize Ax21 through its LRR domain. Another RLK/RLP in rice, Xa3/Xa26/Xa22(t), also
confers resistance to Xoo. Transgenic plants carrying Xa26 displayed high levels of resistance to
Xoo. Xa21 and Xa26 are the only two confirmed RLK/RLP resistance (R) genes and although
they both confer resistance to Xoo there are differences between the mechanisms the two genes
use to mediate immunity. Xa21-mediated resistance increases progressively from the susceptible
early seedling stage to full resistance at adult stage. In contrast, Xa26-mediated resistance can be
detected from the juvenile stage through the adult stage in rice.
In tomato, the cytosolic domain of Tomato Atypical Receptor-like kinase 1 (TARK1)
interacts with XopN a type III effector of the bacterial pathogen Xanthomonas campestris
pathovar vesicatoria (Xcv). During infection, XopN compromises tomato defense pathways by
suppressing callose deposition and expression of PTI marker genes such as PTI5, WRKY28,
LRR22, and GRAS2. Null mutations of XopN in Xcv resulted in reduced pathogenicity in tomato.
TARK1 RNAi tomato plants supported more Xcv ΔNopN growth than did wild type tomato
plants, indicating that TARK1 is a positive regulator of tomato basal innate immunity.
Interestingly, TARK1 has been shown to be an inactive kinase and it may function in innate
immunity by interacting with other primary receptors (Kim et al. 2009).
Several RLKs were found to negatively regulate plant defense responses to bacterial
pathogens. The RIN4-interacting receptor-like kinase (RIPK) was identified from the RIN4
15
protein complex in Arabidopsis expressing the bacterial effector avrRpm1. RIPK encodes a
receptor-like cytoplasmic receptor that negatively regulates plant innate immunity (Liu et al.
2011). T-DNA knockout mutants of RIPK were more resistant to Pst DC3000 after spray
inoculation. There was however no difference between ripk KO mutants and wild type plants
when inoculating Pst DC3000 on plants via syringe infiltration (Liu et al. 2011). These results
indicate that RIPK is capable of suppressing Arabidopsis defense at an early stage of infection.
An S locus RLK, CBRLK1, also acts as a negative regulator of Arabidopsis defense against
bacterial pathogens. Cbrlk1-1 mutants are resistant to Pst DC3000 and the mechanism of
resistance is most likely due to enhanced PR gene expression (Kim et al. 2009). Despite its role
in powdery mildew infection, FER also negatively regulates Arabidopsis innate immunity to the
bacterial pathogen PstDC3000 as FER protein levels are induced within 5 minutes of flg22
treatment (Keinath et al. 2010). Flg22-induced ROS levels were significantly higher and stomata
remained constantly closed in fer mutants, which may account for its resistance to P. syringae
infection.
CRLK1CRLK1CRLK1CRLK1 isisisis aaaa receptor-likereceptor-likereceptor-likereceptor-like kinasekinasekinasekinase involvedinvolvedinvolvedinvolved inininin ArabidopsisArabidopsisArabidopsisArabidopsis defensedefensedefensedefense againstagainstagainstagainst fungifungifungifungi
Chitin is a general elicitor that can trigger plant innate immunity and treatment of plants
with chitin can rapidly induce and suppress a large number of defense-related genes in rice and
Arabidopsis (Kaku et al. 2006; Ramonell et al. 2002). In Arabidopsis, many chitin-responsive
genes (CRG) have been shown to play important roles in plant defense (Ramonell 2005). In
order to identify genes that conferred resistance to pathogens, we used a forward genetics
approach to study classes of genes that responded to chitin treatment. My dissertation project
focused on identifying several receptor-like kinases involved in Arabidopsis defense against the
16
powdery mildew pathogen Golovinomycetes cichoracearum. Seven homozygous T-DNA
insertional mutants (Table 1.2) were obtained from the Arabidopsis Biological Resource Cencer
(ABRC) and challenged with G. cichoracearum (Refer to Materials and Methods, Chapter two).
A light infection assay (Refer to Materials and Methods, Chapter two) showed that mutants in
two RLKs, crlk1 and crlk7, were more susceptible to powdery mildew than Col-0 wild type,
which is only moderately susceptible to powdery mildew (Figure 1.1). The following chapters
detail my research describing the identification and characterization of one of these RLKs,
CRLK1, and our current understanding of its function in chitin-mediated defense against fungal
pathogens.
17
Table 1.1. The list of RLKs and RLPs involved in plant innate immunity.
Name ofRLK/RLP
Organism Type ofRLK/RLP
Resistant Susceptible References
BIK1 Arabidopsis RLCK B.cinereaA. brassicicola
Pst DC3000 Veronese etal. 2006
BIR1 Arabidopsis LRR RLK H.parasiticaNoco2
Gao et al.2009
SOBIR1 Arabidopsis LRR RLK Pst DC3000 Gao etal.2009
OSBRR1 Rice LRR RLK M. oryzae Peng et al.2009
BSR1 Arabidopsis RLCK C.higginsianumPst DC3000
Dubouzet etal. 2010
CERK1/LysMRLK1
Arabidopsis LysM RLK G.cichoracearumA. brassicicola
Wan et al.2008;Miya et al.2007;
OsCERK1 Rice LysM RLK Shimizu et al.2010
CEBiP Rice LysM RLP M.oryzae Kaku et al.2006Kishimoto etal. 2010
HvCEBiP Barley LysM RLP M. oryzae Tanaka et al.2010
LeEix1 and 2 Tobacco LRR RLP Ron andAvni, 2004
CBRLK1 Arabidopsis S-locusRLK
Pst DC3000 Kim et al.2009
EFR Arabidopsis LRR RLK A. tumefaciens Zipfel et al.2006
ERECTA Arabidopsis LRR RLK P. cucumerinaP. irregulare
Llorente etal. 2005Adie et al.2007
FLS2 Arabidopsis LRR RLK Pst DC3000 Gomez-Gomez andBoller 2000;Zipfel et al.2004
FER Arabidopsis G. orontiiPst DC3000
Kessler et al.2010
18
Keinath et al.2010
NbLRK1 N.benthamiana
Lectin-likeRLK
Kanzaki et al.2008
AtPepR1 and 2 Arabidopsis LRR RLK Yamaguchiet al. 2006;Krol etal.2010
NgRLK1 N.glutinosa B-lectin,S-locusglycoprotein
Kim et al.2010
TaRLK-R1,2,and3
Wheat Wheat striperust
Zhou et al.2007
AtRLP30 Arabidopsis LRR RLP P.syringae pvphaseolicola1448A
Wang et al.2008
RIPK Arabidopsis RLCK Pst DC3000 Liu etal.2011
NbSERK3/BAK1 N.benthamiana
LRR RLK Pta 11528PtoDC3000PtoDC3000hrcCP. infestans
Heese et al.2007Chaparro-Garcia et al.2011
SNC2 Arabidopsis LRR RLP Pst DC3000 Zhang et al.2010
SNC3 Arabidopsis LRR RLP Zhang et al.2010
TARK1 Tomato LRR RLK Xanthomonascampestrispathovarvesicatoria(Xcv)
Kim et al.2009
TPK1b Tomato RLCK B.cinereaTobaccohornworm(Manducasexta)
Abuqamar etal.2008
Ve1 Tomato LRR RLP V. DahliaeV. albo-atrum
Fradin et al.2009
Vfa4 Apple LRR RLP V.inaequalis
Malnoy et al.2008
Vfa1 and Vfa2 Apple LRR RLP V. inaequalis Malnoy et al.2008;Belfanti et al2004
19
WAK1 Arabidopsis EGF-likeRLK
B. cinerea Decreux andMessiaen2005;Decreux etal. 2006
OsWAK1 Rice EGF-likeRLK
M. Oryzae Li et al. 2009
XA21 Rice LRR RLK Xanthomonasoryzae pv.oryzae
Lee et al.2009
Xa3/Xa26 Rice RLK Xanthomonasoryzae pv.Oryzae
Sun et al.2004
Xa21D Rice RLP Xanthomonasoryzae pv.Oryzae
Wang et al.2004
20
Table 1.2 Gene name, locus and mutant accession number of seven receptor-like kinasesselected from chitin-responsive genes.
Gene Locus Mutant Accession NumberCRLK1 At5g46080 SAIL_801_H08; Salk_063626CRLK2 At4g25390 Salk_093369CRLK3 At1g53080 SAIL_897_G10CRLK4 At4g11470 Salk_106993CRLK5 At4g18250 Salk_036670CRLK6 At5g59680 Salk_001929CRLK7 At2g41890 Salk_147631
21
0
10
20
30
40
50
Col-0 NahG crlk1 crlk2 crlk4 crlk5 crlk6 crlk7
c/c
FigureFigureFigureFigure 1.11.11.11.1 AverageAverageAverageAverage numbersnumbersnumbersnumbers ofofofof conidiophoresconidiophoresconidiophoresconidiophores perperperper colonycolonycolonycolony (c/c)(c/c)(c/c)(c/c) onononon receptor-likereceptor-likereceptor-likereceptor-like kinasekinasekinasekinasemutants,mutants,mutants,mutants, Col-0Col-0Col-0Col-0 wildwildwildwild typetypetypetype andandandand NahG.NahG.NahG.NahG. Mutants crlk1 and crlk7 showed a higher average numberof conidiophores per colony than Col-0 wild type, indicating that CRLK1 and CRLK7 encodegenes positively regulate Arabidopsis innate immunity. Each bar represents average number ofconidiophores counted in 25 single colonies for each mutant. NahG is transgenic linesoverexpressing SA hydroxylase and highly susceptible to powdery mildew infection. Theconidiophores were counted at 5 days after infection.
22
CHAPTERCHAPTERCHAPTERCHAPTER TWOTWOTWOTWO
CHARACTERIZATIONCHARACTERIZATIONCHARACTERIZATIONCHARACTERIZATION OFOFOFOF CRLK1,CRLK1,CRLK1,CRLK1, AAAA NOVELNOVELNOVELNOVEL RECEPTOR-LIKERECEPTOR-LIKERECEPTOR-LIKERECEPTOR-LIKE KINASEKINASEKINASEKINASEINVOLVEDINVOLVEDINVOLVEDINVOLVED ININININ THETHETHETHE INITIATIONINITIATIONINITIATIONINITIATION ANDANDANDAND REGULATIONREGULATIONREGULATIONREGULATIONOFOFOFOF ARABIDOPSISARABIDOPSISARABIDOPSISARABIDOPSIS INNATEINNATEINNATEINNATE
IMMUNITYIMMUNITYIMMUNITYIMMUNITY
INTRODUCTIONINTRODUCTIONINTRODUCTIONINTRODUCTION
Organisms in the environment are under siege by a host of disease-causing organisms
including bacteria, fungi, viruses and nematodes. Removal of these extracellular threats is
paramount to the survival of multicellular organisms (Inohara et al. 2005). Both plants and
animals are capable of detecting pathogens using specific host pattern-recognition receptors
(PRRs) that recognize pathogen-associated molecular patterns (PAMPs) associated with broad
classes of pathogens. Interaction between PRR and PAMP leads to the induction of innate
immunity.
Arabidopsis is a powerful tool to study the interactions between powdery mildew and
plants. There are at least four compatible powdery mildew pathogens for Arabidopsis:
Golovinomyces cichoracearum (Gc), G. orontii (Go), Oidium neolycopersici (On) and Erysiphe
cruciferarum (Ec) (Reviewed by Lipka et al. 2008). An imcompatible powdery mildew such as
Blumeria graminis f.sp. hordei (Bgh) was also used to study the genes that critical for
compatibility (Stein et al. 2006). Receptor-like kinases have been shown to play a critical role in
powdery mildew-Arabidopsis interaction (Miya et al. 2007; Wan et al. 2008; Kessler et al. 2010).
23
In Arabidopsis, CERK1 is the major receptor-like kinase that binds chitin derived from fungal
pathogens and triggers Arabidopsis innate immunity (Miya et al. 2007; Wan et al. 2008).
CERK1 homologs in other plant species were also found to play a similar role in plant defense
against fungal pathogens (Shimizu et al. 2010). FERONIA (FER) is a receptor-like kinase that
negatively regulates plant innate immunity upon powdery mildew infection (Kessler et al. 2010).
Since FER also functions in Arabidopsis pollen tube reception, it is hypothesized that powdery
mildew hyphae may mimic Arabidopsis pollen tube and utilize FER to establish compatibility
(Kessler et al. 2010; Govers and Angenent 2010).
Since there are more than 600 RLKs in Arabidopsis genome, many RLKs were
upregulated or downregulated by chitin treatment (Shiu et al. 2001; Wan et al. 2008). We
hypothesized that some RLKs induced by chitin may play critical roles in Arabidopsis defense
against powdery mildew. In our preliminary study, we screened several RLK homozygous T-
DNA insertional mutants using G. cichoracearum (Chapter one). In this chapter, we describe a
novel RLK, Chitin-induced RLK1 (CRLK1) that is up regulated in response to chitin treatment
in Arabidopsis. Knock-out mutants in CRLK1 are more susceptible to the biotrophic pathogen
Golovinomycetes cichoracearum and the necrotrophic pathogen Plectosphaerella cucumerina.
CRLK1 localizes to the plasma membrane and is most highly expressed in the early stages of
chitin-induced immunity. CRLK1 expression is not induced by salicylic acid, jasmonic acid or
ethylene indicating that it is unique to chitin-induced signaling. Expression of MAPK3 was
increased in crlk1 mutants suggesting that CRLK1 may play a role in negative regulation of
chitin signaling.
24
MATERIALSMATERIALSMATERIALSMATERIALS ANDANDANDANDMETHODSMETHODSMETHODSMETHODS
BiologicalBiologicalBiologicalBiological materialsmaterialsmaterialsmaterials andandandand growthgrowthgrowthgrowth conditionsconditionsconditionsconditions
T-DNA insertional mutants of CRLK1 (At5g46080; Sail_801_H08; Salk_063626) and
NahG were obtained from the Arabidopsis Biological Resource Center (ABRC, Ohio State
University). Homozygous T-DNA mutants were identified using these primers: CRLK1: 5'-
TCCAAATCACCCTCCTTCC-3' (F); 5'-CTTCTTCTCATAATCTTCCTCTTC -3' (R). T-DNA
primer: 5'-TAGCATCTGAATTTCATAACCAATCTCGATACAC-3'. One backcross was
performed on all mutants with Col-0. Plants were grown under controlled conditions in a growth
chamber (Percival Scientific) at 22°C day/19°C night with 16 hrs of light per 24 hrs and 50% RH.
G. cichoracearum was cultured on squash and maintained at 22°C day/19°C night with 16 hrs of
light per 24 hrs and 85% RH. Fungal inoculums were prepared and inoculations performed as
described (Wilson et al., 2001). P. cucumerina was grown on potato dextrose agar at 28 °C, as
described (Sanchez-Vallet et al., 2010).
InfectionInfectionInfectionInfection assaysassaysassaysassays withwithwithwith G.G.G.G. cichoracearumcichoracearumcichoracearumcichoracearum
Heavy infection with G. cichoracearum was done by touching 21-day old Arabidopsis
rosettes with heavily infected squash leaves and scored for resistance phenotypes after 10 days
(Wilson et al. 2001). For determination of fungal biomass, plants were lightly infected as
described (Wilson et al., 2001). For H2O2 staining, leaves were harvested 5 dpi and stained in
1mg/ml DAB for 8 hrs and then cleared in 95% of ethanol overnight. Cleared leaves were
equilibrated in a 1:1:1 mixture of water: lactic acid: glycerol for 3 hrs and counter-stained in 200
mg/ml Trypan blue for 2 hrs. Conidiophores and H2O2 stained leaves were scored under 40X
25
magnification with a light microscope. Student’s t-test was performed using Excel to determine
SE with n=10.
P.P.P.P. cucumerinacucumerinacucumerinacucumerina BiomassBiomassBiomassBiomass DeterminationDeterminationDeterminationDetermination
Spores of P. cucumerina were sprayed onto 4-week old Arabidopsis plants at a
concentration of 2×106 spores/ml. To determine fungal biomass within leaf tissue, fungal DNA
was extracted from infected leaves 3 dpi. Relative fungal biomass was quantified using qRT-
PCR in a real-time PCR system (Roche), as described (Sanchez-Vallet et al. 2010).
DiseaseDiseaseDiseaseDisease assaysassaysassaysassays ofofofof P.P.P.P. syringaesyringaesyringaesyringae
P. syringae DC3000 virulent or avirulent strains (avrRpt2) were cultured on King's B
plates with kanamycin (50μg/ml) for 2 days. Strains were resuspended in 10mM MgCl2 and
grown to an OD600 reading of 0.05 (5×107 cells/ml). Cells were diluted 1:1000. Diluted strains
were used to inoculate Arabidopsis leaves using a 1ml syringe. Inoculated leaves were collected
48 and 96 hpi and pulverized in 1.5 ml tube containing 200 μl ice cold H2O. Resuspended
bacteria were plated in serial dilutions to determine levels of growth as described (Hinsch and
Staskawicz. 1996).
ChitinChitinChitinChitin andandandand hormonehormonehormonehormone treatmentstreatmentstreatmentstreatments
Seedlings were surface sterilized and grown in 10 ml of liquid MS medium supplemented
with Gambourg vitamins and 2% dextrose (Sigma-Aldrich) in 50 ml tubes. Seedlings in liquid
culture were grown under continuous light at room temperature as described (Zhang et al. 2002).
14 day old seedlings were treated with either a solution containing 1μg/ml hydrolyzed crab shell
26
chitin (CSC, Sigma-Aldrich) in ddH2O or ddH2O only for time points starting at 30 min and
ending at 24 hrs. Chitin solution was made by adding ddH2O to CSC and vortexing overnight.
For hormone treatments, 14 day old seedlings in liquid culture were treated with 5 mM SA, 100
µM methyl jasmonate or 0.5 mM ACC for 24 hrs before harvesting. Harvested seedlings were
frozen immediately on liquid nitrogen.
QuantitativeQuantitativeQuantitativeQuantitative realrealrealreal timetimetimetime PCRPCRPCRPCR
Total RNA was isolated from 14 day old seedlings using Trizol Reagent (Invitrogen) and
treated with DNase I (Ambion). 5 µg of total RNA was reverse transcribed to cDNA using a
SuperscriptTM II RT kit (Invitrogen). qRT-PCR was carried out using an Opticon2TM qRT-PCR
System (BioRad). Accession numbers for genes used are: CRLK1: At5g46080; MAPK3:
At3g45640;WRKY53: At4g23810; Actin-2: At3g18780. Primers for qRT-PCR were: CRLK1: 5-
'GGAGAAAGAATCGTCGTAAC-3' (F); 5'-GATGTGAATCTACCGTGAAC-3' (R); Actin-2:
5'-GGTATTCTTACCTTGAAGTATCCTA-3' (F); 5’-
TCATTGTAGAAAGTGTGATGCCAGATC-3' (R);MAPK3: 5'-
CTCACGGAGGACAGTTCATAAG-3' (F) 5'-GAGATCAGATTCTGTCGGTGTG-3' (R);
WRKY53: 5'-CCTACGAGAGATCTCTTCTTCTG-3' (F); 5'-
AGATCGGAGAACTCTCCACGTG (R)-3'. Each qRT-PCR reaction contained 12.5 µl IQ
SYBR Green Supermix (Bio-Rad), 8.5 µl DEPC-treated water (Ambion), 2 µl of cDNA
(10ng/µl), and 1 µl forward and reverse primer (12.5µM). PCR reaction conditions were: 50°C
for 2 min; 95°C for 10 min; 95°C for 15 s, 60°C for 30 s and 72°C for 30 s for 40 cycles. Raw
data were collected by Opticon monitor 3 software (Bio-Rad) and relative gene expression levels
were analyzed using LinregPCR software (Ramakers et al. 2003).
27
TransientTransientTransientTransient expressionexpressionexpressionexpression inininin tobaccotobaccotobaccotobacco
A fragment containing full length CRLK1 cDNA was generated by PCR. Primers for
35S:CRLK1:GFP construct were:
5'-GGGACAAGTTTGTACAAAAAAGCAGGCTTCATGGACAAATCTGAAAAAATCGC- 3'
(F);
5'- GGGGACCACTTTGTACAAGAAAGCTGGGTCCCCTCCTTCCCTCTCCAAA-3' (R).
Forward primer for 35S:ΔTM CRLK1:GFP was:
5'GGGACAAGTTTGTACAAAAAAGCAGGCTTCAGAAAAAAACCAAACC-3' (F).
Reverse primer for 35S:ΔTM CRLK1:GFP was the same sequence as the 35S:CRLK:GFP
reverse primer.
Underlined sequences are CRLK1 specific. PCR product was cloned into pDONR221 using
Gateway technology (Invitrogen), subcloned into the binary vector pMDC83 (Curtis and
Grossniklaus. 2003) and transformed into Agrobacterium tumefaciens strain GV3010. Transient
expression was carried out by co-infiltrating tobacco leaves with an A. tumefaciens strain
containing free GFP or 35S:CRLK1:GFP fusion genes and another strain of A. tumefaciens
containing the plasma membrane marker 35S:AtPIP2:mCherry (Sparkes et al. 2006; Nelson et al.
2007). For plasmolysis experiment, 1 M of NaCl was infiltrated into tobacco leaves 10 minutes
before images were taken. Images were collected using a Leica TCS SP2 AOBS Confocal
Microscope (Leica Microsystems) 72 hrs after infiltration. GFP and mCherry were excited using
a 488 nm Ar/Kr laser and a 543 nm He/Ne laser respectively.
28
PredictionPredictionPredictionPrediction ofofofof W-boxesW-boxesW-boxesW-boxes
W boxes in the promoter region of CRLK1 were predicted by manually scanning for the
W-box sequence [(T)TGAC(C/T)] 1.5 kb upstream CRLK1 start codon.
ConstructionConstructionConstructionConstruction ofofofof pCRLK1::GUSpCRLK1::GUSpCRLK1::GUSpCRLK1::GUS vectorvectorvectorvector andandandand histochemicalhistochemicalhistochemicalhistochemical stainingstainingstainingstaining withwithwithwith X-glucX-glucX-glucX-gluc
A 2kb DNA fragment was amplified from Arabidopsis genomic DNA using Iproof High
Fidelity Polymerase (Bio-Rad Laboratories) using primers contain attB recombination site. The
sequences were as following:
Forward:
GGGGACAAGTTTGTACAAAAAAGCAGGCTTC CATGTTTGAACTGCATTATGA
Reverse:
GGGGACCACTTTGTACAAGAAAGCTGGGTCTTGATTTCAACAAAGAAAATAAAT
The underlined sequences are attB recombination site. The PCR product was introduced to entry
vector pDONR211 using BP clonase mix (Invitrogen). The resultant pDONR221 vector
harboured CRLK1 promoter was subcloned into pMDC162 (Curtis and Grossniklaus, 2003), a T-
DNA binary vector containing GUS gene downstream recombination sites. The pCRLK1::
GUS vector was transformed to Agrobacterium tumefaciens strain GV3010 and then transformed
into Arabidopsis Col-0 via floral dip method (Zhang et al. 2006). The transformants were
selected on agar plates containing 50μg/ml of hygromycin B and full-strength of MS salt
supplemented with Gambourg vitamins (Sigma-Aldrich). Homozygous transgenic lines were
selected from T3 lines for histochemical staining. Tissues were stained in staining buffer
containing 0.5M sodium phosphate buffer (pH 7.2), 10% Triton X-100, 100mM potassium
ferrocyanide, 100mM potassium ferricyanide and 10mM X-Gluc. Wounding treatment was
29
carried out by stabbing transgenic plant leaves with needles. The leaves were stained
immediately after wound treatment. Cross-section of Arabidopsis roots were made as following
procedure: stained Arabidopsis seedlings as above, then destained in 70% EtOH overnight. The
seedlings were incubated in Glutaraldehyde for 1 hour. Then the seedlings were rinsed in sodium
phosphate buffer (PH=7.2) three times and then incubated in gradient EtOH (25%, 50%, 75%,
and 100%) for 30 minutes each step. Then the seedlings were incubated in resin (10g of ERL
4206, 4g of DER 736, 26g of NSA, and 0.5ml of DMAE): EtOH=2:1 for 1 hour, resin:EtOH=1:1
for 1 hour and resin overnight in 70°C. The seedlings embedded in resin were trimmed and
section using LKB ULTROTOME 4801A and then visualized under light compound microscope.
RESULTSRESULTSRESULTSRESULTS
IdentificationIdentificationIdentificationIdentification andandandand characterizationcharacterizationcharacterizationcharacterization ofofofof CRLK1CRLK1CRLK1CRLK1
We identified a group of LRR-RLKs that appeared to specifically respond to chitin by
analyzing publically available microarray data of Arabidopsis plants treated with three elicitors:
1) Flg22, the conserved domain of bacterial flagellin; 2) oligogalacturonides and 3) purified
chitin fragments. Focusing on genes involved in chitin perception, we identified genes that were
A) up-regulated by chitin; B) classified as RLKs by gene annotation and C) had not been
previously characterized in relation to defense responses and obtained T-DNA insertional
mutants in the selected genes from the Salk Institute Genomic Analysis Laboratory collection
(http://signal.salk.edu/cgi-bin/tdnaexpress). All lines were screened to identify homozygous
mutants and one backcross was performed on all insertional mutants with wild-type Columbia
(Col-0; Data not shown).
30
Since chitin fragments are one of the pathogen-associated molecular patterns that are
known to elicit strong defense responses in plants (Ramonell et al. 2002; Zhang et al. 2002) and
plants have evolved a mechanism to detect chitin fragments then one would predict that
mutations in chitin-responsive genes would result in an enhanced susceptibility to pathogens.
We inoculated the T-DNA mutants with the powdery mildew pathogen, G. cichoracearum, and
evaluated them for disease resistance. To evaluate susceptibility the T-DNA lines were
compared with powdery mildew inoculated Col-0 as the control and with the hyper-susceptible
transgenic plant NahG (Nawrath and Metraux 1999). At high density inoculation, one of the T-
DNA insertional mutants designated chitin receptor-like kinase 1 (crlk1; At5g46080) had more
severe macroscopic symptoms compared with Col-0 wild type plants (Figure 2.1A) though the
fungal growth was not as advanced as that on hyper-susceptible NahG plants. Independent
insertional mutants of CRLK1 also showed enhanced disease susceptibility when infected with G.
cichoracearum confirming that the altered disease phenotype can be attributed to the loss of
CRLK1 function and not to a secondary mutation (Data not shown). To more quantitatively
examine the susceptibility phenotype we inoculated crlk1, Col-0 and NahG at low density and
examined hyphal growth and the number of conidiophores produced per colony. Though visible
differences in the amount of hyphal growth on each were subtle (Fig. 2.1B), fungal colonies on
crlk1 mutant plants produced a higher density of conidiophores compared to Col-0 (Figure 2.1C).
However crlk1 mutants did not produce as many conidiophores as the NahG transgenic line
(Reuber et al. 1998).
A characteristic of the initial response to pathogens is ROS production (Mittler et al.
2004). Since crlk1 was more susceptible to powdery mildew we wanted to determine if
production of ROS in crlk1 was compromised. Leaves of crlk1, Col-0 and NahG were infected
31
at low density and stained with diamino-benzidine (DAB) to visualize H2O2 and with trypan blue
to observe the fungal hyphae. Both crlk1 and Col-0 exhibited a similar level and pattern of DAB
staining at sites of H2O2 production where the fungus was attempting to penetrate the leaf
epidermal cell (Figure 2.1D). In contrast, no DAB staining was observed in the NahG transgenic
line as it is compromised in ROS production.
32
FigureFigureFigureFigure 2.2.2.2.1111 crlk1crlk1crlk1crlk1 isisisis moremoremoremore susceptiblesusceptiblesusceptiblesusceptible totototo GGGG.... cichoracearumcichoracearumcichoracearumcichoracearum butbutbutbut exhibitsexhibitsexhibitsexhibits normalnormalnormalnormal ROSROSROSROSproduction.production.production.production. A.A.A.A.Whole plant visible phenotype of crlk1, Col-0 and NahG 10 dpi. B.B.B.B. Fungalhyphae and conidiophores of G. cichoracearum stained by trypan blue 5 dpi. Arrows indicateconidiophores. Bar = 0.2mm. C.C.C.C. Quantification of conidiophores per colony (c/c). Averagevalue and SE were calculated from n=25 colonies. D.D.D.D. DAB staining to determine H2O2
production at sites of infection in Col-0, crlk1and NahG. Arrows indicate points of H2O2 stainingat infection sites. Bar = 0.1mm.
33
CRLK1CRLK1CRLK1CRLK1 isisisis involvedinvolvedinvolvedinvolved inininin defensedefensedefensedefense againstagainstagainstagainst biotrophicbiotrophicbiotrophicbiotrophic andandandand necrotrophicnecrotrophicnecrotrophicnecrotrophic fungalfungalfungalfungal pathogenspathogenspathogenspathogens
Since mutations in CRLK1 render plants more susceptible to infection by the biotrophic
fungus G. cichoracearum (Figure 2.1A, 2.1B and 2.1C), we were interested in learning if CRLK1
participated in defense against other classes of fungi. To test this 3-week-old seedlings of crlk1
were inoculated with the necrotrophic fungus P. cucumerina and fungal biomass within the
leaves was quantified (Figure 2.2). To evaluate the levels of susceptibility crlk1 was compared
to Col-0, Arabidopsis G-protein beta subunit 1-1 (agb1-1) that is hyper-susceptible to P.
cucumerina and enhanced resistance to necrotrophs 1-1 (ern1-1) that is resistant to P.
cucumerina infection. At 3 dpi crlk1 had more than double the amount of fungal biomass in the
leaves compared with the Col-0 control plants (Figure 2.2). This level of fungal growth was
comparable to that of the hyper-susceptible agb1-1 mutant and much less than that in the
resistant ern1-1 leaves (Figure 2.2) indicating that CRLK1 function is needed for defense against
both biotrophic (Figure 2.1) and necrotrophic (Figure 2.2) pathogens.
To determine if CRLK1 was acting more broadly in plant basal defense responses against
other classes of pathogens we tested the resistance phenotype of crlk1 mutants infected with both
virulent (DC3000 vir) and avirulent (DC3000 avrRpt2) strains of the bacterial pathogen
Psuedomonas syringae pv tomato DC3000. Bacterial counts on infected leaves in both Col-0
and crlk1 mutants were the same regardless of strain or time after inoculation (Figure 2S1)
suggesting that CRLK1 acts only in defense against fungal pathogens.
34
FigureFigureFigureFigure 2222.2.2.2.2 crlk1crlk1crlk1crlk1 isisisis moremoremoremore susceptiblesusceptiblesusceptiblesusceptible totototo thethethethe necrotrophnecrotrophnecrotrophnecrotroph P.P.P.P. cucumerinacucumerinacucumerinacucumerina.... Fungal biomass inleaves was quantified by qRT-PCR 3 dpi. Data represents ratio of fungal biomass between wild-type Col-0 and each mutant (n = 3).
35
FigureFigureFigureFigure 2S12S12S12S1 crlk1crlk1crlk1crlk1 isisisis notnotnotnot compromisedcompromisedcompromisedcompromised inininin itsitsitsits resistanceresistanceresistanceresistance totototo bacterialbacterialbacterialbacterial pathogens.pathogens.pathogens.pathogens. AAAA.Quantitative analysis of growth of either P. syringae DC3000 vir or P. syringae avrRpt2 strainswithin leaves of Col-0 and crlk1 at 0 (white bar), 48 (black bar) and 96 (striped bar) hrs postinfection. BBBB. Visible phenotypes of Col-0 and crlk1 Arabidopsis leaves after inoculation witheither P. syringae DC3000 vir or P. syringae avrRpt2 strains. Black and red pen marks denotesite of inoculation with pathogen. Photos were taken at 96 hours post inoculation.
36
CRLK1CRLK1CRLK1CRLK1 isisisis inducedinducedinducedinduced earlyearlyearlyearly inininin thethethethe chitinchitinchitinchitin responseresponseresponseresponse andandandand isisisis notnotnotnot affectedaffectedaffectedaffected bybybyby otherotherotherother defense-relateddefense-relateddefense-relateddefense-relatedhormoneshormoneshormoneshormones
To determine the timing of CRLK1 expression after chitin treatment expression levels of
CRLK1 were monitored 30 min, 1hr, 1.5 hr, 2 hr, 4 hr and 24 hrs post chitin treatment. Analysis
of the gene expression revealed that CRLK1 is induced more than 10-fold within 1 hour of chitin
treatment (Figure 2.3A) compared with mock treated plants. CRLK1 expression then quickly
dropped back to negligible levels within 4 hours (Figure 2.3A). At 24 hours post-treatment,
CRLK1 expression appears to increase slightly though the level of induction is far below that of
earlier time points (Figure 2.3A).
Salicylic acid (SA), jasmonic acid (JA) and ethylene (ET) are plant hormones that play
important roles in plant defense responses (Bari and Jones 2009). Since there is cross-talk
between many plant defense response pathways we were interested in determining if CRLK1
expression was influenced by SA, JA or ET. Col-0 seedlings were treated with either SA, Methyl
jasmonate (MeJA) or the ethylene precursor 1-aminocyclopropane 1-carboxylic acid (ACC) for
24 hours and expression of CRLK1 was analyzed. In all three hormone treatments CRLK1 was
repressed similarly (Figure 2.3B) compared to mock-treated plants. These data suggest that
CRLK1 is repressed by a general mechanism at work during SA-, JA- and ET-mediated
responses and is not specifically regulated by any of these pathways.
37
FigureFigureFigureFigure 2.32.32.32.3 ExpressionExpressionExpressionExpression ofofofof CRLK1CRLK1CRLK1CRLK1 afterafterafterafter chitin,chitin,chitin,chitin, ACC,ACC,ACC,ACC, MeJAMeJAMeJAMeJA andandandand SASASASA treatments.treatments.treatments.treatments. A.A.A.A. Inductionof CRLK1 transcripts by chitin at various time points. Col-0 seedlings were treated with chitin orddH2O (mock) in MS liquid medium for 0.5, 1, 1.5, 2, 4 and 24 hrs. Bar represents ratio betweenmock and chitin treated Col-0. B.B.B.B. Affects of ACC, MeJA and SA treatment on CRLK1expression. Data represents ratio of gene expression between ddH2O (mock) and hormonetreated Col-0 plants after 24 hrs treatment.
38
CRLK1CRLK1CRLK1CRLK1 encodesencodesencodesencodes aaaa receptor-likereceptor-likereceptor-likereceptor-like kinasekinasekinasekinase thatthatthatthat isisisis localizedlocalizedlocalizedlocalized totototo thethethethe plasmaplasmaplasmaplasma membranemembranemembranemembrane
Using protein prediction software we found that CRLK1 encoded a receptor-like kinase
with a short N-terminal domain (12 amino acids), a transmembrane domain (13-29 amino acids)
and a C-terminal kinase domain (data not shown). The N-terminal domain of CRLK1 does not
contain any known binding or interaction sites so its potential for interaction with other proteins
appears limited. To understand the regulation of CRLK1 we performed an analysis of the gene’s
upstream promoter region. Seven w-boxes were found in the CRLK1 promoter region within
2.5kb of the start site suggesting that WRKY transcription factors may play a role in its
regulation (Figure 2.4A).
To determine CRLK1’s location within the cell a construct containing a C-terminal
fusion of the green fluorescent protein (GFP) to CRLK1 under the control of the CaMV 35S
promoter (35S:CRLK1: GFP) was made and transiently expressed in tobacco epidermal cells.
Unlike free GFP (Figure 2.4B), 35S:CRLK1: GFP was clearly localized to the plasma membrane
in the tobacco cells (Figure 2.4C). We also performed a co-localization using our
35S:CRLK1:GFP construct and the plasma membrane marker AtPIP2A:mCherry (Cutler et al.
2000). 35S:CRLK1: GFP clearly co-localized with the plasma membrane marker (Figure 2.4C)
confirming its localization to the plasma membrane. To further rule out the possibility of
CRLK1 is associated with plant cell wall, tobacco leaves expressing 35S:CRLK1: GFP and
AtPIP2A:mCherry were infiltrated with 1M NaCl for plasmolysis. As figure 2.4D showed,
CRLK1:GFP were colocalized with AtPIP2A:mCherry on plasma membrane detached from cell
wall indicating CRLK1 was only expressed in plant plasma membrane. The first 30 amino acids
of CRLK1 were predicted to be transmembrane domain (TM). We hypothesized that the first 30
amino acids were critical for CRLK1 localization and function. To test this hypothesis, a
39
construct containing mutants CRLK1 with deletion of TM was generated. Upon visualization,
mutant CRLK1 (35S:ΔTM CRLK1:GFP) was predominantly delivered to cytoplasm (Figure
2.4E), suggesting a critical role of first 30 amino acids in CRLK1 targeting.
40
FigureFigureFigureFigure 2.42.42.42.4 CRLK1CRLK1CRLK1CRLK1 encodesencodesencodesencodes aaaa RLKRLKRLKRLK thatthatthatthat hashashashas multiplemultiplemultiplemultiple W-boxesW-boxesW-boxesW-boxes inininin itsitsitsits promoterpromoterpromoterpromoter sequencesequencesequencesequence andandandandisisisis localizedlocalizedlocalizedlocalized totototo thethethethe plasmaplasmaplasmaplasma membrane.membrane.membrane.membrane. A.A.A.A.Multiple W boxes found 1.5 kb upstream of theCRLK1 start site. The numbers indicate positions from start codon of CRLK1 transcript. ATG:start codon; TGA: stop codon; TM: transmembrane domain; TTGACC: consensus for W boxelement. B-E:B-E:B-E:B-E: CRLK1 localizes into plasma membrane in tobacco leaves. Panel B-Ecorrespond to tobacco cells expressing free 35S:GFP, 35S:CRLK1:GFP, 35S:CRLK1:GFPtreated with 1M NaCl and 35:ΔTM CRLK1:GFP respectively. Free GFP was as control andlocalized into plasma membrane and cytoplasm (B) and 35S:CRLK1:GFP fusion protein wasonly expressed in plasma membrane, as 35S:CRLK1:GFP colocalized with plasma membranemarker under both normal condition (C) and plasmolysis (D). Deletion of transmembranedomain in 35S:ΔTM CRLK1:GFP fusion protein targeted the fusion protein into plasmamembrane, cytoplasm and nucleus (E), as fusion protein in cytoplasm did not colocalize withplamsa membrane marker.Bar=50μm.GFP, free GFP or fusion GFP proteins; mCherry, plasma membrane marker AtPIP2:mCherry.
41
ExpressionExpressionExpressionExpression ofofofof CRLK1CRLK1CRLK1CRLK1 inininin ArabidopsisArabidopsisArabidopsisArabidopsis tissuestissuestissuestissues atatatat differentdifferentdifferentdifferent developementaldevelopementaldevelopementaldevelopemental stagesstagesstagesstages
In order to study the where CRLK1 localized in tissue level, transgenic Arabidopsis were
generated to express GUS under the control of a 2kb CRLK1 promoter region. Homozygous
transgenic lines were selected at T2 generation and subjected to GUS staining under 37°C for 3
hours (described under Materials and Methods). Intense GUS staining were detected in
cotyledons, hypocotyls and roots as early as 2 days (Figure 2.5A). As the seedlings grew, the
pCRLK1::GUS activity were still present in cotyledons, hypocotyls and roots, however, the
expression pattern in cotyledons changed from uniformly distributed (Figure 2.5A) to patch-like
(Figure 2.5B and 2.5C) and then to predominantly in vasculature (Figure 2.5D). In roots, GUS
activity was detected mainly in stele (ST) and endodermis (EN) . However, no activity was
found in root hair cells cortex (CO) and epidermis (EP) (Figure 2.5E and 2.5G). GUS is
continuously expressed along roots except the meristemaic zone (MZ) (Figure 2.5F). In 21-day
soil-grown plants, GUS was expressed predominantly in vasculature of mature rosette leaves
(Figure 2.5H). After transgenic plant developed reproductive organs, GUS was mainly
expressed in sepals, stigma and stamen of mature flowers (Figure 2.5I and 2.5J). No GUS
activity was detected in immature developing flower buds (Figure 2.5I) or mature flower anther
(Figure 2.5J). After plants developed siliques, pCRLK1::GUS was expressed in tips and
abscission zone of young developing siliques (Figure 2.5K). Interestingly, GUS expression was
not detected in mature siliques except petioles (Figure 2.5L). The histochemical analysis of
pCRLK1::GUS indicated that CRLK1 may be regulated temporally and spatially during
42
Arabidopsis development. CRLK1 strong expression in cotyledons and rosettes leaves suggested
roles of CRLK1 in sensing pathogens. Upon wounding treatment, pCRLK1::GUS in tissue
around the wound was rapidly induced (Supplemental figure 2S2 B and 2S2D) indicating
expression of CRLK1 may be regulated by other defense pathways.
43
FigureFigureFigureFigure 2.52.52.52.5 HistochemicalHistochemicalHistochemicalHistochemical stainingstainingstainingstaining ofofofof GUSGUSGUSGUS activityactivityactivityactivity inininin transgenictransgenictransgenictransgenic ArabidopsisArabidopsisArabidopsisArabidopsis harboringharboringharboringharboringpCRLK1::GUS.pCRLK1::GUS.pCRLK1::GUS.pCRLK1::GUS. Transgenic Arabidopsis seedlings were grown in 7.5% MS agar supplementedwith Gambourg vitamins and seedlings were stained in 10mM X-gluc for 3 hours in 37°C asdescribed in Material and Methods. pCRLK1::GUS activity was detected in cotyledons,hypocotyls and roots in 2-day old seedlings (A), 3-day old seedlings (B), 4-day old seedlings (C)and 5-day old seedlings (D). GUS was expressed in a similar pattern in hypocotyls and roots butdifferent in cotyledons during seedlings development. In 5-day old seedling roots, GUS wasexpressed in maturation zone and elongation zone of seedlings but no activity was detected inmeristemaic zone (MZ) (F). GUS activity was detected in stele (ST) and endodermis (EN) incross-section of 5-day seedling roots (E and G). In 21-day old Arabidopsis, GUS was expressedin vasculature of rosette leaves (H). After plant developed flowers, GUS was expressed ininflorescences such as sepals, stigma, and stamen ( I and J). In young siliques, GUS wasexpressed in silique tip and abscission zone (K). In mature siliques, GUS was expressed insilique petioles and GUS activity in siliques was undetectable (L).Scale bars represent for 1mm from A to D and 0.1mm from E to G.ST, stele; EP, Epidermis; EN, Endodermis; CO, Cortex.
44
Control Wound
FigureFigureFigureFigure 2S22S22S22S2 Wound-inducedWound-inducedWound-inducedWound-induced GUSGUSGUSGUS expressionexpressionexpressionexpression inininin pCRLK1::GUSpCRLK1::GUSpCRLK1::GUSpCRLK1::GUS transgenictransgenictransgenictransgenic ArabidopsisArabidopsisArabidopsisArabidopsisplants.plants.plants.plants. Arabidopsis leaves were wounded and immediately stained with X-gluc for 3 hoursunder 37 °C as described in Materials and Methods. A and C, mock; B and D, wound treatment.GUS is highly expressed peripherally in the mesophyll and vein cells around wound, as shown inD.
45
RoleRoleRoleRole ofofofof CRLK1CRLK1CRLK1CRLK1 inininin chitinchitinchitinchitin mediatedmediatedmediatedmediated signalingsignalingsignalingsignaling
Though several significant players in chitin mediated signaling have been identified we
are far from a comprehensive understanding of this signaling pathway (Wan et al. 2008;
Berrocal-Lobo et al. 2010; Kishi-Kaboshi et al. 2010; Shimizu et al. 2010). Since CRLK1 was
induced within 30 minutes of chitin treatment and its expression was not upregulated by other
defense related hormones we wanted to determine where CRLK1 might be acting within the
known chitin-mediated signaling pathway. To determine this we tested the expression levels of
two well-characterized marker genes, MAPK3 andWRKY53, that are strongly induced after
chitin treatment in the crlk1 mutant and Col-0 (Wan et al. 2004; Wan et al. 2008). Expression of
bothMAPK3 and WRKY53 was not blocked in crlk1 and expression levels of WRKY53 were not
significantly different between Col-0 and crlk1 (Figure 2.6A & 2.6B). Interestingly, MAPK3
expression was more than 2-fold higher in the crlk1 mutant compared with Col-0 wild type
plants (Figure 2.6A). Since MAPK3 is known to act fairly early in chitin-mediated responses
(Wan et al. 2004), this suggests that functional CRLK1 may be involved in repression or
modulation of upstream chitin signaling responses as fungal infection progresses.
46
FigureFigureFigureFigure 2.62.62.62.6 ExpressionExpressionExpressionExpression ofofofofMAPK3MAPK3MAPK3MAPK3 andandandandWRKY53WRKY53WRKY53WRKY53 afterafterafterafter chitinchitinchitinchitin treatmenttreatmenttreatmenttreatment inininin Col-0Col-0Col-0Col-0 wildwildwildwild typetypetypetypeandandandand crlk1crlk1crlk1crlk1.... Data represents the ratio of (A) MAPK3 or (B) WRKY53 expression after chitintreatment with mock (ddH2O) treated plants. Plants were treated with chitin for 30 min beforecollection for total RNA. Chitin treatments were as described in experimental methods.
47
DISCUSSIONDISCUSSIONDISCUSSIONDISCUSSION
Plants are capable of sensing general elicitors derived either from the invading pathogen
or the damaged plant itself to trigger broad-spectrum innate immune responses. In the current
study we identified a receptor-like kinase, CRLK1 that is involved in chitin-mediated defense
responses to fungal pathogens. Several RLKs are known to recognize PAMPs particularly those
involved in responses to bacterial pathogens. The overall picture for chitin-mediated signaling
against fungal pathogens is less clear. In rice chitin oligosaccharide elicitor-binding protein
(CEBiP) was shown to bind chitin and a knockdown of CEBiP mRNA levels in rice cells
resulted in a reduction in the number of chitin responsive genes expressed (Kaku et al. 2006).
Furthermore the rice chitin elicitor receptor kinase 1 (OsCERK1) was shown to form a protein
complex with CEBiP and both CEBiP and OsCERK1 were shown to be required for activation
of chitin-mediated signaling in rice (Shimizu et al. 2010). In Arabidopsis CERK1 was identified
as the major receptor that binds chitin and initiates chitin-mediated signaling (Miya et al. 2007)
though potential interacting partners remain to be identified. It is possible that CRLK1 may act in
concert with CERK1 in a complex similar to that of CEBiP/OsCERK1 to activate chitin-
mediated signaling events. Experiments to determine interacting partners of CRLK1 will be
critical to more completely understand its function within the known chitin-signaling cascade.
Unlike most RLKs CRLK1 does not contain an extracellular domain that is necessary to
recognize PAMPs. Therefore the function of CRLK1 in signaling is probably mediated through
interactions with other RLKs or RLPs. In bacteria the BIK1 kinase has been reported to associate
with both BAK1 and FLS2 and is required for flg22-triggered innate immunity (Lu et al. 2010).
BIK1 also lacks an extracellular domain and its phosphorylation upon flg22 binding is required
by BAK1 and FLS2. Similarly CRLK1 may function as a partner of other RLKs or proteins,
48
such as CERK1, via direct binding and phosphorylation. Our data suggest that CERK1 and
CRLK1 may act together either by direct interaction or through a complex since both cerlk1 and
crlk1 mutants were susceptible to the biotrophic fungus G. cichoracearum. Additionally in the
cerk1 knock-out mutant the induction of CRLK1 upon chitin treatment was blocked indicating
that transcriptional regulation of CRLK1 by chitin is dependent on CERK1.
We have shown that CRLK1 is essential for defense against the fungal pathogens G.
cichoracearum and P. cucumerina. Several other RLKs have been identified in plants that are
involved in defense against biotrophic or necrotrophic fungi. In Arabidopsis ERECTA (ER) was
found in a QTL analysis to play a role in defense against the necrotrophic fungi Plectosphaerella
cucumerina (Llorente et al. 2005). In tomato, a receptor-like cytoplasmic kinase Tomato Protein
Kinase 1b (TPK1b) was shown to play a critical role in defense against the necrotrophic fungus B.
cinerea but has no role in defense against the bacterial pathogen P. syringae (Abuqamar et al.
2008). In our study CRLK1 was also shown to have no effect on the defense response to P.
syringae (Figure 2S1). Though originally linked to elicitor-mediated defense against bacterial
pathogens, Arabidopsis T-DNA insertional mutants of BAK1 were shown to confer higher
susceptibility to two necrotrophic fungi B. cinerea and A. brassicicola (Kemmerling et al. 2007).
Another kinase, BOTRYTIS-INDUCED KINASE1 (BIK1), has also been shown to be required for
resistance to both B. cinerea and A. brassicicola (Veronese et al. 2006). While the data is far
from complete, it does appear that most RLKs linked to defense against fungal pathogens are
unique to fungal defense pathways and are not involved in defense against other classes of
pathogens.
Chitin has been shown to induce more than 800 genes in Arabidopsis within 30 minutes
of treatment (Wan et al. 2008). Many of these genes are induced temporarily by chitin and then
49
their transcripts decrease rapidly. In a time course study of chitin-induced gene expression,
AtMAPK3 expression was shown to be induced after as little as 5 minutes of chitin treatment. It
then reached a maximum expression level after 30 minutes and then decreased to 1-fold within 4
hours (Wan et al. 2004). Chitin-induced expression of CRLK1 resembled that of AtMAPK3
though CRLK1 is induced at a higher level than AtMAPK3. We surveyed 39 receptor-like
kinases from the 890 genes induced by chitin and found that most of the RLKs were induced
between 2-4 fold after 30 minutes of chitin treatment (data not shown). CRLK1 was highly
induced by chitin compared to most of the other RLKs, which may suggest that increased
amounts of CRLK1 are required to prolong and sustain chitin-mediated defense. The fact that
CRLK1 transcripts rapidly decreased after 1 hour of chitin treatment strongly suggest that
CRLK1 is essential in the early stages of defense against fungal pathogens.
We observed enhanced induction ofMAPK3 in crlk1 mutants after chitin treatment but
no effects were observed on WRKY53 expression. Based on these findings we propose a model
whereby chitin binding to CERK1 induces CRLK1 expression through MAPK3 and other
unidentified signaling molecules with CRLK1 expression reaching maximal levels within one
hour of chitin perception. CRLK1 and/or its interacting partners can then (1) go on to activate
other unknown molecules in fungal defense and (2) act to suppressMAPK3 expression in order
to lower or regulate the response over time in a negative feedback loop. Additional experiments
aimed at identifying CRLK1’s interacting partners and its precise role in modulating MAPK3
will be important in determining the precise role of CRLK1 in defense against fungal pathogens
and in elicitor-mediated defense.
50
Since CRLK1 is involved in Arabidopsis defense against fungal pathogens, we hypothesized that
CRLK1 was predominantly expressed in leaves in order to mediate the defense when fungal
pathogens invaded Arabidopsis leaves. We determined the expression pattern of GUS driven by
2kb CRLK1 promoter in Arabidopsis (Figure 2.5). Interestingly, GUS was expressed
predominantly in vascular tissues of Arabidopsis leaves, which indicated that CRLK1 may have
an unknown function in vascular tissue development. The CRLK1 expression in floral organs
suggested CRLK1 may also participate in flower development. However, there is no phenotype
in floral organs of crlk1 mutants, suggesting compensation by redundant RLKs in Arabidopsis.
Some plant resistance proteins were expressed in a vascular tissue-specific pattern and these
proteins were involved in vascular tissue development (Ramirez et al. 2011) or initiation of
vascular tissue defense responses (Liu and Ekramoddoullah 2011).
.
51
REFERENCESREFERENCESREFERENCESREFERENCES
Abuqamar, S., Chai, M.F., Luo, H., Song, F., and Mengiste, T. (2008). Tomato protein kinase 1bmediates signaling of plant responses to necrotrophic fungi and insect herbivory. Plant Cell 20,1964-1983.
Bari, R., and Jones, J.D. (2009). Role of plant hormones in plant defence responses. Plant Mol.Biol. 69, 473-488.
Berrocal-Lobo, M., Stone, S., Yang, X., Antico, J., Callis, J., Ramonell, K.M., and Somerville, S.(2010). ATL9, a RING zinc finger protein with E3 ubiquitin ligase activity implicated in chitin-and NADPH oxidase-mediated defense responses. PLoS One 5, e14426.
Curtis, M.D., and Grossniklaus, U. (2003). A gateway cloning vector set for high-throughputfunctional analysis of genes in planta. Plant Physiol. 133, 462-469.
Cutler, S.R., Ehrhardt, D.W., Griffitts, J.S., and Somerville, C.R. (2000). Random GFP::cDNAfusions enable visualization of subcellular structures in cells of Arabidopsis at a high frequency.Proc. Natl. Acad. Sci. U. S. A. 97, 3718-3723.
Govers, F., and Angenent, G.C. (2010). Plant science. Fertility goddesses as Trojan horses.Science 330, 922-923.
Hinsch, M., and Staskawicz, B. (1996). Identification of a new Arabidopsis disease resistancelocus, RPs4, and cloning of the corresponding avirulence gene, avrRps4, from Pseudomonassyringae pv. pisi. Mol. Plant Microbe Interact. 9, 55-61.
Inohara, Chamaillard, McDonald, C., and Nunez, G. (2005). NOD-LRR proteins: role in host-microbial interactions and inflammatory disease. Annu. Rev. Biochem. 74, 355-383.
Kaku, H., Nishizawa, Y., Ishii-Minami, N., Akimoto-Tomiyama, C., Dohmae, N., Takio, K.,Minami, E., and Shibuya, N. (2006). Plant cells recognize chitin fragments for defense signalingthrough a plasma membrane receptor. Proc. Natl. Acad. Sci. U. S. A. 103, 11086-11091.
Kessler, S.A., Shimosato-Asano, H., Keinath, N.F., Wuest, S.E., Ingram, G., Panstruga, R., andGrossniklaus, U. (2010). Conserved molecular components for pollen tube reception and fungalinvasion. Science 330, 968-971.
Kemmerling, B., Schwedt, A., Rodriguez, P., Mazzotta, S., Frank, M., Qamar, S.A.,Mengiste,T.,Betsuyaku, S., Parker, J.E., Mussig, C., et al. (2007). The BRI1-associated kinase 1,BAK1, has a brassinolide-independent role in plant cell-death control. Curr. Biol. 17, 1116-1122.
Kishi-Kaboshi, M., Okada, K., Kurimoto, L., Murakami, S., Umezawa, T., Shibuya, N., Yamane,H., Miyao, A., Takatsuji, H., Takahashi, A., and Hirochika, H. (2010). A rice fungal MAMP-
52
responsive MAPK cascade regulates metabolic flow to antimicrobial metabolite synthesis.Plant J. 63, 599-612.
Lipka, U., Fuchs, R., and Lipka, V. (2008). Arabidopsis non-host resistance to powdery mildews.Curr. Opin. Plant Biol. 11, 404-411.
Liu, J.J., and Ekramoddoullah, A.K. (2011). Genomic organization, induced expression andpromoter activity of a resistance gene analog (PmTNL1) in western white pine (Pinus monticola).Planta 233, 1041-1053.
Llorente, F., Alonso-Blanco, C., Sanchez-Rodriguez, C., Jorda, L., and Molina, A. (2005).ERECTA receptor-like kinase and heterotrimeric G protein from Arabidopsis are required forresistance to the necrotrophic fungus Plectosphaerella cucumerina. Plant J. 43, 165-180.
Lu, D., Wu, S., Gao, X., Zhang, Y., Shan, L., and He, P. (2010). A receptor-like cytoplasmickinase, BIK1, associates with a flagellin receptor complex to initiate plant innate immunity.Proc. Natl. Acad. Sci. U. S. A. 107, 496-501.
Mittler, R., Vanderauwera, S., Gollery, M., and Van Breusegem, F. (2004). Reactive oxygengene network of plants. Trends Plant Sci. 9, 490-498.
Miya, A., Albert, P., Shinya, T., Desaki, Y., Ichimura, K., Shirasu, K., Narusaka, Y., Kawakami,N., Kaku, H., and Shibuya, N. (2007). CERK1, a LysM receptor kinase, is essential for chitinelicitor signaling in Arabidopsis. Proc. Natl. Acad. Sci. U. S. A. 104, 19613-19618.
Nawrath, C., and Metraux, J.P. (1999). Salicylic acid induction-deficient mutants of Arabidopsisexpress PR-2 and PR-5 and accumulate high levels of camalexin after pathogen inoculation.Plant Cell 11, 1393-1404.
Nelson, B.K., Cai, X., and Nebenfuhr, A. (2007). A multicolored set of in vivo organelle markersfor co-localization studies in Arabidopsis and other plants. Plant J. 51, 1126-1136.
Ramakers, C., Ruijter, J.M., Deprez, R.H., and Moorman, A.F. (2003). Assumption-free analysisof quantitative real-time polymerase chain reaction (PCR) data. Neurosci. Lett. 339, 62- 66.
Ramirez, V., Agorio, A., Coego, A., Garcia-Andrade, J., Hernandez, M.J., Balaguer, B.,Ouwerkerk, P.B., Zarra, I., and Vera, P. (2011). MYB46 modulates disease susceptibility toBotrytis cinerea in Arabidopsis. Plant Physiol. 155, 1920-1935.
Ramonell, K.M., Zhang, B., Ewing, R.M., Chen, Y., Xu, D., Stacey, G., and Somerville, S.(2002). Microarray analysis of chitin elicitation in Arabidopsis thaliana. Mol. Plant. Pathol.3, 301-311.
Reuber, T.L., Plotnikova, J.M., Dewdney, J., Rogers, E.E., Wood, W., and Ausubel, F.M.(1998).Correlation of defense gene induction defects with powdery mildew susceptibility in Arabidopsisenhanced disease susceptibility mutants. Plant J. 16, 473-485.
53
Sanchez-Vallet, A., Ramos, B., Bednarek, P., Lopez, G., Pislewska-Bednarek, M., Schulze-Lefert, P., and Molina, A. (2010). Tryptophan-derived secondary metabolites in Arabidopsisthaliana confer non-host resistance to necrotrophic Plectosphaerella cucumerina fungi. Plant J.63, 115-127.
Shimizu, T., Nakano, T., Takamizawa, D., Desaki, Y., Ishii-Minami, N., Nishizawa, Y., Minami,E., Okada, K., Yamane, H., Kaku, H., and Shibuya, N. (2010). Two LysM receptor molecules,CEBiP and OsCERK1, cooperatively regulate chitin elicitor signaling in rice. Plant J. 64, 204-214.
Shiu, S.H., and Bleecker, A.B. (2001). Receptor-like kinases from Arabidopsis form amonophyletic gene family related to animal receptor kinases. Proc. Natl. Acad. Sci. U. S. A. 98,10763-10768.
Sparkes, I.A., Runions, J., Kearns, A., and Hawes, C. (2006). Rapid, transient expression offluorescent fusion proteins in tobacco plants and generation of stably transformed plants. Nat.Protoc. 1, 2019-2025.
Stein, M., Dittgen, J., Sanchez-Rodriguez, C., Hou, B.H., Molina, A., Schulze-Lefert, P., Lipka,V., and Somerville, S. (2006). Arabidopsis PEN3/PDR8, an ATP binding cassette
transporter, contributes to nonhost resistance to inappropriate pathogens that enter by directpenetration. Plant Cell 18, 731-746.
Veronese, P., Nakagami, H., Bluhm, B., Abuqamar, S., Chen, X., Salmeron, J., Dietrich, R.A.,Hirt, H., and Mengiste, T. (2006). The membrane-anchored BOTRYTIS-INDUCED KINASE1plays distinct roles in Arabidopsis resistance to necrotrophic and biotrophic pathogens. Plant Cell18, 257-273.
Wan, J., Zhang, S., and Stacey, G. (2004). Activation of a mitogen-activated protein kinasepathway in Arabidopsis by chitin. Mol. Plant. Pathol. 5, 125-135.
Wan, J., Zhang, X.C., Neece, D., Ramonell, K.M., Clough, S., Kim, S.Y., Stacey, M.G., andStacey, G. (2008). A LysM receptor-like kinase plays a critical role in chitin signaling and fungalresistance in Arabidopsis. Plant Cell 20, 471-481.
Wilson, I.W., Schiff, C.L., Hughes, D.E., and Somerville, S.C. (2001). Quantitative trait locianalysis of powdery mildew disease resistance in the Arabidopsis thaliana accession kashmir-1.Genetics 158, 1301-1309.
Zhang, B., Ramonell, K., Somerville, S., and Stacey, G. (2002). Characterization of early, chitin-induced gene expression in Arabidopsis. Mol. Plant Microbe Interact. 15, 963-970.
Zhang, X., Henriques, R., Lin, S.S., Niu, Q.W., and Chua, N.H. (2006). Agrobacterium-mediatedtransformation of Arabidopsis thaliana using the floral dip method. Nat. Protoc. 1, 641-646.
54
CHAPTERCHAPTERCHAPTERCHAPTER THREETHREETHREETHREE
CRLK1CRLK1CRLK1CRLK1 ISISISIS AAAA FUNCTIONALFUNCTIONALFUNCTIONALFUNCTIONALMANGANESE-DEPENDENTMANGANESE-DEPENDENTMANGANESE-DEPENDENTMANGANESE-DEPENDENT RECEPTOR-LIKERECEPTOR-LIKERECEPTOR-LIKERECEPTOR-LIKE KINASEKINASEKINASEKINASEINVOLVEDINVOLVEDINVOLVEDINVOLVED ININININ DEFENSEDEFENSEDEFENSEDEFENSE AGAINSTAGAINSTAGAINSTAGAINST FUNGALFUNGALFUNGALFUNGAL PATHOGENSPATHOGENSPATHOGENSPATHOGENS
INTRODUCTIONINTRODUCTIONINTRODUCTIONINTRODUCTION
Plants have evolved a system of defense mechanisms to perceive the invasion of
pathogens through Pathogen-associated Molecular Patterns (PAMPs) or effectors. When
pathogens attack plants, conserved signature molecules from pathogens can be recognized by
plant pattern recognition receptors (PRR) to initiate a PAMP-triggered immunity (PTI) (Zipfel
2009). However, pathogens may also suppress the PTI through secreting effector proteins into
the plant cell cytosol and altering defense signaling pathways. To overcome the pathogen
effectors, plants have evolved a specialized system to recognize pathogen effectors and initiate
effector-triggered immunity (ETI) (Chisholm et al. 2006).
Receptor-like kinases (RLKs) are one of the largest gene families in Arabidopsis and
many RLKs have been shown to recognize PAMPs and activate PTI (Shiu et al. 2001). A few
RLKs have been intensively studied and their ligands and functions in plant innate immunity
have been identified. For example, CERK1/LysM RLK1was shown to bind the elicitor chitin
and initiate defense responses against fungal pathogens in both Arabidopsis and rice (Miya et al.
2007; Wan et al. 2008; Shimizu et al. 2010). A typical RLK contains an extracellular domain, a
transmembrane domain, and a functional cytoplasmic kinase domain. Although many RLKs do
not have a ligand binding domain, they may still activate signaling pathways through association
55
with other RLKs to form protein complexes (Lu et al. 2010). Several RLKs lacking the ligand
binding domain have been reported to play prominent roles in defense against fungal pathogens.
BIK1, an Arabidopsis RLCK, is induced by the necrotrophic fungus Botrytis cinerea and bik1
knockout mutants displayed severe disease symptoms after fungal infection (Veronese et al
2006). In tomato, TPK1b, a homolog of BIK1, also plays an important role in defense against
B.cinerea (Abuqamar et al. 2008). Overexpression of a rice RLCK, OsBSR1, in Arabidopsis
increased resistance to the fungal pathogen C. higginsianum. Overexpression of OsBSR1 in rice
also conferred resistance to bacterial and fungal pathogens (Dubouzet et al. 2011).
CRLK1 was identified in an Arabidopsis screen for chitin-upregulated genes using
microarray analysis (Ramonell et al. 2005). Previous experiments in this dissertation showed
that knockout mutants of crlk1 were more susceptible to G. cichoracearum and P. cucumerina,
suggesting that CRLK1 is involved in resistance to fungal pathogens (Chapter two). Upon chitin
treatment, CRLK1 is induced rapidly about 10 fold within 1 hour and its expression drops to
negligible levels within 4 hours. Transient expression of a CRLK1-GFP fusion protein showed
that CRLK1 localizes to the plasma membrane (PM) and its transmembrane domain is critical for
correct targeting. In this chapter we show that CRLK1 encodes a functional kinase and that Mn2+
is required for its kinase activity. Overexpression of a 35S:CRLK1:GUS fusion protein in stable
transgenic Arabidopsis plants leads to an increase in resistance against G. cichoracearum.
Chitin-induced CRLK1 expression was repressed in both mapk3 andWRKY transcription factor
mutants suggesting that CRLK1 may be negatively regulated by these proteins during the defense
response.
56
MATERIALSMATERIALSMATERIALSMATERIALS andandandandMETHODSMETHODSMETHODSMETHODS
BiologicalBiologicalBiologicalBiological materialsmaterialsmaterialsmaterials andandandand growthgrowthgrowthgrowth conditionsconditionsconditionsconditions
T-DNA insertional mutant crlk1-2 (Salk_063626) and allWRKY mutants were obtained
from the Arabidopsis Biological Resource Center (ABRC, Ohio State University). To identify
homozygous T-DNA mutants, PCR reactions were performed using the following primers:
crlk1-2 (Salk_063626):
5'-GATGAAACCGAGTTAATACGGC-3'(F); 5'-GGTCGGTTAGGAACGGTTTAC-3' (R);
wrky6 (Salk_012997):
5'-GAACGTATTAGCCAATCACGC-3'(F); 5'-TGTGGACGTGTCATAATTTGG-3'(R);
wrky72 (Salk_055293):
5'-GAGTGGAAGAGAGTGGCTGTG-3' (F); 5'-CAAAACATGGTTGATCATCCC-3' (R);
wrky17 (Salk_076337):
5'-TGGATTTTGGTTAAAGACCTTC-3' (F); 5'-AGCAAGAAAGATCGAAGAGCC-3' (R);
wrky48 (Salk_066438):
5'-TTACCGGTGACCAGTGTTTTC-3' (F); 5'--CTTTTTGGCCGTATTTTCTCC-3' (R);
wrky53 (Salk_034157):
5'-TCAGGCACGACTTAGAGAAGC-3' (F); 5'-GGGAAAGTTGTGTCAATCTCG-3' (R);
wrky46 (Salk_134310):
5'-TCTGTCGATTCCAACAAAACC-3' (F); 5'-AAGCCAATTTTTATCCATCGG-3' (R);
wrky18 (Salk_093916):
5'-CGATATTTGTCACCTTCATCG-3' (F); 5'-TCATTTCGATGCAAAGACATTC-3' (R);
T-DNA primer: 5'-TAGCATCTGAATTTCATAACCAATCTCGATACAC-3'. Both the mapk3
and mapk6 mutants were a kind gift from Dr. Brian Ellis.
57
Arabidopsis plants were grown in soil under controlled environmental conditions in a
Percival chamber (22°C day/19°C night with 16 hours light/8 hours dark and relative humidity of
50%). For 35S:CRLK1:GUS lines, Arabidopsis seeds were surface sterilized and grown on
Murashige and Skoog (MS) medium plates with 50mg/ml hygromycin B under the same
environmental conditions as soil grown plants. After 7 days healthy seedlings were selected and
transferred to soil to complete the growth cycle. G. cichoracearum was cultured on cucumber
leaves (Burpee Gardening) according to standard protocols before inoculation onto Arabidopsis.
InInInIn silicosilicosilicosilico analysisanalysisanalysisanalysis ofofofof CRLK1CRLK1CRLK1CRLK1
Sequence alignment and construction of a phylogenetic tree was performed using the
software program phylogeny.fr (http://www.phylogeny.fr/version2_cgi/index.cgi ) as described,
which is based onMUMUMUMUltiple SSSSequence CCCComparison by LLLLog- EEEExpectation (MUSCLE) (Dereeper
et al. 2008). Transmembrane domain and phosphorylation sites of CRLK1 were predicted by
TMpred (http://www.ch.embnet.org/software/TMPRED_form.html) and PhosPhAt
(http://phosphat.mpimp-golm.mpg.de/). CRLK1 catalytic subdomains were predicted by
aligning CRLK1 with AhSTYK (Rudrabhatla and Rajasekharan 2002) using MUSCLE
(http://www.ebi.ac.uk/Tools/msa/muscle/). Data regarding expression of CRLK1 in various
Arabidopsis organs and after treatment with various pathogens and elicitors were obtained using
Genevestigator (https://www.genevestigator.com/gv/).
ExpressionExpressionExpressionExpression andandandand PurificationPurificationPurificationPurification ofofofof ΔΔΔΔTM-CRLK1TM-CRLK1TM-CRLK1TM-CRLK1
58
The ΔTM-CRLK1 construct was amplified by PCR using Iproof high fidelity DNA
polymerase (BioRad Hercule, CA). The primers used for amplification were:
5'-GGATCCAGAAAAAAACCAAACCGGTCC-3' (F);
5'-AAGCTTTCACCCTCCTTCCCTCTCCAA-3' (R).
The PCR product was cloned into the pGEM-T vector (Promega, Madison, WI) and then
digested using BamHI and HindIII restriction enzymes (New England BioLab). The DNA
fragment containing the CRLK1 sequence was extracted from an agrose gel, purified and
religated into the pQE80L protein expression vector (Qiagen). The vector containing the ΔTM-
CRLK1 was transformed into E.coli. Transformed E.coli was grown in 1.2L of LB medium with
100ug/ml ampicillin overnight. CRLK1 protein expression was induced by the addition of 100
μM IPTG (100μM) to the growth medium. The culture was allowed to grow for 12 hours post
induction. The cell culture was pelleted by centrifugation at 5000 rpm for 5 minutes at 8 °C. The
pellet was homogenized in 50 mM phosphate buffer and 0.1 mM protease inhibitor (PMSF). The
resuspended E.coli was frozen, thawed and sonicated for 1 hour on ice and then centrifuged at
18000 rpm for 20 minutes at 8 °C. The transparent supernatant was recovered and subjected to
ultracentrifugation for 1 hour. The supernatant containing the CRLK1 protein was then applied
to a Ni2+ column and eluted in 300 mM imidazole according to the manufacturer protocol
(Sigma). The eluted protein solution was then subjected to dialysis at 4°C for overnight in buffer
containing 30% glycerol, 200 mM NaCl and then stored at -80°C.
InInInIn vitrovitrovitrovitro kinasekinasekinasekinase assayassayassayassay ofofofof ΔΔΔΔTM-CRLK1TM-CRLK1TM-CRLK1TM-CRLK1
CRLK1 kinase activity was determined in 10 μl buffer containing 1 μl of 500 mM Tris
HCl, 1 μl of 100 mM Hepes, 0.2 μl of 100 mM DTT, 0.5 μl of 1mg/ml CRLK1 protein (a final
59
concentration of 50μg/ml), 2 μl of 2 mg/ml myelin basic protein, 1 μl of a 100 mM solution of
either Mn2+, Ca2+ or Mg2+, 5mCi/ml [γ32-P] ATP (3000Ci mmol-1; PerkinElmer, Waltham, MA),
10M ATP and H2O to a final volume of 10 μl. The reaction was incubated at room temperature
for 1 hour and then terminated by adding equal amount of 1% SDS and boiling the solution for 5
minutes. The samples were then separated by SDS-PAGE, the gels dried and then exposed to X-
ray film for 2 days.
IdentificationIdentificationIdentificationIdentification ofofofof phosphorylationphosphorylationphosphorylationphosphorylation sitessitessitessites inininin CRLK1CRLK1CRLK1CRLK1
The CRLK1 autophosphorylation site analysis was performed by Applied Biomics, Inc
(Hayward, CA). The procedure is as follows: CRLK1 (31-332) was autophosphorylated in the
presence of 10nM Mn2+ for 2 hours at room temperature and then the reaction buffer was
changed to 25 mM ammonium bicarbonate (PH 8.0) followed by reduction, alkylation and
trypsin digestion. The digested CRLK1 phospho-peptides were enriched by using Supel-Tips
columns (Sigma-Aldrich, St. Louis. MO), desalted by Zip-tip C18 (Millipore, Billerica,MA) and
then eluted from the Zip-tip C18 column with matrix solution (α-cyano-4-hydroxycinnamic acid,
5 mg/ml in 50% acetonitrile, 0.1% trifluoroacetic acid, 25 mM ammonium bicarbonate). The
eluted phospho-peptides were spotted onto a matrix-assisted laser desorption/ionization (MALDI)
plate and MALDI-TOF analysis was performed using an AB Sciex Proteomics Analyzer (AB
Sciex). The top hits with high confidence were subjected to UCSF protein Prospector
(http://prospector.ucsf.edu/prospector/mshome.htm) for virtual digestion. The MS precursors
that matched the virtual digestion were then subsequently subjected to MS fragmentation. The
phospho-peptide mass and associated fragmentation spectra were then analyzed using the
MASCOT search engine (http://www.osc.edu/supercomputing/software/apps/mascot.shtml) to
60
search the NCBI non-redundant database (NCBInr). Candidates with a protein intensity score
higher than 95 were considered significant.
GenerationGenerationGenerationGeneration andandandand histochemicalhistochemicalhistochemicalhistochemical analysisanalysisanalysisanalysis ofofofof transgenictransgenictransgenictransgenic ArabidopsisArabidopsisArabidopsisArabidopsis 35S:35S:35S:35S:CRLK1CRLK1CRLK1CRLK1:::: GUSGUSGUSGUS
A fragment containing full length CRLK1 cDNA was generated by PCR. Primers for
35S:CRLK1: GUS construct were:
5'-GGGACAAGTTTGTACAAAAAAGCAGGCTTCATGGACAAATCTGAAAAAATCGC- 3'
(F);
5'-GGGGACCACTTTGTACAAGAAAGCTGGGTCCCCTCCTTCCCTCTCCAAA-3' (R).
The underlined sequence is CRLK1 specific. The resulting PCR product was introduced into the
pDONR221 vector using Gateway® BP Clonase II enzyme mix (Invitrogen), subcloned into
pMDC139 and then transformed into Agrobacterium tumefaciens strain GV3101. Transgenic
Arabidopsis lines were generated via Agrobacterium-mediated transformation using standard
protocols (Zhang et al. 2006). The T1 transformants were selected for on plates containing 50
μg/ml of hygromycin B and stained using standard GUS staining protocols to confirm GUS
expression. Stable lines expressing GUS were selected and grown to the T3 generation. The T3
homozygous transgenic lines were then used in the G. cichoracearum infection assays.
InfectionInfectionInfectionInfection assaysassaysassaysassays withwithwithwith G.G.G.G. cichoracearumcichoracearumcichoracearumcichoracearum
Inoculation of Arabidopsis transgenic lines was performed by dusting G. cichoracearum
fungal spores onto Arabidopsis rosette leaves as previously described (Wilson et al., 2001). At 5
dpi, infected Arabidopsis leaves were cleared in 70% ethanol overnight and then stained with
trypan blue solution (25μg/ml trypan blue dissolved in 1:1:1 of glycerol, lactic acid and H2O) for
61
2 hours. After destaining with a solution containing 1:1:1 of glycerol, lactic acid and water, the
numbers of conidiophores produced per colony were counted using at least 20 leaves per
genotype. For chitin pretreatment, 21-day old Arabidopsis plants were sprayed with 200μg/ml
crab shell chitin in water either 4 hours or 24 hours before inoculation with G. cichoracearum
(described by Wan et al. 2008).
ElicitorElicitorElicitorElicitor treatmenttreatmenttreatmenttreatment ofofofof ArabidopsisArabidopsisArabidopsisArabidopsis liquidliquidliquidliquid cultureculturecultureculture
Arabidopsis seeds were surface sterilized and grown in 10ml of liquid culture (2%
Dextrose, 1 package of Murashige and Skoog salts dissolved in H2O) in 50ml conical tubes
under continuous light for two weeks. Plants were treated with either 50μl of 20mg/ml chitin
(Sigma, St Louis, MO, USA) or 10μl of 10mM flg22 (Genscript, Piscataway, NJ) for 30 minutes.
After treatment, plants were harvested, frozen immediately in liquid nitrogen and stored at -80°C.
TotalTotalTotalTotal RNARNARNARNA extraction,extraction,extraction,extraction, reversereversereversereverse transcription,transcription,transcription,transcription, andandandand quantitativequantitativequantitativequantitative realrealrealreal timetimetimetime PCRPCRPCRPCR
Arabidopsis total RNA was isolated from frozen tissues using TRizol Reagent
(Invitrogen) in a protocol suggested by the manufacturer. The extracted RNA was treated with
RQ1 DNase (Promega, Madison, WI) and then purified with an E.Z.N.A. RNA cleanup kit
(Omega Bio-tek, Norcross, GA). The purified RNA was screened for genomic DNA
contamination by qRT-PCR using Actin-2 primers. Actin-2 primer sequence was:
5'-GGTATTCTTACCTTGAAGTATCCTA-3'(F); 5’-
TCATTGTAGAAAGTGTGATGCCAGATC-3' (R).
The total RNA was digested with DNase until no genomic DNA was detectable by qRT-PCR
using Actin-2 primers. First strand cDNA was synthesized using the RevertAid First Strand
62
cDNA Synthesis Kit (Fermentas) and random hexamers according to the manufacturer’s protocol.
qRT-PCR was performed using PerfeCTa SYBR Green SuperMix for iQ™ (Quanta Biosciences,
Gaithersburg, MD) with a final volume of 20μl per reaction. qRT-PCR reaction was performed
in Hard-Shell® 96-Well Skirted PCR Plates using a DNA Engine Opticon® 2 system (BioRad,
Hercules, CA). Gene primers were designed using Beacon DesignerTM software (Premier Biosoft,
Palo Alto, CA) to have annealing temperatures between 55°C to 65°C and an amplicon length of
less than 300 bp. The qRT-PCR program consisted of: 50°C for 2 min; 95°C for 10 min; 95°C
for 15 s, 60°C for 30 s and 72°C for 30 s for 40 cycles. The raw qRT-PCR data was analyzed
using the LinRegPCR software program (Ramakers et al. 2003) and cycle threshold (CT) values
with optimized amplification efficiency and relative gene expression was calculated using Gene
Expression MacroTM (BioRad, Hercule, CA) that is based on ΔΔCT method. The following gene
specific primers were used in qRT-PCR :
CRLK1 (At5g46080):
5-'GGAGAAAGAATCGTCGTAAC-3' (F);
5'-GATGTGAATCTACCGTGAAC-3' (R);
Three independent biological replicates were performed for each experiment.
AccessionAccessionAccessionAccession numbersnumbersnumbersnumbers ofofofof genesgenesgenesgenes usedusedusedused inininin thisthisthisthis studystudystudystudy
CRLK1, At5g46080;MAPK3, At3g45640;MAPK6, At2g43790;WRKY6, At1g62300;
WRKY72, At5g15130;WRKY17, At2g24570; WRKY48, At5g49520; WRKY53, At4g23810;
WRKY46, At2g46400;WRKY18, At4g31800; ACTIN-2, At3g18780.
63
RESULTSRESULTSRESULTSRESULTS
SequenceSequenceSequenceSequence andandandand phylogeneticphylogeneticphylogeneticphylogenetic analysisanalysisanalysisanalysis ofofofof CRLK1CRLK1CRLK1CRLK1
Chitin responsive receptor-like kinase 1 (CRLK1) has been shown to play an important
role in Arabidopsis defense against both biotrophic and necrotrophic fungal pathogens (Chapter
two). Using the CRLK1 deduced amino acid sequence and NCBI BLAST 7 protein sequences
with an identity greater than 50% to CRLK1 were chosen for alignment and construction of a
phylogenetic tree using the Phylogeny.fr software program (http://www.phylogeny.fr/).
Phylogenetic analysis showed that CRLK1 is most related to a putative serine and threonine
kinase (AlRLK1) from Arabidopsis lyrata (Figure 3.1). To analyze CRLK1 subdomains, the
deduced CRLK1 amino acid sequence was further analyzed using TMpred
(http://www.ch.embnet.org/software/TMPRED_form.html) and PhosPhAt
(http://phosphat.mpimp-golm.mpg.de/). The TMpred output suggested that CRLK1 contained a
single transmembrane domain (TM), which a length of 12 to 30 amino acids (Figure 3S1).
PhosPhAt analysis predicted that the juxtamembrane (JM) domain is from amino acid 31 to 65
and the catalytic kinase domains are from amino acid 66 to 324 (Figure 3.2). Phosphorylation
sites of CRLK1 were predicted by PhosPhAt, which suggested 4 potential sites within the
juxtamembrane domain and 7 within the catalytic kinase domain (Figure 3.2). CRLK1 contains
all 12 conserved kinase catalytic subdomains (I to XI) when aligned with AhSTYK, a kinase
with subdomains predicted by Rudrabhatla and Rajasekharan (2002).
64
FigureFigureFigureFigure 3.13.13.13.1 AAAA pppphylogenetichylogenetichylogenetichylogenetic treetreetreetree basedbasedbasedbased onononon proteinproteinproteinprotein sequencesequencesequencesequence alignmentalignmentalignmentalignment ofofofof CRLK1CRLK1CRLK1CRLK1 andandandand sevensevensevensevenrelatedrelatedrelatedrelated proteins.proteins.proteins.proteins. The genebank accession number of each protein is: CRLK1 (Arabidopsisthaliana), NP_199420; AlRLK1 (Arabidopsis lyrata), XP_002863430; MtPK1 (Medicagotruncatula), ABN08719; RcPK (Ricinus communis), XP_002509422; PtPK2 (Populustrichocarpa), XP_002305775; PtPK1 (Populus trichocarpa), XP_002329804; VvPK1 (Vitisvinifera), XP_002278731; VvPK2 (Vitis vinifera), CAN77470. Protein sequences were alignedwith multiple sequence comparison by log-expectation (MUSCLE). The phylogenetic tree wasgenerated using the Phylogeny.fr platform (http://www.phylogeny.fr/). Horizontal branch lengthsrepresent protein divergence. Bootstrap values are above branches.
65
FigureFigureFigureFigure 3S13S13S13S1 PredictionPredictionPredictionPrediction ofofofof CRLK1CRLK1CRLK1CRLK1 transmembranetransmembranetransmembranetransmembrane domaindomaindomaindomainssss.... Hydropathy analysis of CRLK1was performed using TMpred. The TMpred output suggests a transmembrane domain fromamino acids 12-30.
66
MDKSEKIAYASVLSLLSLSLLLLIIFLFLLCRKKPNRSDDEYLLPETKPATTTTMMMM **** **** JJJJMMMM
GLSYSLTELDSATDGFNQRRIIGSGRLGTVYAAIIPDHKNLVAVKRIHP**** **** **** IIII IIIIIIII
GLVLSKPGFGFSTVIKSLSSSHHPNVVSILGFSEAPGERIVVTEFVGEIIIIIIIIIIII IIIIVVVV **** VVVV
GKSLSDHLHGGSNSATAVEFGWKTRFKIAAGAARGLEYLHEIANPRIV**** VVVVIIII AAAA ****
HGRFTSSNVLVDEKSTAKICDYGFGFLIPIEKSGIFGYIEEGYCKESDVVVVVIIII BBBB VVVVIIIIIIII VVVVIIIIIIIIIIII
YGYGVVLMEILSGRRSENGLIVKWATPLIKEQRFAELLDPRIVVQSEIKIIIIXXXX XXXX **** XXXXIIIISLVIRLAKVALACVGNSRRSRPSISEVAAILNSLEREGG
****
FigureFigureFigureFigure 3.23.23.23.2 SubdomainsSubdomainsSubdomainsSubdomains andandandand predictedpredictedpredictedpredicted phosphorylationphosphorylationphosphorylationphosphorylation sitessitessitessites ofofofof CRLK1.CRLK1.CRLK1.CRLK1. The first 30 aminoacids (underlined) were predicted to be a transmembrane domain in TMpred (Hofmann andStoffel, 1993). The underlined protein sequences with roman numerals are canonical kinasecatalytic subdomains generated by aligning CRLK1 with the ahSTYK kinase (Rudrabhatla andRajasekharan 2002). Asterisks indicate phosphorylation sites predicted by PhosPhAt 3.0. TM,transmembrane domain; JM, juxtamembrane domain.
67
CRLK1CRLK1CRLK1CRLK1 isisisis aaaa functionalfunctionalfunctionalfunctional kinasekinasekinasekinase andandandand itsitsitsits activityactivityactivityactivity requirerequirerequirerequiressss MnMnMnMn2+2+2+2+
The CRLK1 amino acid sequence predicted that it contained a tyrosine/threonine/serine
intracellular kinase domain. To test whether CRLK1 was a functional kinase, we expressed the
intracellular kinase region of CRLK1 in E.coli. The full length CRLK1 was also expressed in
E.coli but was mainly expressed in the insoluble fraction of total E.coli proteins, suggesting that
CRLK1 may also localize into the membrane system of E.coli. The ΔTM-CRLK1 protein was
expressed as a fusion protein that contained six histidine residues on the truncated N-terminus.
The protein was purified by affinity chromatography and detected as a 32k Da protein by SDS-
PAGE (Figure 3.3 A). This finding was consistent with the prediction from the amino acid
sequence. The purified protein was incubated buffers containing [γ32-P]-ATP and myelin basic
protein (MBP) as an artificial substrate. The mixture was analyzed via SDS-PAGE and
autoradiographed for 48 hours. Results showed that the autophosphorylation of ΔTM-CRLK1
could only be detected in buffers containing Mn2+ (Data not shown). Thus, we predicted that
CRLK1 kinase activity was dependent on the presence of Mn2+. In order to test this hypothesis,
we incubated the CRLK1 protein with MBP as an artificial substrate in buffers containing
incrementally increasing concentrations of Mn2+. CRLK1 kinase activity was extremely low in
buffers containing less than 5 mM Mn2+ (Figure 3.3B). Both autophosphorylation of CRLK1 and
MBP phosphorylation reached a high level at 10 mM Mn2+ and a maximum level at 20 mMMn2+.
The CRLK1 kinase activity began to be inhibited at concentrations of 50 mM Mn2+.
In order to determine whether CRLK1 is also active in the presence of other divalent
metal ions, we incubated CRLK1 with MBP in buffers combining Ca2+, Mg2+ and Mn2+. Very
weak kinase activity of CRLK1 can be detected in the presence of Ca2+ but no activity was
68
detected when incubated with Mg2+ alone. When combining Ca2+ and Mg2+, CRLK1 activity
showed a similar intensity to that of Ca2+ alone (Figure 3.3C). In a buffer solution containing
Ca2+ and Mn2+ together, CRLK1 showed less activity than with Mn2+ alone, indicating that Ca2+
may compete with Mn2+ for kinase binding sites. Mg2+ and Mn2+ increased the
autophosphorylation activity of CRLK1, but decreased the MBP phosphorylation compared to
that of Mn2+ alone. In the presence of Ca2+, Mg2+ and Mn2+, the Mn2+ dependent kinase activity is
strongly inhibited, compared to the combinations of Ca2+/Mn2+ and Mg2+/Mn2+ (Figure 3.3C).
69
30kDa25kDa
17kDa
7kDa
46kDa58kDa80kDa
175kDa
ΔTM-CRLK1
AAAA
0 0.1 0.5 1 2 5 10 20 50 mM
MBP
Mn2++++[[[[CCCC]]]]BBBB
ΔTM-CRLK1
Ca2+Mg2+Mn2+
+ - - + + - +- + - + - + +- - + - + + +
MBP
CCCC
ΔTM-CRLK1
FigureFigureFigureFigure 3.33.33.33.3 PurificationPurificationPurificationPurification andandandand inininin vitrovitrovitrovitro kinasekinasekinasekinase assayassayassayassay ofofofof truncatedtruncatedtruncatedtruncated CRLK1CRLK1CRLK1CRLK1 ((((ΔΔΔΔTM-CRLK1)TM-CRLK1)TM-CRLK1)TM-CRLK1) ininininE.coliE.coliE.coliE.coli.... AAAA. The purified ΔTM-CRLK1 from E.coli total protein was analyzed by SDS-PAGE. BBBB.CRLK1 kinase activity increased in a gradient of MnCl2. CCCC. CRLK1 kinase activity incombination of bivalent ions Ca2+, Mg2+ and Mn2+. MBP, myelin basic protein; ΔTM-CRLK1,mutant CRLK1 protein with transmembrane domain deleted.
70
PhosphorylationPhosphorylationPhosphorylationPhosphorylation sitesitesitesite identificationidentificationidentificationidentification inininin thethethethe CRLK1CRLK1CRLK1CRLK1 proteinproteinproteinprotein usingusingusingusing MassMassMassMass SpectrometrySpectrometrySpectrometrySpectrometry ((((MS)MS)MS)MS)
In order to determine where CRLK1 is autophosphorylated in vitro, we determined the
phosphorylation sites of CRLK1 using Mass Spectrometry (MS). In brief, CRLK1 purified
protein was autophosphorylated in vitro and then subjected to trypsin digestion. The digested
CRLK1 phospho-peptides were enriched and then analyzed by MS. Two phospho-peptides were
identified in CRLK1’s cytoplasmic kinase domain region as potential phosphorylation sites
(Table 3.1). For the first phospho-peptide containing amino acids 241 to 258, two tyrosines were
phosphorylated in vitro. Two out of four serines in the second peptide (AA 150 to 170) may also
be autophosphorylated. Identification of the serine at amino acid 152 was consistent with the
predicted phosphorylation sites identifies using PhosPhat. The data suggest that CRLK1 is a
dual-specificity kinase that phosphorylates tyrosine and serine in vitro. The ion score and signal
count for the two phospho-peptides were low due to either low phosphorylation efficiency in the
sample or a low concentration of purified protein (Figure 3S2). It is possible that other
phosphorylation sites may be identified if phosphorylation efficiency can be increased or a
higher concentration of purified protein is used for the in vitro kinase assay.
71
Table 3.1 Potential phosphorylation sites in phospho-peptide identified from MS/MS
Observed Massa Start - Endb Phospho-Peptide Sequencec Loss of phosphated2066.7854 241-258 ESDVYGYGVVLMEILSGR 22519.8459 150-170 SLSDHLHGGSNSATAVEFGW
K2
a The Mass Value (Da) of phospho-peptide sequence.bPosition of phospho-peptide sequence in the complete amino acid sequence/cContains phosphorylated residue (tyrosine, threonine, or serine). The potential phosphorylationsites were underlined.dNumber of phosphorylated amino acids in the peptide.
72
A
Loss of Phosphate(2146 - 80 - 80 = 1986 Da)
ESDVYGYGVVLMEILSGR Phospho(Y)[5,7]Ion Score = 0
B
Loss of Phosphate2519 - 98 - 98 = 2323 Da
SLSDHLHGGSNSATAVEFGWK
Ion Score = 0
FigureFigureFigureFigure 3S3S3S3S2222 Phospho-peptidesPhospho-peptidesPhospho-peptidesPhospho-peptides identifiedidentifiedidentifiedidentified fromfromfromfromMS/MSMS/MSMS/MSMS/MS forforforfor CRLK1.CRLK1.CRLK1.CRLK1.CRLK1 purified protein was autophosphorylated for 2 hours at room temperature in the presenceof manganese. The phosphorylated protein was then digested by trypsin and enriched forphospho-peptides that were subjected to MS/MS for analysis. AAAA. A 2146 Da phospho-peptidecontaining two tyrosine residues that are potentially phosphorylated. BBBB. A 2519 Da phospho-peptide containing four serine residues. Two of the identified serine residues are potentiallyphosphorylated.
73
CRLK1CRLK1CRLK1CRLK1 participatesparticipatesparticipatesparticipates inininin plantplantplantplant defensedefensedefensedefense againstagainstagainstagainstG.G.G.G. cichoracearumcichoracearumcichoracearumcichoracearum andandandand ooooverexpressionverexpressionverexpressionverexpression ofofofofCRLK1CRLK1CRLK1CRLK1 enhanceenhanceenhanceenhancessss resistanceresistanceresistanceresistance totototo G.G.G.G. cichoracearumcichoracearumcichoracearumcichoracearum infection.infection.infection.infection.
We previously showed that a homozygous T-DNA insertional mutants in crlk1
(Sail_801_H08) display a higher susceptibility to the biotrophic fungal pathogen G.
cichoracearum and the necrotrophic fungus P. cucumerina compared to wild type plants
(Chapter two). In order to further confirm this result, transgenic Arabidopsis plants
overexpressing 35S:CRLK1:GUS fusion protein driven by CaMV 35S promoter was generated
via Agrobacterium-mediated transformation (Zhang et al. 2006). It has been shown that
pretreatment of Arabidopsis plants with crab shell chitin (CSC) can enhance plant resistance to
both fungal and bacterial pathogens (Wan et al. 2008). When mutants in the chitin receptor
CERK1/LysM RLK1 were pretreated with crab shell chitin (CSC), this failed to protect plants
from A. brassicicola and P. syringae pv tomato DC3000 infection since chitin-mediated
signaling is blocked (Wan et al. 2008) indicating that CERK1/LysM RLK1 is critical for chitin-
induced resistance. In order to dissect the function of CRLK1 in chitin signaling, we pretreated
two CRLK1 mutants (crlk1-1 and crlk1-2), CRLK1 overexpression lines (35S:CRLK1: GUS),
Col-0 wild type and the hypersusceptible transgenic plant NahG with crab shell chitin 4 hours
and 24 hours before inoculation of G. cichoracearum. At 5 days post-inoculation (dpi), the
susceptibility of each line was determined by quantifying the conidiophores per fungal colony on
infected Arabidopsis leaves. As Figure 3.4 shows, pretreatment of Col-0 wild type with crab
shell chitin (CSC) increased resistance against G. cichoracearum compared to control treated
plants. Without pretreatment, both T-DNA insertion mutants of CRLK1 (crlk1-1 and crlk1-2)
were significantly more susceptible to G. cichoracearum compared to Col-0 wild type (Figure
3.4 A, B and C). In addition, overexpression of the 35S:CRLK1: GUS fusion protein in
74
Arabidopsis significantly increased plant resistance to G. cichoracearum (Figure 3.4B). At 5
dpi, the number of fungal colonies on 35S:CRLK1: GUS leaves was much less than on Col-0
wild type (data not shown). At 10 dpi CRLK1 overexpression lines were still resistant to G.
cichoracearum infection (Figure 3.4C), indicating that CRLK1 is critical in activating plant
defense against fungal pathogens. Compared with untreated crlk1-1 and crlk1-2 mutants, both
chitin-pretreated crlk1-1 and crlk1-2 mutants showed an enhanced resistance to G.
cichoracearum, suggesting that mutations in CRLK1 do not fully block chitin-mediated signaling.
Pretreatment of 35S:CRLK1: GUS lines with Crab Shell Chitin (CSC) conferred a similar
resistance compared to untreated 35S:CRLK1: GUS plants (Figure 3.4B). Therefore the
protective effect of pre-treatment with chitin may be negligible in Arabidopsis due to the
constitutive activation of defenses by CRLK1 overexpression.
75
0
2
4
6
8
10
12
14
16
18
cccc////cccc* *
*
*
++
+
Contro l Chitin trea tm ent
Col-0 crlk1-1 crlk1-2 35S:CRLK1: GUS NahG
Col-0 crlk1-1 crlk1-2 35S:CRLK1: GUS NahGA
B
C
76
FigureFigureFigureFigure 3.43.43.43.4 PhenotypesPhenotypesPhenotypesPhenotypes ofofofof ArabidopsisArabidopsisArabidopsisArabidopsis CRLK1CRLK1CRLK1CRLK1 mutantsmutantsmutantsmutants andandandand overexpressionoverexpressionoverexpressionoverexpression lines.lines.lines.lines. A.A.A.A.Microscopic photographs were taken from infected leaves stained with trypan blue from control(panel a) and chitin pretreated (panel b) Arabidopsis at 5 dpi. Fungal conidiophores and hyphaewere stained by trypan blue and Arabidopsis leaves were cleared in 70% ethanol after staining.Scale bar represents 0.5mm. BBBB.... Quantification of the numbers of G. cichoracearumconidiophores on chitin or H2O (control) pretreated Arabidopsis rosette leaves. Each data pointrepresents the average number of conidiophores per colony (c/c) counted from 18 leaves of 6plants for each genotype. Error bar denotes standard error. The white and gray bars indicatecontrol and chitin treatment respectively. The asterisk indicates significant difference (p<0.05)between untreated Arabidopsis lines and Col-0 wild type plants. The plus symbol indicates thesignificant difference (p<0.05) between the chitin treated and control plants of the same genotype.The p-value is calculated based on a student's t-test. Each data set was repeated for at least twobiological replicates. C.C.C.C.Macroscopic photographs were taken at 10 dpi from Arabidopsis leavesinoculated at high density with spores of G. cichoracearum. Leaves of the T-DNA insertionalmutants crlk1-1 (SAIL_801_H08) and crlk1-2 (Salk_063626) developed a heavier fungalcoverage on the leaves and displayed more disease symptoms than Col-0 wild type. Leaves fromCRLK1 overexpression lines (35S:CRLK1: GUS) were highly resistant to G. cichoracearuminfection.
77
CRLK1CRLK1CRLK1CRLK1 expressionexpressionexpressionexpression isisisis inducedinducedinducedinduced uponuponuponupon infectioninfectioninfectioninfection withwithwithwith variousvariousvariousvarious pathogenspathogenspathogenspathogens andandandand treatmenttreatmenttreatmenttreatment withwithwithwithotherotherotherother elicitorselicitorselicitorselicitors
We showed that CRLK1 is highly induced by chitin within 1 hour and that the induction
dropped to a negligible level within 4 hours (Chapter two). However, whether CRLK1 responds
to other pathogens or elicitors is unknown. To investigate the expression of CRLK1 in different
tissues / development stages in Arabidopsis, after infection with other pathogens and after
treatment with other elicitors, we obtained expression data on CRLK1 from Genevestigator, a
database containing publicly available microarray data (Zimmermann et al. 2005). Based on this
microarray data, CRLK1 is highly expressed in both young and developed flowers (Figure 3.5A)
which is consistent with the expression pattern of pCRLK1::GUS in plants (Chapter two).
Overall, the expression levels of CRLK1 in other Arabidopsis tissues/organs were very low
throughout all other developmental stages (Figure 3.5A). Upon stimuli, CRLK1 is induced by
many pathogens including Botrytis cinerea (necrotrophic fungi), Blumeria graminis (biotrophic
fungi), Bemisia tabaci type B (Insect), Golovinomyces cichoracearum (biotrophic fungi) and
Pseudomonas syringae (bacterium). Aside from chitin, CRLK1 is also induced by bacterial
elicitors flg22, hrpZ, EF-Tu, LPS, and Oligogalacturonide (OG), a plant danger-associated
molecular pattern (DAMP) (Figure 3.5 B). The induction of CRLK1 by flg22 was confirmed by
qRT-PCR (Figure 3.5 C).
FLS2 and CERK1/LysM RLK1 are the Arabidopsis receptors for flg22 and chitin
respectively (Gomez-Gomez and Boller 2000; Miya et al. 2007; Wan et al. 2008). In order to
test whether mutations in FLS2 and CERK1 can affect induction of CRLK1 upon chitin or flg22
treatment, CRLK1 expression was detected in the Arabidopsis Ws-0 ecotype (FLS2 is mutated in
78
Ws-0) treated with chitin or cerk1 mutants treated with flg22. As figure 3.5C showed, CRLK1
expression in the flg22-treated cerk1 mutant remained similar to wild type levels. Chitin treated
Ws-0 mutants had a higher induction of CRLK1 than that of wild type plants, indicating that
FLS2 may repress CERK1-mediated chitin signaling.
Induction of most of chitin responsive genes including CRLK1 was blocked in the cerk1
knockout mutant (Wan et al. 2008). One model suggests that CERK1/LysM RLK1 may operate
through induction of a MAPK cascade and transcription factors such as those in the WRKY
family (Wan et al. 2008). MAPK3 and MAPK6 are induced upon chitin treatment (Wan et al.
2004) and are known to play important roles in plant innate immunity (Rodriguez et al. 2010).
WRKY proteins are a large family of transcription factors that have been shown to positively and
negatively regulate Arabidopsis defense pathways (Pandey and Somssich 2009). WRKY
transcription factors bind to W boxes (core sequence of TGAC) in the promoter region of many
RLKs (Du and Chen 2000). There are seven W boxes in the promoter region of CRLK1
suggesting CRLK1 may also be regulated by WRKY transcription factors (Chapter two). In
order to test whether MAPK3/6 and WRKY TFs regulate CRLK1, induction of CRLK1 by chitin
was determined in mapk3, mapk6 and several wrky mutants. As shown in Figure 3.6A-C,
CRLK1 induction by chitin was increased in mapk3, wrky6, wrky17, wrky48, wrky53 and wrky46
mutants, suggesting that CRLK1 is negatively regulated by MAPK3 and WRKY transcription
factors during chitin-mediated defense.
79
0
100
200
300
400
500
600
700
800
900
germinatedseeds
seedling
young rosette
developedrosette
bolting
young flower
developedflower
flowersand siliques
mature siliques
Signalintensity
AAAA
0
2
4
6
8
10
12
Foldchange
B.cinerea
B.graminis
G.cichoracearum
B.tabacitype B
P.syringae chi
tinEF-Tu
flg22
HrpZ(1h)
LPS (1h)
OG(1h)
GST-NPP1
BBBB
0
5
10
15
20
25
30
35
Col-0 Col-0Col-0 Ws-0 cerk1
chitin flg22 chitin+flg22 chitin flg22Treatment
Background
Foldchange
CCCC
FigureFigureFigureFigure 3.53.53.53.5 CRLK1CRLK1CRLK1CRLK1 genegenegenegene expressionsexpressionsexpressionsexpressions inininin ArabidopsisArabidopsisArabidopsisArabidopsis organsorgansorgansorgans andandandand underunderunderunder variousvariousvariousvarioustreatments/conditions.treatments/conditions.treatments/conditions.treatments/conditions. AAAA.... CRLK1 expression in Arabidopsis organs were analyzed using themicroarray database software Genevestigator. B.B.B.B. CRLK1 expression is induced by pathogensand general elicitors. Expression data from Genevestigator was obtained from microarray rawdata using the MASS algorithm. C.C.C.C. Expression of CRLK1 was analyzed after 30 minutetreatments with either flg22 or chitin in Col-0, Ws-0 and cerk1 (At3g21630) by qRT-PCR. Datarepresents ratio of expression between mock (H2O) and treated plants in three independentbiological replicates. Error bars represents standard error.
80
Foldchange
051015202530354045
Col-0 mapk3 mapk6
AAAA
0
10
20
30
40
05101520253035
Foldchange
Foldchange
Col-0 wrky6 wrky72 wrky17
wrky48 wrky53 wrky46 wrky18Col-0
BBBB
CCCC
FigureFigureFigureFigure 3.63.63.63.6 ExpressionExpressionExpressionExpression ofofofof CRLK1CRLK1CRLK1CRLK1 afterafterafterafter chitinchitinchitinchitin treatmenttreatmenttreatmenttreatment ininininMAPKMAPKMAPKMAPK andandandandWRKYWRKYWRKYWRKYmutants.mutants.mutants.mutants. A.A.A.A.Induction of CRLK1 in Col-0 wild type, mapk3 and mapk6 after CSC treatment for 30 minutes. BBBBand C.C.C.C. Induction of CRLK1 in Col-0 wild type, wrky6, wrky72, wrky17, wrky48, wrky53, wrky46,and wrky18 mutants after chitin treatment (30 minutes). Data represent ratio between mock andtreated plants of three independent biological replicates. Error bars indicate standard error.
81
DISCUSSIONDISCUSSIONDISCUSSIONDISCUSSION
CRLK1CRLK1CRLK1CRLK1 isisisis distinctdistinctdistinctdistinct fromfromfromfrom otherotherotherother RLKsRLKsRLKsRLKs inininin ArabidopsisArabidopsisArabidopsisArabidopsis andandandand otherotherotherother plantplantplantplant speciesspeciesspeciesspecies
In Arabidopsis thaliana, CRLK1 is in the CR4-L clade but is markedly distinct from other
RLK members in the CR4-L group (Shiu and Bleecker 2001). When comparing the RLK protein
sequences from Arabidopsis thaliana and rice, CRLK1 is closely related to the rice RLK
Osi007326.1 and these two RLKs form their own group RLCK-XIV (Shiu et al. 2004). These
data indicate CRLK1 is quite distinct from other RLK family members in Arabidopsis. In order
to study whether CRLK1 is closely related to any RLK’s in other plant species, we compared the
CRLK1 protein sequence with 7 other RLKs that had an identity score higher than 50% from
various plant species (Figure 3.1). We found that CRLK1 is most closely related to AlRLK
(XP_002863430) in Arabidopsis lyrata, a close relative species of Arabidopsis thaliana. CRLK1
and AlRLK1 form a clade that is sister to another clade composed of MtPK1, RcPK, PtPK1,
PtPK2, VvPK1 and VvPK2. Both clades had 100% bootstrap support. Taken together, CRLK1
is distinct among RLK members found both in Arabidopsis thaliana and in other plant species.
CRLK1CRLK1CRLK1CRLK1 encodeencodeencodeencodessss aaaa functionalfunctionalfunctionalfunctional MnMnMnMn2+2+2+2+ -dependent-dependent-dependent-dependent kinasekinasekinasekinase
To date, many RLKs have been reported to be involved in plant defense against
pathogens. However, only a few RLKs have actually been expressed and purified in order to
determine their ability to phosphorylate themselves or other substrates. It is assumed that RLKs
function in plant signaling pathways through phosphorylation of various substrates. However, a
RLK called Atypical Receptor-like kinase 1 (TARK1) from tomato was found to be exception
because its cytoplasmic kinase domain is inactive (Kim et al. 2009). TARK1 may function in
defense responses by interacting with other primary receptors (Kim et al. 2009). Nemoto et al.
82
(2011) studied serine/threonine autophosphorylation in 759 Arabidopsis kinases and found that
179 of these protein kinases demonstrated autophosphorylation activity. CRLK1
autophosphorylation was not analyzed in those experiments (Nemoto et al. 2011). In the current
work, we have shown that CRLK1 is capable if both autophosphorylation and phosphorylation of
an artificial substrate, myelin basic protein (MBP) (Figure 3.3B). To determine the effects of
divalent metal ions on CRLK1 kinase activity, we showed that CRLK1 has its highest kinase
activity in the presence of Mn2+ (Figure 3.3C). Many studies have shown that Mn2+ is required or
preferred for activating many plant RLK. For example, Arabidopsis CRINKLY4 (ACR4), an
RLK close to CRLK1 in the Arabidopsis RLK phylogenetic tree (Shiu and Bleecker 2001), has
been shown to prefer Mn2+ to Mg2+ for its own autophosphorylation (Meyer et al. 2011). In
addition, a pepper receptor-like kinase, CaRLK1, exhibits kinase activity only in the presence of
Mn2+ (Yi et al. 2010). Alignment of the Mn2+ dependent kinase AtSTYPK(AT) with another
known Mg2+ dependent kinase AhSTYPK(AH) and the conserved sequence for Mn2+dependent
kinase domains suggested that a conserved histidine at amino acid 248 in AtSTYPK might be
critical for Mn2+ dependent kinase activity (Reddy and Rajasekharan 2006). Mutation of the
conserved histidine to an alanine residue in AtSTYPK leads to a loss of kinase activity (Reddy
and Rajasekharan 2006). Alignment of CRLK1 with AtSTYPK revealed that CRLK1 also
contains a conserved histidine that is critical for kinase activity. However, the conserved
histidine was not found in AhSTYPK, a Mg2+ -dependent kinase (Figure 3S3).
83
AT LVNYEEWTIDLRKLHMGPAFAQGAFGKLYRGTYNGEDVAIKLLERSDSNPEKAQALEQQF 177AH LENFDEWTIDLRKLNMGEAFAQGAFGKLYRGTYNGEDVAIKILERPENELSKAQLMEQQF 135CRLK1 SYSLTELDSATDGFNQRRIIGSGRLGTVYAAIIPDHKNLVAVKRIHPGLVLSKPGFG--F 110Mn -----------------RLLSRGAEGDIYLTEWGSRAAVLKIRRARGYRNAD-------L 36
:. * * :* .. : : . . :AT QQEVSMLAFLKHPNIVRFIGACIKPMVWCIVTEYAKGG-SVRQFLTKRQNRAVPLKLAVM 236AH QQEVMMLATLKHPNIVRFIGACRKPMVWCIVTEYAKGG-SVRQSLMKRQNRSVPLKLAVK 194CRLK1 STVIKSLSSSHHPNVVSILGFSEAPGERIVVTEFVGEGKSLSDHLHGGSNSATAVEFGWK 170Mn DARLRKRRTVREAEIIRQARSAGVPVPVVFFVDTVECS-ITMQHVRGRPVSSFSGAALVR 95
. : :..::: . * ...: . . : : : .AT QALDVAR----GMAYVHERN---FIHRDLKSDNLLISADRSIKIADFGVARIEVQTEGMT 289AH QALDVAR----GMAYVPWLG---LIHRDLKSDNLLIFGAKSIKIADFGVAGIEVQTEGMT 247CRLK1 TRFKIAAGAARGLEYLHEIANPRIVHGRFTSSNVLVDEKSTAKICDYGFG-FLIPIE--- 226Mn LAEQIGR----MAGTLHKNG---IMHGDLTTSNFIRSGG-TLYAIDFGLS---------- 137
.:. : ::* :.:.*.: : *:*..AT PETGTYRWMAPEMIQHRPYTQKVDVYSFGIVLWELITGLLPFQNMTAVQAAFAVVNRGVR 349AH PETGTYRWMAPEMIQHRPYTQKVDVYSFGIVLWELIPGMLPFQNMPAVQAAFAVVTKNVR 307CRLK1 -KSGIFGYIEEG------YCKESDVYGYGVVLMEILSGRR---------SENGLIVKWAT 270Mn -----------------ARTDKPEDHAVDLRLFKEI-----------------LNSAHVR 163
.: : :. .: * : : : .
FigureFigureFigureFigure 3S3S3S3S3333 SequenceSequenceSequenceSequence alignmentalignmentalignmentalignment ofofofof CRLK1CRLK1CRLK1CRLK1 withwithwithwith ArabidopsisArabidopsisArabidopsisArabidopsis kinasekinasekinasekinase (AT),(AT),(AT),(AT), ArachisArachisArachisArachis kinasekinasekinasekinase(AH)(AH)(AH)(AH) andandandand thethethethe conservedconservedconservedconserved manganesemanganesemanganesemanganese----dependentdependentdependentdependent kinasekinasekinasekinase domaindomaindomaindomain (Accession(Accession(Accession(Accession numbernumbernumbernumberCOG0515).COG0515).COG0515).COG0515). Accession numbers for kinases are as follows: AT, NP_565568; AH, AY027437.Amino acids marked in red indicate the conserved histidine residues for Mn2+ dependent kinases.Asterisks indicate conserved amino acids among all kinase domains.
84
CRLK1CRLK1CRLK1CRLK1 andandandand itsitsitsits signalingsignalingsignalingsignaling pathwaypathwaypathwaypathway
It is clear that CRLK1 acts downstream of CERK1/LysM RLK1 in the chitin signaling
pathway since CRLK1 induction by chitin is blocked in cerk1 mutants (Wan et al. 2008).
Interestingly, CRLK1 can also be induced by the bacterial elicitor flg22 in Col-0 wild type
(Figure 3.5C). Zipfel et al. showed that induction of almost all flg22-responsive genes was
blocked in an fls2-17 mutant treated with flg22 (Zipfel et al. 2004). CRLK1 was induced 2.7 fold
and 1.1 fold in the Arabidopsis ecotype Landsberg erecta Ler-0 and fls2-17 mutants respectively
suggesting that CRLK1 also operates downstream of FLS2 in the flagellin-induced signaling
pathway (Zipfel et al. 2004). Both MAPK3 and MAPK6 have been intensively studied regarding
their function in pathogen-triggered plant defense signaling and it is well known that they can be
stimulated by various PAMPs (Reviewed by Tena et al. 2011). In Arabidopsis treated with
chitin,MAPK3 mRNA transcripts were induced by chitin and MAPK3 and MAPK6 kinase
activity was strongly increased upon chitin treatment (Wan et al. 2004). Our data shows that
CRLK1 induction upon chitin treatment is significantly increased in mapk3 mutants, suggesting
thatMAPK3 may be a negative regulator of CRLK1 expression.
WRKY transcription factors have been shown to regulate plant defense both positively
and negatively. For example, AtWRKY48 is a negative regulator of Arabidopsis defense against
the virulent bacterial pathogen P. Syringaepv. tomato DC3000 (Xing et al. 2008). WRKY18 was
found to be partially redundant with WRKY40 and WRKY60 in the negative regulation of
defense responses against P. syringae pv. tomato DC3000 (Xu et al. 2006) and the biotrophic
fungal pathogen Golovinomyces orontii (Shen et al. 2007). In contrast, wrky18/40 and
wrky18/60 double mutants conferred higher susceptibility to the necrotrophic fungal pathogen B.
cinerea (Xu et al. 2006). WRKY53 also displayed opposing roles in defense signaling when
85
Arabidopsis was challenged by different pathogens (Pandey and Somssich 2009). In the current
study, we show that CRLK1 induction by chitin was significantly higher in wrky6, wrky17,
wrky48, wrky46, wrky53 than in Col-0 wild type (Figure 3.6C and D). While it is possible that
these WRKY transcription factors negatively regulate CRLK1 in chitin signaling further study is
needed to investigate whether these WRKY transcription factors can bind directly to the CRLK1
promoter and regulate its expression.
In conclusion, we have shown that CRLK1 is a functional receptor-like kinase involved in
defense against fungal pathogens and that Mn2+ is critical for its kinase activity in vitro.
Furthermore, we show that CRLK1 may be negatively regulated by MAPK3 and severalWRKY
transcription factors during chitin-mediated defense responses (Figure 3.6A-C). The
characterization of CRLK1 provides important information on both its function and regulation in
chitin-mediated signaling. This work establishes a foundation for further studies to identify
CRLK1’s interactor(s) and its mechanism of regulation during defense responses.
86
REFERENCESREFERENCESREFERENCESREFERENCES
Abuqamar, S., Chai, M.F., Luo, H., Song, F., and Mengiste, T. (2008). Tomato protein kinase 1bmediates signaling of plant responses to necrotrophic fungi and insect herbivory. Plant Cell 20,1964-1983.
Adai, A., Johnson, C., Mlotshwa, S., Archer-Evans, S., Manocha, V., Vance, V., and Sundaresan,V. (2005). Computational prediction of miRNAs in Arabidopsis thaliana. Genome Res. 15, 78-91.
Chisholm, S.T., Coaker, G., Day, B., and Staskawicz, B.J. (2006). Host-microbe interactions:shaping the evolution of the plant immune response. Cell 124, 803-814.
Dereeper, A., Guignon, V., Blanc, G., Audic, S., Buffet, S., Chevenet, F., Dufayard,J.F.,Guindon, S., Lefort, V., Lescot, M., Claverie, J.M., and Gascuel, O. (2008). Phylogeny.fr:robust phylogenetic analysis for the non-specialist. Nucleic Acids Res. 36,W465-9.
Du, L., and Chen, Z. (2000). Identification of genes encoding receptor-like protein kinases aspossible targets of pathogen- and salicylic acid-induced WRKY DNA-binding proteins inArabidopsis. The Plant Journal 24, 837-847.
Dubouzet, J.G., Maeda, S., Sugano, S., Ohtake, M., Hayashi, N., Ichikawa, T., Kondou, Y.,Kuroda, H., Horii, Y., Matsui, M., et al. (2011). Screening for resistance against Pseudomonassyringae in rice-FOX Arabidopsis lines identified a putative receptor-like cytoplasmic kinasegene that confers resistance to major bacterial and fungal pathogens in Arabidopsis and rice.Plant. Biotechnol. J. 9, 466-485.
Gomez-Gomez, L., and Boller, T. (2000). FLS2: An LRR Receptor–like Kinase Involved in thePerception of the Bacterial Elicitor Flagellin in Arabidopsis. Mol. Cell 5, 1003-1011.
Hofmann, K., and Stofell, W. (1993). TMpred - Prediction of Transmembrane Regions andOrientation. Biol. Chem. Hoppe-Seyler 374,
Kim, J.G., Li, X., Roden, J.A., Taylor, K.W., Aakre, C.D., Su, B., Lalonde, S., Kirik, A., Chen,Y., Baranage, G., et al. (2009). Xanthomonas T3S Effector XopN Suppresses PAMP-TriggeredImmunity and Interacts with a Tomato Atypical Receptor-Like Kinase and TFT1. Plant Cell 21,1305-1323.
Lu, D., Wu, S., Gao, X., Zhang, Y., Shan, L., and He, P. (2010). A receptor-like cytoplasmickinase, BIK1, associates with a flagellin receptor complex to initiate plant innate immunity.Proc. Natl. Acad. Sci. U. S. A. 107, 496-501.
Meyer, M.R., Lichti, C.F., Townsend, R.R., and Rao, A.G. (2011). Identification of in vitroautophosphorylation sites and effects of phosphorylation on the Arabidopsis CRINKLY4 (ACR4)receptor-like kinase intracellular domain: insights into conformation, oligomerization, andactivity. Biochemistry 50, 2170-2186.
87
Miya, A., Albert, P., Shinya, T., Desaki, Y., Ichimura, K., Shirasu, K., Narusaka, Y., Kawakami,N., Kaku, H., and Shibuya, N. (2007). CERK1, a LysM receptor kinase, is essential for chitinelicitor signaling in Arabidopsis. Proc. Natl. Acad. Sci. U. S. A. 104, 19613-19618.
Nemoto, K., Seto, T., Takahashi, H., Nozawa, A., Seki, M., Shinozaki, K., Endo, Y., andSawasaki, T. (2011). Autophosphorylation profiling of Arabidopsis protein kinases using thecell-free system. Phytochemistry 72, 1136-1144.
Pandey, S.P., and Somssich, I.E. (2009). The role of WRKY transcription factors in plantimmunity. Plant Physiol. 150, 1648-1655.
Ramakers, C., Ruijter, J.M., Deprez, R.H., and Moorman, A.F. (2003). Assumption-free analysisof quantitative real-time polymerase chain reaction (PCR) data. Neurosci. Lett. 339, 62-66.
Ramonell, K., Berrocal-Lobo, M., Koh, S., Wan, J., Edwards, H., Stacey, G., and Somerville, S.(2005). Loss-of-function mutations in chitin responsive genes show increased susceptibility tothe powdery mildew pathogen Erysiphe cichoracearum. Plant Physiol. 138, 1027-1036.
Reddy, M.M., and Rajasekharan, R. (2006). Role of threonine residues in the regulation ofmanganese-dependent arabidopsis serine/threonine/tyrosine protein kinase activity. Arch.Biochem. Biophys. 455, 99-109.
Rodriguez, M.C., Petersen, M., and Mundy, J. (2010). Mitogen-activated protein kinasesignaling in plants. Annu. Rev. Plant. Biol. 61, 621-649.
Rudrabhatla, P., and Rajasekharan, R. (2002). Developmentally regulated dual-specificity kinasefrom peanut that is induced by abiotic stresses. Plant Physiol. 130, 380-390.
Shen, Q.H., Saijo, Y., Mauch, S., Biskup, C., Bieri, S., Keller, B., Seki, H., Ulker, B., Somssich,I.E., and Schulze-Lefert, P. (2007). Nuclear activity of MLA immune receptors links isolate-specific and basal disease-resistance responses. Science 315, 1098-1103.
Shimizu, T., Nakano, T., Takamizawa, D., Desaki, Y., Ishii-Minami, N., Nishizawa, Y., Minami,E., Okada, K., Yamane, H., Kaku, H., and Shibuya, N. (2010). Two LysM receptor molecules,CEBiP and OsCERK1, cooperatively regulate chitin elicitor signaling in rice. Plant J. 64, 204-214.
Shiu, S.H., and Bleecker, A.B. (2001). Receptor-like kinases from Arabidopsis form amonophyletic gene family related to animal receptor kinases. Proc. Natl. Acad. Sci. U. S. A. 98,10763-10768.
Shiu, S.H., Karlowski, W.M., Pan, R., Tzeng, Y.H., Mayer, K.F., and Li, W.H. (2004).Comparative analysis of the receptor-like kinase family in Arabidopsis and rice. Plant Cell 16,1220-1234.
88
Tena, G., Boudsocq, M., and Sheen, J. (2011). Protein kinase signaling networks in plant innateimmunity. Curr. Opin. Plant Biol.
Veronese, P., Nakagami, H., Bluhm, B., Abuqamar, S., Chen, X., Salmeron, J., Dietrich, R.A.,Hirt, H., and Mengiste, T. (2006). The membrane-anchored BOTRYTIS-INDUCED KINASE1plays distinct roles in Arabidopsis resistance to necrotrophic and biotrophic pathogens. Plant Cell18, 257-273.
Wan, J., Zhang, S., and Stacey, G. (2004). Activation of a mitogen-activated protein kinasepathway in Arabidopsis by chitin. Mol. Plant. Pathol. 5, 125-135.
Wan, J., Zhang, X.C., Neece, D., Ramonell, K.M., Clough, S., Kim, S.Y., Stacey, M.G., andStacey, G. (2008). A LysM receptor-like kinase plays a critical role in chitin signaling and fungalresistance in Arabidopsis. Plant Cell 20, 471-481.
Wan, J., Zhang, X.C., and Stacey, G. (2008). Chitin signaling and plant disease resistance. Plant.Signal. Behav. 3, 831-833.
Wilson, I.W., Schiff, C.L., Hughes, D.E., and Somerville, S.C. (2001). Quantitative trait locianalysis of powdery mildew disease resistance in the Arabidopsis thaliana accession kashmir-1.Genetics 158, 1301-1309.
Xing, D.H., Lai, Z.B., Zheng, Z.Y., Vinod, K.M., Fan, B.F., and Chen, Z.X. (2008). Stress- andpathogen-induced Arabidopsis WRKY48 is a transcriptional activator that represses plant basaldefense. Mol. Plant. 1, 459-470.
Xu, X., Chen, C., Fan, B., and Chen, Z. (2006). Physical and functional interactions betweenpathogen-induced Arabidopsis WRKY18, WRKY40, and WRKY60 transcription factors. PlantCell 18, 1310-1326.
Yi, S.Y., Lee, D.J., Yeom, S.I., Yoon, J., Kim, Y.H., Kwon, S.Y., and Choi, D. (2010). A novelpepper (Capsicum annuum) receptor-like kinase functions as a negative regulator of plant celldeath via accumulation of superoxide anions. New Phytol. 185, 701-715.
Zhang, X., Henriques, R., Lin, S.S., Niu, Q.W., and Chua, N.H. (2006). Agrobacterium-mediatedtransformation of Arabidopsis thaliana using the floral dip method. Nat. Protoc. 1, 641-646.
Zimmermann, P., Hennig, L., and Gruissem, W. (2005). Gene-expression analysis and networkdiscovery using Genevestigator. Trends Plant Sci. 10, 407-409.
Zipfel, C. (2009). Early molecular events in PAMP-triggered immunity. Curr. Opin. Plant Biol.12, 414-420.
Zipfel, C., Robatzek, S., Navarro, L., Oakeley, E.J., Jones, J.D., Felix, G., and Boller, T. (2004).Bacterial disease resistance in Arabidopsis through flagellin perception. Nature 428, 764-767.
89
CHAPTERCHAPTERCHAPTERCHAPTER FOURFOURFOURFOUR
SUMMARYSUMMARYSUMMARYSUMMARYOFOFOFOFWORKWORKWORKWORKANDANDANDAND FUTUREFUTUREFUTUREFUTURE DIRECTIONSDIRECTIONSDIRECTIONSDIRECTIONS
SUMMARYSUMMARYSUMMARYSUMMARYOFOFOFOFWORKWORKWORKWORK
In this dissertation, we report the identification and characterization of CRLK1 a
receptor-like kinase that is involved in Arabidopsis innate immunity. We have shown that
CRLK1 is critical in Arabidopsis defense against the biotrophic fungi G. cichoracearum and the
necrotrophic fungal pathogen P. cucumerina. Mutations in crlk1 result in plants that are more
susceptible to infections and that support significantly more conidiophores of G. cichoracearum
and leaf biomass of P. cucumerina than Col-0 wild type plants (Figure 2.1 and 2.2).
Overexpression of CRLK1 in Arabidopsis results in plants that are highly resistant to G.
cichoracearum (Figure 3.4). However, our data indicate that CRLK1 is not involved resistance
to bacterial pathogens since there is no significant difference between the response of crlk1
mutants and Col-0 wild type plants when inoculated with Pst DC3000 (Figure 2S1). Expression
of CRLK1 can be induced by infection with various pathogens and by treatment with several
general defense elicitors such as chitin, flg22 and OG (Figure 3.5). Additionally, CRLK1
appears to be involved in early defense signaling as induction of CRLK1 is highest one hour post
chitin treatment and then drops rapidly to baseline levels after 4 hours (Figure 2.3A). We also
show that pretreatment of plants with chitin enhances the resistance to G. cichoracearum (Figure
3.4). Unlike CERK1, crlk1 mutants still displayed enhanced resistance after chitin pretreatment
indicating that mutation in CRLK1 does not fully block chitin-triggered signaling cascades. The
induction of CRLK1 transcripts after chitin treatment was increased in the mpk3 mutant and vice
90
versa suggesting that CRLK1 and MPK3 may suppress each other after chitin treatment (Figure
2.6 and 3.6). This may function as a backup mechanism if another defense pathway is blocked
by secreted pathogen effectors in order to make up for the lost pathway. The CRLK1 promoter
region contains 7 W-boxes that serve as binding sites for WRKY transcription factors, a class of
TF known to play important roles in regulating defense gene expression. CRLK1 induction by
chitin was higher in wrky6, -17, -48, -53 and -46 mutants suggesting that these WRKY
transcription factors may act as negative regulators for CRLK1 expression (Figure 3.6C). An in
vitro kinase assay showed that CRLK1 is a functional kinase and that its kinase activity is
dependent on Mn2+ (Figure 3.3B). CRLK1 is able to both autophosphorylate itself and to
phosphorylate the artificial substrate myelin basic protein in vitro (Figure 3.3B). In planta,
CRLK1 is localized to the plasma membrane (PM) and the first 30 amino acids are critical for
correct targeting to the PM (Figure 2.4 B-E). Bimolecular fluorescence complementation (BiFC)
showed that CRLK1 did not interact with either the chitin receptor CERK1 or with itself to form
homodimers (Data not shown). However, the data does not rule out the possibility that CRLK1
may interact with other RLKs or RLPs to activate downstream signaling pathways. Expression
of GUS driven by CRLK1’s native promoter showed that CRLK1 is mainly expressed in the
vasculature and flowers of Arabidopsis (Figure 2.5).
Based on the results above, we propose a model for CRLK1 activity in chitin-mediated
signaling and defense. As shown in figure 4.1, upon chitin treatment or fungal pathogen infection
CERK1 binds chitin oligomers and is phosphorylated in order to activate multiple downstream
signaling pathways (Petutschnig et al. 2010; Figure 4.1 Step 1). One of the activated pathways
operates throughMPK3 and WRKY transcription factors, which then feedback to repress further
induction of CRLK1 after chitin treatment (Figure 4.1 Step 2). Another possibility is that an
91
unknown pathway operating through unknown kinases and transcription factors activates the
expression of CRLK1 (Figure 4.1 Step 3). After the CRLK1 protein is synthesized, it is targeted
to the plasma membrane, where it may interact with unidentified receptor-like proteins or kinases.
CRLK1 may undergo autophosphorylation or be phosphorylated by other kinases for activation
and it then goes on to trigger defense signaling leading to defense gene expression (Figure 4.1
Step 4).
FUTUREFUTUREFUTUREFUTURE DIRECTIONSDIRECTIONSDIRECTIONSDIRECTIONS
DissectingDissectingDissectingDissecting CRLK1CRLK1CRLK1CRLK1 functionfunctionfunctionfunction viaviaviavia aaaa seriesseriesseriesseries ofofofof allelicallelicallelicallelic mutantsmutantsmutantsmutants
Although two different T-DNA insertional mutants in CRLK1 have been tested for their
susceptibility to powdery mildew, more crlk1 mutants are needed for more complete dissection
of CRLK1 function. Crlk1-1 and crlk1-2 are homozygous mutants with T-DNA insertions in
only one exon of CRLK1 locus that both generate a null mutation. In order to further explore
CRLK1 function, a series of point mutations can be generated in the CRLK1 exon via Targeting
Induced Local Lesions IN Genomes (TILLING; Bush and Krysan 2010). Custom TILLING in
genes of interest is commercially available through the Seattle Arabidopsis TILLING Project and
one can get mutants within 4 months (http://tilling.fhcrc.org/). With a series of CRLK1 mutant
alleles, one could challenge the mutants with powdery mildew to determine the susceptibility and
resistance phenotypes compared to Col-0 wild type and the original crlk1 knockout mutants.
Four phenotypes can be anticipated: highly susceptible, partial susceptibility, wild-type
phenotype (weak susceptibility) and resistant. After correlating the phenotypes with the
particular amino acid mutated, one can study the roles of specific amino acids in CRLK1
function. For example, mutations in critical phosphorylation sites (Serine, Tyrosine and
92
Threonine) in CRLK1 may render plants very susceptible when infected by powdery mildew. In
contrast, gain-of-function mutations in certain amino acids may create a constitutively activated
kinase. For example, a mutation in SNC2-1D (suppressor of npr1-1, constitutive 2)
transmembrane domain resulted in semi-dominant mutants that constantly activate Arabidopsis
defense responses (Zhang et al. 2010). Changing an alanine to a threonine in the SNC4-1D
(suppressor of npr1-1, constitutive4-1D) kinase domain also caused constitutive activation of the
receptor-like kinase (Bi et al. 2010). To dissect whether there is cross-talk between CRLK1 and
other defense pathways, double mutants could also be created by crossing the crlk1 TILLING
mutants and mutants in other well-defined defense pathways such as npr1 and pad4 (Salicylic
acid-mediated defense), etr1 (Ethylene-mediated defense) and jar1 (Jasmonic acid-mediated
defense) and then challenging them with powdery mildew to determine resistance phenotypes.
EMSEMSEMSEMS ScreenScreenScreenScreen andandandandMap-basedMap-basedMap-basedMap-based cloningcloningcloningcloning totototo identifyidentifyidentifyidentify suppressorssuppressorssuppressorssuppressors ofofofof crlk1crlk1crlk1crlk1
In Chapter two, CRLK1 was shown to play an important role in defense against
biotrophic and necrotrophic fungal pathogens. However, nothing is known about genes that may
regulate CRLK1 during defense responses. Plant defense responses are fine-tuned by both
positive and negative regulators to restrict pathogen attack. In order to identify genes that
potentially regulate CRLK1, crlk1 mutants seeds can be treated with ethyl methanesulfonate
(EMS) and progeny screened for secondary mutations that reverse the original phenotype
(suppressor screening). These secondary mutations can be identified via map-based cloning
within one year based on current protocols (Jander et al. 2002). After suppressors of crlk1
(scrlk1 for short) are identified, experiments can be carried out to elucidate the functions of the
new genes such as:
93
1. T-DNA mutants can be obtained for each new gene identified and tested for their
resistance to powdery mildew. Double mutants can then be made by crossing crlk1 and scrlk1
and a subsequent round of testing with powdery mildew to confirm whether scrlk1 can reverse
the original crlk1 phenotype.
2. SCRLK1 candidates can be characterized in many ways. Bimolecular fluorescence
complementation and co-immunoprecipitation can be used to determine whether CRLK1 and
SCRLK1 interact with each other directly. To determine whether SCRLK1 is co-expressed with
CRLK1 after chitin treatment, SCRLK1 gene expression can be monitored by quantitative real-
time PCR in a series of time-course experiments after chitin treatment. The expression of
SCRLK1 in Arabidopsis can also be studied via generating transgenic Arabidopsis lines that
express pSCRLK1::GUS.
DetermineDetermineDetermineDetermine thethethethe phosphorylationphosphorylationphosphorylationphosphorylation statusstatusstatusstatus andandandand sitessitessitessites inininin vivovivovivovivo afterafterafterafter treatmenttreatmenttreatmenttreatment withwithwithwith chitinchitinchitinchitin ororororinfectioninfectioninfectioninfection withwithwithwith powderypowderypowderypowdery mildewmildewmildewmildew
I have shown that CRLK1 is induced early in the chitin-mediated defense response in a
time-course experiment (Chapter two). However, little is known about the expression levels of
the CRLK1 protein after chitin treatment or powdery mildew infection. Previously, I generated
an antibody against CRLK1’s cytoplasmic kinase domain. Western blot assays can be used to
quantify CRLK1 protein levels post chitin treatment and powdery mildew inoculation. To study
phosphorylation status and sites after treatment or infection, CRLK1 can be immunoprecipitated
from Arabidopsis liquid cell culture after chitin treatment. The CRLK1 protein eluted can be
analyzed by SDS-PAGE, excised and then digested with trypsin. After enrichment of the
phospho-peptide(s), samples could then be subjected to mass spectrometry for analysis as
described by Wang et al. (2005). To study the effects of critical amino acids on CRLK1
94
autophosphorylation, a series of mutant proteins could be generated via site-directed mutagenesis
and then analyzed for kinase activity using in vitro kinase assays (Chapter three). Combined
with allelic mutants generated by TILLING, critical amino acids could be identified and their
effects on kinase activity and plant immunity elucidated.
CreateCreateCreateCreate powderypowderypowderypowdery mildewmildewmildewmildew resistantresistantresistantresistant transgenictransgenictransgenictransgenic cropscropscropscrops bybybyby exogenouslyexogenouslyexogenouslyexogenously overexpressingoverexpressingoverexpressingoverexpressing CRLK1CRLK1CRLK1CRLK1
Powdery mildew severely affects yield of many crops such as tomato, soybean, potato
and numerous cereal crops. Lacombe et al (2010) reported that transferring a PRR from
Arabidopsis to tomato and Nicotiana benthamiana generated broad-spectrum defense to a
pathogenic bacterium (Lacombe et al. 2010). Similarly, exogenous overexpression of CRLK1 in
crop plants may increase plant defense and generate broad-spectrum resistance to not only
powdery mildew but other fungal pathogens. In Chapter three, I constructed CRLK1
overexpression plants in a T-DNA binary vector that expressed a 35S:CRLK1: GUS fusion
protein. The same or similar vector could be used for transformation of cereal crops, maize and
soybean via Agrobacterium tumefaciens (Shrawat and Good 2011; Ishida et al. 2007; Ko et al.
2006) and selection of transformants would be relatively easy by screening for GUS activity in
the plants. The transgenic crops generated could then be tested for their resistance to powdery
mildew and their fungal pathogens.
IdentificationIdentificationIdentificationIdentification ofofofof CRLK1CRLK1CRLK1CRLK1 interactorsinteractorsinteractorsinteractors viaviaviavia yeastyeastyeastyeast twotwotwotwo hybridhybridhybridhybrid andandandandMassMassMassMass SpectrometrySpectrometrySpectrometrySpectrometry
Receptor-like kinases do not act alone in the activation of plant defense pathways. Many
proteins may be involved and/or associated with RLKs before or after perception of the pathogen.
An example is that of the Arabidopsis BAK1 kinase that can associate with many RLKs
95
including FLS2, BRI1, PEPR1 and PEPR2 (reviewed by Postel et al. 2010). Thus identification
of interactors is an important way to elucidate the precise mechanism of CRLK1 activity. There
are two methods that might be used to identify CRLK1 associated protein(s).
1. Yeast two hybrid analysis can be used to screen a large number of genes that may
interact with CRLK1. Due to the limitations of this technique, a high number of false positives
are to be expected. I have cloned CRLK1’s cytoplasmic kinase domain into the yeast-two-hybrid
bait vector pAS1 and the vector is ready for yeast transformation. Co-immunoprecipitation
experiments (Co-IP) can be carried out to confirm the interactions in planta.
2. In order to elucidate CRLK1 interactors in Arabidopsis, tandem affinity purification
(TAP) and MS would be suitable to study dynamic protein-protein interaction in time course
experiments after chitin treatment (Leene et al. 2011). In these experiments, CRLK1 will be
cloned into the Gateway compatible vector pKNGSTAP, which contains GS tag (tag based on
protein G with streptavidin-binding peptide) fused to a target open reading frame (ORF) (Van
Leene et al. 2011). Stable transgenic Arabidopsis expressing CRLK1-GS will be generated via
Agrobacterium-mediated transformation (Zhang et al. 2006). Arabidopsis liquid cell culture can
then be treated with chitin and then extracted for total protein that is then subjected to tandem
affinity purification. Protein complexes are concentrated and then resolved on NuPAGE gels
(Invitrogen) to separate proteins from complexes. Each protein band can then be excised and
subjected to matrix-assisted laser desorption/ionization (MALDI) tandem MS as described by
Van Leene et al (2011).
96
Chitin
CERK1 PPPP
LysM domain
kinase domain
CRLK1
?
TFs
? MPK (eg., MPK3)
WRKY TFs
?
Expression ofdefense genes
�
�
� �
unknown RLK?
Defense responses
MPKKK (eg., MEKK1)
MPKK (eg., MKK4/5)
CRLK1 gene expression
FigureFigureFigureFigure 4.14.14.14.1.... ModelModelModelModel ofofofof CRLK1CRLK1CRLK1CRLK1 inininin chitin-mediatedchitin-mediatedchitin-mediatedchitin-mediated innateinnateinnateinnate immunity.immunity.immunity.immunity. 1. CERK1 isphosphorylated upon chitin treatment. 2. Activated CERK1 triggers a MPK signaling pathway.3. CERK1 may activate an unknown signaling pathway that induces expression of CRLK1. 4.CRLK1 activates defense responses or expression of defense genes through as yetuncharacterized signaling partners.
97
REFERENCESREFERENCESREFERENCESREFERENCES
Abuqamar, S., Chai, M.F., Luo, H., Song, F., and Mengiste, T. (2008). Tomato protein kinase 1bmediates signaling of plant responses to necrotrophic fungi and insect herbivory. Plant Cell 20,1964-1983.
Adie, B.A., Perez-Perez, J., Perez-Perez, M.M., Godoy, M., Sanchez-Serrano, J.J., Schmelz, E.A.,and Solano, R. (2007). ABA is an essential signal for plant resistance to pathogens affecting JAbiosynthesis and the activation of defenses in Arabidopsis. Plant Cell 19, 1665-1681.
Bar, M., Sharfman, M., Ron, M., and Avni, A. (2010). BAK1 is required for the attenuation ofethylene-inducing xylanase (Eix)-induced defense responses by the decoy receptor LeEix1. PlantJ. 63, 791-800.
Belfanti, E., Silfverberg-Dilworth, E., Tartarini, S., Patocchi, A., Barbieri, M., Zhu, J., Vinatzer,B.A., Gianfranceschi, L., Gessler, C., and Sansavini, S. (2004). The HcrVf2 gene from a wildapple confers scab resistance to a transgenic cultivated variety. Proc. Natl. Acad. Sci. U. S. A.101, 886-890.
Bi, D., Cheng, Y.T., Li, X., and Zhang, Y. (2010). Activation of plant immune responses by again-of-function mutation in an atypical receptor-like kinase. Plant Physiol. 153, 1771-1779.
Bleckmann, A., Weidtkamp-Peters, S., Seidel, C.A., and Simon, R. (2010). Stem cell signaling inArabidopsis requires CRN to localize CLV2 to the plasma membrane. Plant Physiol. 152, 166-176.
Brutus, A., Sicilia, F., Macone, A., Cervone, F., and De Lorenzo, G. (2010). A domain swapapproach reveals a role of the plant wall-associated kinase 1 (WAK1) as a receptor ofoligogalacturonides. Proc. Natl. Acad. Sci. U. S. A. 107, 9452-9457.
Bush, S.M., and Krysan, P.J. (2010). iTILLING: a personalized approach to the identification ofinduced mutations in Arabidopsis. Plant Physiol. 154, 25-35.
Chaparro-Garcia, A., Wilkinson, R.C., Gimenez-Ibanez, S., Findlay, K., Coffey, M.D., Zipfel, C.,
Decreux, A., and Messiaen, J. (2005). Wall-associated kinase WAK1 interacts with cell wallpectins in a calcium-induced conformation. Plant Cell Physiol. 46, 268-278.
98
Decreux, A., Thomas, A., Spies, B., Brasseur, R., Van Cutsem, P., and Messiaen, J. (2006). Invitro characterization of the homogalacturonan-binding domain of the wall-associated kinaseWAK1 using site-directed mutagenesis. Phytochemistry 67, 1068-1079.
Denoux, C., Galletti, R., Mammarella, N., Gopalan, S., Werck, D., De Lorenzo, G., Ferrari, S.,Ausubel, F.M., and Dewdney, J. (2008). Activation of defense response pathways by OGs andFlg22 elicitors in Arabidopsis seedlings. Mol. Plant. 1, 423-445.
Dubouzet, J.G., Maeda, S., Sugano, S., Ohtake, M., Hayashi, N., Ichikawa, T., Kondou, Y.,Kuroda, H., Horii, Y., Matsui, M., et al. (2010). Screening for resistance against Pseudomonassyringae in rice-FOX Arabidopsis lines identified a putative receptor-like cytoplasmic kinasegene that confers resistance to major bacterial and fungal pathogens in Arabidopsis and rice.Plant. Biotechnol. J.
Enkerli, J., Felix, G., and Boller, T. (1999). The enzymatic activity of fungal xylanase is notnecessary for its elicitor activity. Plant Physiol. 121, 391-397.
Fradin, E.F., Zhang, Z., Juarez Ayala, J.C., Castroverde, C.D., Nazar, R.N., Robb, J., Liu, .M.,and Thomma, B.P. (2009). Genetic dissection of Verticillium wilt resistance mediated by tomatoVe1. Plant Physiol. 150, 320-332.
Fritz-Laylin, L.K., Krishnamurthy, N., Tor, M., Sjolander, K.V., and Jones, J.D. (2005).Phylogenomic analysis of the receptor-like proteins of rice and Arabidopsis. Plant Physiol. 138,611-623.
Gao, M., Wang, X., Wang, D., Xu, F., Ding, X., Zhang, Z., Bi, D., Cheng, Y.T., Chen, S., Li, X.,and Zhang, Y. (2009). Regulation of cell death and innate immunity by two receptor-like kinasesin Arabidopsis. Cell. Host Microbe 6, 34-44.
Gimenez-Ibanez, S., Hann, D.R., Ntoukakis, V., Petutschnig, E., Lipka, V., and Rathjen, J.P.(2009). AvrPtoB targets the LysM receptor kinase CERK1 to promote bacterial virulence onplants. Curr. Biol. 19, 423-429.
Godiard, L., Sauviac, L., Torii, K.U., Grenon, O., Mangin, B., Grimsley, N.H., and Marco, Y.(2003). ERECTA, an LRR receptor-like kinase protein controlling development pleiotropicallyaffects resistance to bacterial wilt. Plant J. 36, 353-365.
Gomez-Gomez, L., and Boller, T. (2000). FLS2: an LRR receptor-like kinase involved in theperception of the bacterial elicitor flagellin in Arabidopsis. Mol. Cell 5, 1003-1011.
Gou, X., He, K., Yang, H., Yuan, T., Lin, H., Clouse, S.D., and Li, J. (2010). Genome-widecloning and sequence analysis of leucine-rich repeat receptor-like protein kinase genes inArabidopsis thaliana. BMC Genomics 11, 19.
Govers, F., and Angenent, G.C. (2010). Plant science. Fertility goddesses as Trojan horses.Science 330, 922-923.
99
Heese, A., Hann, D.R., Gimenez-Ibanez, S., Jones, A.M., He, K., Li, J., Schroeder, J.I., Peck,S.C., and Rathjen, J.P. (2007). The receptor-like kinase SERK3/BAK1 is a central regulator ofinnate immunity in plants. Proc. Natl. Acad. Sci. U. S. A. 104, 12217-12222.
Huffaker, A., Dafoe, N.J., and Schmelz, E.A. (2011). ZmPep1, an Ortholog of ArabidopsisElicitor Peptide 1, Regulates Maize Innate Immunity and Enhances Disease Resistance. PlantPhysiol.
Huffaker, A., Pearce, G., and Ryan, C.A. (2006). An endogenous peptide signal in Arabidopsisactivates components of the innate immune response. Proc. Natl. Acad. Sci. U. S. A. 103, 10098-10103.
Iizasa, E., Mitsutomi, M., and Nagano, Y. (2010). Direct binding of a plant LysM receptor-likekinase, LysM RLK1/CERK1, to chitin in vitro. J. Biol. Chem. 285, 2996-3004.
Ishida, Y., Hiei, Y., and Komari, T. (2007). Agrobacterium-mediated transformation of maize.Nat. Protoc. 2, 1614-1621.
Jander, G., Norris, S.R., Rounsley, S.D., Bush, D.F., Levin, I.M., and Last, R.L. (2002).Arabidopsis map-based cloning in the post-genome era. Plant Physiol. 129, 440-450.
Jurca, M.E., Bottka, S., and Feher, A. (2008). Characterization of a family of Arabidopsisreceptor-like cytoplasmic kinases (RLCK class VI). Plant Cell Rep. 27, 739-748.
Kaku, H., Nishizawa, Y., Ishii-Minami, N., Akimoto-Tomiyama, C., Dohmae, N., Takio, K.,Minami, E., and Shibuya, N. (2006). Plant cells recognize chitin fragments for defense signalingthrough a plasma membrane receptor. Proc. Natl. Acad. Sci. U. S. A. 103, 11086-11091.
Kanzaki, H., Saitoh, H., Takahashi, Y., Berberich, T., Ito, A., Kamoun, S., and Terauchi, R.(2008). NbLRK1, a lectin-like receptor kinase protein of Nicotiana benthamiana, interacts withPhytophthora infestans INF1 elicitin and mediates INF1-induced cell death. Planta 228, 977-987.
Keinath, N.F., Kierszniowska, S., Lorek, J., Bourdais, G., Kessler, S.A., Shimosato-Asano, H.,Grossniklaus, U., Schulze, W.X., Robatzek, S., and Panstruga, R. (2010). PAMP (pathogen-associated molecular pattern)-induced changes in plasma membrane compartmentalization revealnovel components of plant immunity. J. Biol. Chem. 285, 39140-39149.
Kessler, S.A., Shimosato-Asano, H., Keinath, N.F., Wuest, S.E., Ingram, G., Panstruga, R., andGrossniklaus, U. (2010). Conserved molecular components for pollen tube reception and fungalinvasion. Science 330, 968-971.
Kim, H.S., Jung, M.S., Lee, S.M., Kim, K.E., Byun, H., Choi, M.S., Park, H.C., Cho, M.J., andChung, W.S. (2009). An S-locus receptor-like kinase plays a role as a negative regulator in plantdefense responses. Biochem. Biophys. Res. Commun. 381, 424-428.
100
Kim, J.G., Li, X., Roden, J.A., Taylor, K.W., Aakre, C.D., Su, B., Lalonde, S., Kirik, A., Chen,Y., Baranage, G., et al. (2009). Xanthomonas T3S Effector XopN Suppresses PAMP-TriggeredImmunity and Interacts with a Tomato Atypical Receptor-Like Kinase and TFT1. Plant Cell 21,1305-1323.
Kishimoto, K., Kouzai, Y., Kaku, H., Shibuya, N., Minami, E., and Nishizawa, Y. (2010).Perception of the chitin oligosaccharides contributes to disease resistance to blast fungusMagnaporthe oryzae in rice. Plant J. 64, 343-354.
Ko, T.S., Korban, S.S., and Somers, D.A. (2006). Soybean (Glycine max) transformation usingimmature cotyledon explants. Methods Mol. Biol. 343, 397-405.
Krol, E., Mentzel, T., Chinchilla, D., Boller, T., Felix, G., Kemmerling, B., Postel, S., Arents, M.,Jeworutzki, E., Al-Rasheid, K.A., Becker, D., and Hedrich, R. (2010). Perception of theArabidopsis danger signal peptide 1 involves the pattern recognition receptor AtPEPR1 and itsclose homologue AtPEPR2. J. Biol. Chem. 285, 13471-13479.
Lacombe, S., Rougon-Cardoso, A., Sherwood, E., Peeters, N., Dahlbeck, D., van Esse, H.P.,Smoker, M., Rallapalli, G., Thomma, B.P., Staskawicz, B., Jones, J.D., and Zipfel, C. (2010).Interfamily transfer of a plant pattern-recognition receptor confers broad-spectrum bacterialresistance. Nat. Biotechnol. 28, 365-369.
Lee, S.W., Han, S.W., Sririyanum, M., Park, C.J., Seo, Y.S., and Ronald, P.C. (2009). A type I-secreted, sulfated peptide triggers XA21-mediated innate immunity. Science 326, 850-853.
Li, H., Zhou, S.Y., Zhao, W.S., Su, S.C., and Peng, Y.L. (2009). A novel wall-associatedreceptor-like protein kinase gene, OsWAK1, plays important roles in rice blast disease resistance.Plant Mol. Biol. 69, 337-346.
Li, J., and Chory, J. (1997). A putative leucine-rich repeat receptor kinase involved inbrassinosteroid signal transduction. Cell 90, 929-938.
Liu, J., Elmore, J.M., Lin, Z.J., and Coaker, G. (2011). A Receptor-like Cytoplasmic KinasePhosphorylates the Host Target RIN4, Leading to the Activation of a Plant Innate ImmuneReceptor. Cell. Host Microbe 9, 137-146.
Liu, P., Wei, W., Ouyang, S., Zhang, J.S., Chen, S.Y., and Zhang, W.K. (2009). Analysis ofexpressed receptor-like kinases (RLKs) in soybean. J. Genet. Genomics 36, 611-619.
Llorente, F., Alonso-Blanco, C., Sanchez-Rodriguez, C., Jorda, L., and Molina, A. (2005).ERECTA receptor-like kinase and heterotrimeric G protein from Arabidopsis are required forresistance to the necrotrophic fungus Plectosphaerella cucumerina. Plant J. 43, 165-180.
Lu, D., Wu, S., Gao, X., Zhang, Y., Shan, L., and He, P. (2010). A receptor-like cytoplasmickinase, BIK1, associates with a flagellin receptor complex to initiate plant innate immunity.Proc. Natl. Acad. Sci. U. S. A. 107, 496-501.
101
Malnoy, M., Xu, M., Borejsza-Wysocka, E., Korban, S.S., and Aldwinckle, H.S. (2008). Tworeceptor-like genes, Vfa1 and Vfa2, confer resistance to the fungal pathogen Venturia inaequalisinciting apple scab disease. Mol. Plant Microbe Interact. 21, 448-458.
Miya, A., Albert, P., Shinya, T., Desaki, Y., Ichimura, K., Shirasu, K., Narusaka, Y., Kawakami,N., Kaku, H., and Shibuya, N. (2007). CERK1, a LysM receptor kinase, is essential for chitinelicitor signaling in Arabidopsis. Proc. Natl. Acad. Sci. U. S. A. 104, 19613-19618.
Nurnberger, T., and Scheel, D. (2001). Signal transmission in the plant immune response. TrendsPlant Sci. 6, 372-379.
Oerke, E.-., and Dehne, H.-. (2004). Safeguarding production—losses in major crops and the roleof crop protection. Crop Protection 23, 275-285.
Osakabe, K., Osakabe, Y., and Toki, S. (2010). Site-directed mutagenesis in Arabidopsis usingcustom-designed zinc finger nucleases. Proc. Natl. Acad. Sci. U. S. A. 107, 12034-12039.
Peng, H., Zhang, Q., Li, Y., Lei, C., Zhai, Y., Sun, X., Sun, D., Sun, Y., and Lu, T. (2009). Aputative leucine-rich repeat receptor kinase, OsBRR1, is involved in rice blast resistance. Planta230, 377-385.
Petutschnig, E.K., Jones, A.M., Serazetdinova, L., Lipka, U., and Lipka, V. (2010). The lysinmotif receptor-like kinase (LysM-RLK) CERK1 is a major chitin-binding protein in Arabidopsisthaliana and subject to chitin-induced phosphorylation. J. Biol. Chem. 285, 28902-28911.
Postel, S., and Kemmerling, B. (2009). Plant systems for recognition of pathogen-associatedmolecular patterns. Semin. Cell Dev. Biol. 20, 1025-1031.
Postel, S., Kufner, I., Beuter, C., Mazzotta, S., Schwedt, A., Borlotti, A., Halter, T., Kemmerling,B., and Nurnberger, T. (2010). The multifunctional leucine-rich repeat receptor kinase BAK1 isimplicated in Arabidopsis development and immunity. Eur. J. Cell Biol. 89, 169-174.
Qi, Y., Tsuda, K., Glazebrook, J., and Katagiri, F. (2011). Physical association of pattern-triggered immunity (PTI) and effector-triggered immunity (ETI) immune receptors inArabidopsis. Mol. Plant. Pathol.
Ribot, C., Hirsch, J., Balzergue, S., Tharreau, D., Notteghem, J.L., Lebrun, M.H., and Morel, J.B.(2008). Susceptibility of rice to the blast fungus, Magnaporthe grisea. J. Plant Physiol. 165, 114-124.
Ricci, P., Bonnet, P., Huet, J.C., Sallantin, M., Beauvais-Cante, F., Bruneteau, M., Billard, V.,Michel, G., and Pernollet, J.C. (1989). Structure and activity of proteins from pathogenic fungiPhytophthora eliciting necrosis and acquired resistance in tobacco. Eur. J. Biochem. 183, 555-563.
102
Ramonell, K., Berrocal-Lobo, M., Koh, S., Wan, J., Edwards, H., Stacey, G., and Somerville, S.(2005). Loss-of-function mutations in chitin responsive genes show increased susceptibility tothe powdery mildew pathogen Erysiphe cichoracearum. Plant Physiol. 138, 1027-1036.
Ramonell, K.M., Zhang, B., Ewing, R.M., Chen, Y., Xu, D., Stacey, G., and Somerville, S.(2002). Microarray analysis of chitin elicitation in Arabidopsis thaliana. Mol. Plant. Pathol. 3,301-311.
Ron, M., and Avni, A. (2004). The receptor for the fungal elicitor ethylene-inducing xylanase isa member of a resistance-like gene family in tomato. Plant Cell 16, 1604-1615.
Rowland, O., Ludwig, A.A., Merrick, C.J., Baillieul, F., Tracy, F.E., Durrant, W.E., Fritz-Laylin,L., Nekrasov, V., Sjolander, K., Yoshioka, H., and Jones, J.D. (2005). Functional analysis ofAvr9/Cf-9 rapidly elicited genes identifies a protein kinase, ACIK1, that is essential for full Cf-9-dependent disease resistance in tomato. Plant Cell 17, 295-310.
Sanchez-Rodriguez, C., Estevez, J.M., Llorente, F., Hernandez-Blanco, C., Jorda, L., Pagan, I.,Berrocal, M., Marco, Y., Somerville, S., and Molina, A. (2009). The ERECTA Receptor-LikeKinase Regulates Cell Wall-Mediated Resistance to Pathogens in Arabidopsis thaliana. Mol.Plant Microbe Interact. 22, 953-963.
Senes, A., Engel, D.E., and DeGrado, W.F. (2004). Folding of helical membrane proteins: therole of polar, GxxxG-like and proline motifs. Curr. Opin. Struct. Biol. 14, 465-479.
Shan, L., He, P., Li, J., Heese, A., Peck, S.C., Nurnberger, T., Martin, G.B., and Sheen, J. (2008).Bacterial effectors target the common signaling partner BAK1 to disrupt multiple MAMPreceptor-signaling complexes and impede plant immunity. Cell. Host Microbe 4, 17-27.
Shimizu, T., Nakano, T., Takamizawa, D., Desaki, Y., Ishii-Minami, N., Nishizawa, Y., Minami,E., Okada, K., Yamane, H., Kaku, H., and Shibuya, N. (2010). Two LysM receptor molecules,CEBiP and OsCERK1, cooperatively regulate chitin elicitor signaling in rice. Plant J. 64, 204-214.
Shiu, S.H., and Bleecker, A.B. (2001). Receptor-like kinases from Arabidopsis form amonophyletic gene family related to animal receptor kinases. Proc. Natl. Acad. Sci. U. S. A. 98,10763-10768.
Shiu, S.H., Karlowski, W.M., Pan, R., Tzeng, Y.H., Mayer, K.F., and Li, W.H. (2004).Comparative analysis of the receptor-like kinase family in Arabidopsis and rice. Plant Cell 16,1220-1234.
Shrawat, A.K., and Good, A.G. (2011). Agrobacterium tumefaciens-mediated genetictransformation of cereals using immature embryos. Methods Mol. Biol. 710, 355-372.
103
Song, D., Xi, W., Shen, J., Bi, T., and Li, L. (2011). Characterization of the plasma membraneproteins and receptor-like kinases associated with secondary vascular differentiation in poplar.Plant Mol. Biol.
Tanaka, S., Ichikawa, A., Yamada, K., Tsuji, G., Nishiuchi, T., Mori, M., Koga, H., Nishizawa,Y., O'Connell, R., and Kubo, Y. (2010). HvCEBiP, a gene homologous to rice chitin receptorCEBiP, contributes to basal resistance of barley to Magnaporthe oryzae. BMC Plant. Biol. 10,288.
Tsuda, K., Sato, M., Stoddard, T., Glazebrook, J., and Katagiri, F. (2009). Network properties ofrobust immunity in plants. PLoS Genet. 5, e1000772.
Van Leene, J., Eeckhout, D., Persiau, G., Van De Slijke, E., Geerinck, J., Van Isterdael, G.,Witters, E., and De Jaeger, G. (2011). Isolation of transcription factor complexes fromArabidopsis cell suspension cultures by tandem affinity purification. Methods Mol. Biol. 754,195-218.
Veronese, P., Nakagami, H., Bluhm, B., Abuqamar, S., Chen, X., Salmeron, J., Dietrich, R.A.,Hirt, H., and Mengiste, T. (2006). The membrane-anchored BOTRYTIS-INDUCED KINASE1plays distinct roles in Arabidopsis resistance to necrotrophic and biotrophic pathogens. Plant Cell18, 257-273.
Vij, S., Giri, J., Dansana, P.K., Kapoor, S., and Tyagi, A.K. (2008). The receptor-likecytoplasmic kinase (OsRLCK) gene family in rice: organization, phylogenetic relationship, andexpression during development and stress. Mol. Plant. 1, 732-750.
Wan, J., Zhang, X.C., Neece, D., Ramonell, K.M., Clough, S., Kim, S.Y., Stacey, M.G., andStacey, G. (2008). A LysM receptor-like kinase plays a critical role in chitin signaling and fungalresistance in Arabidopsis. Plant Cell 20, 471-481.
Wang, G., Ellendorff, U., Kemp, B., Mansfield, J.W., Forsyth, A., Mitchell, K., Bastas, K., Liu,C.M., Woods-Tor, A., Zipfel, C., et al. (2008). A genome-wide functional investigation into theroles of receptor-like proteins in Arabidopsis. Plant Physiol. 147, 503-517.
Wang, X., Goshe, M.B., Soderblom, E.J., Phinney, B.S., Kuchar, J.A., Li, J., Asami, T., Yoshida,S., Huber, S.C., and Clouse, S.D. (2005). Identification and functional analysis of in vivophosphorylation sites of the Arabidopsis BRASSINOSTEROID-INSENSITIVE1 receptor kinase.Plant Cell 17, 1685-1703.
Wang, G.L., Ruan, D.L., Song, W.Y., Sideris, S., Chen, L., Pi, L.Y., Zhang, S., Zhang, Z.,Fauquet, C., Gaut, B.S., Whalen, M.C., and Ronald, P.C. (1998). Xa21D encodes a receptor-likemolecule with a leucine-rich repeat domain that determines race-specific recognition and issubject to adaptive evolution. Plant Cell 10, 765-779.
104
Wang, G.L., Song, W.Y., Ruan, D.L., Sideris, S., and Ronald, P.C. (1996). The cloned gene,Xa21, confers resistance to multiple Xanthomonas oryzae pv. oryzae isolates in transgenic plants.Mol. Plant Microbe Interact. 9, 850-855.
Yamaguchi, Y., Huffaker, A., Bryan, A.C., Tax, F.E., and Ryan, C.A. (2010). PEPR2 is a secondreceptor for the Pep1 and Pep2 peptides and contributes to defense responses in Arabidopsis.Plant Cell 22, 508-522.
Yamaguchi, Y., Pearce, G., and Ryan, C.A. (2006). The cell surface leucine-rich repeat receptorfor AtPep1, an endogenous peptide elicitor in Arabidopsis, is functional in transgenic tobaccocells. Proc. Natl. Acad. Sci. U. S. A. 103, 10104-10109.
Zhang, F., Maeder, M.L., Unger-Wallace, E., Hoshaw, J.P., Reyon, D., Christian, M., Li, X.,Pierick, C.J., Dobbs, D., Peterson, T., Joung, J.K., and Voytas, D.F. (2010). High frequencytargeted mutagenesis in Arabidopsis thaliana using zinc finger nucleases. Proc. Natl. Acad. Sci.U. S. A. 107, 12028-12033.
Zhang, X., Henriques, R., Lin, S.S., Niu, Q.W., and Chua, N.H. (2006). Agrobacterium-mediatedtransformation of Arabidopsis thaliana using the floral dip method. Nat. Protoc. 1, 641-646.
Zhang, Y., Yang, Y., Fang, B., Gannon, P., Ding, P., Li, X., and Zhang, Y. (2010). Arabidopsissnc2-1D activates receptor-like protein-mediated immunity transduced through WRKY70. PlantCell 22, 3153-3163.
Zhou, H., Li, S., Deng, Z., Wang, X., Chen, T., Zhang, J., Chen, S., Ling, H., Zhang, A., Wang,D., and Zhang, X. (2007). Molecular analysis of three new receptor-like kinase genes fromhexaploid wheat and evidence for their participation in the wheat hypersensitive response tostripe rust fungus infection. Plant J. 52, 420-434.
Zipfel, C., Kunze, G., Chinchilla, D., Caniard, A., Jones, J.D., Boller, T., and Felix, G. (2006).Perception of the bacterial PAMP EF-Tu by the receptor EFR restricts Agrobacterium-mediatedtransformation. Cell 125, 749-760.
Zipfel, C., Robatzek, S., Navarro, L., Oakeley, E.J., Jones, J.D., Felix, G., and Boller, T. (2004).Bacterial disease resistance in Arabidopsis through flagellin perception. Nature 428, 764-767.